Your browser is old and dusty. Try Google Chrome!

Details for sll1512

ORF sll1512
Accession NP_440318.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_8 Forward -103 -86 9.08529 0.239
NP_441623.1_1 Reverse -14 -32 -4.8974 0.28
NP_441818.1_1 Reverse -169 -180 10.2846 0.232
NP_442169.1_1 Reverse -150 -169 -3.14714 0.29
NP_440996.1_4 Forward -141 -131 16.008 0.265
NP_442861.1_1 Forward -149 -130 12.9791 0.26
NP_440061.1_9 Forward -104 -90 10.2254 0.126
NP_442062.1_8 Forward -177 -167 5.87989 0.149
NP_442062.1_8 Reverse -93 -103 4.10993 0.232
NP_441900.1_2 Reverse -174 -192 -5.48809 0.288
NP_440304.1_4 Forward -179 -169 14.828 0.0466
NP_440044.1_8 Reverse -221 -240 -3.14714 0.28
NP_441200.1_4 Reverse -39 -58 6.78429 0.272
NP_441935.1_1 Forward -300 -281 6.68596 0.264
NP_441546.1_4 Forward -187 -168 11.8975 0.254
NP_442110.1_7 Forward -292 -278 4.52282 0.2
NP_442110.1_7 Forward -177 -163 3.53951 0.21
NP_441772.1_10 Forward -85 -66 12.6841 0.071
NP_441083.1_5 Reverse -168 -178 6.76487 0.0775
NP_441083.1_5 Forward -177 -167 1.16001 0.215
NP_441434.1_1 Reverse -137 -151 9.6563 0.24
NP_441434.1_1 Forward -151 -137 9.17885 0.246
NP_441738.1_2 Reverse -170 -177 11.8385 0.0469
NP_441955.1_8 Reverse -87 -104 8.10198 0.259
NP_441770.1_4 Reverse -15 -34 -11.8003 0.29
NP_442570.1_3 Reverse -29 -48 -9.63698 0.3
NP_441327.1_1 Forward -217 -198 6.13556 0.25
NP_442111.1_4 Reverse -55 -69 5.1128 0.176
NP_440747.1_10 Reverse -165 -177 -11.9574 0.178
NP_440747.1_10 Reverse -90 -102 -12.5474 0.297
NP_441486.1_1 Reverse -165 -179 1.96621 0.0939
NP_442760.1_5 Forward -103 -91 16.558 0.208
NP_440403.1_10 Forward -186 -167 8.94757 0.189
NP_442848.1_1 Reverse -162 -176 0.491246 0.263
NP_441012.1_4 Forward -100 -87 15.6539 0.165
NP_443018.1_3 Reverse -94 -101 10.2655 0.107
NP_441643.1_3 Reverse -303 -322 6.88262 0.291
NP_440376.1_1 Forward -177 -168 6.19458 0.109
NP_440376.1_1 Reverse -168 -177 0.196389 0.283
NP_442687.1_1 Forward -217 -204 11.1301 0.279
NP_442687.1_7 Forward -135 -125 3.71661 0.292
NP_441846.1_10 Reverse -298 -317 -12.5869 0.191
NP_440642.1_10 Reverse -35 -49 1.5723 0.29
NP_440533.1_4 Reverse -85 -104 12.8808 0.297
NP_442658.1_1 Forward -392 -382 4.99446 0.288
NP_442496.1_5 Reverse -187 -205 7.4923 0.256
NP_440184.1_1 Reverse -205 -224 5.26874 0.22
NP_441958.1_5 Forward -178 -168 0.865012 0.12
NP_440318.1_5 Forward -237 -218 19.8614 0.237
NP_440318.1_8 Forward -364 -350 20.3534 0.163
NP_439905.1_1 Forward -228 -215 6.21414 0.295
NP_441097.1_2 Reverse -293 -310 7.217 0.245
NP_442376.1_2 Reverse -43 -62 -6.39206 0.286
NP_442690.1_1 Reverse -208 -227 -1.37718 0.128
NP_442064.1_4 Forward -112 -93 6.68515 0.246
NP_442064.1_4 Reverse -83 -102 4.71854 0.285
NP_440934.1_2 Reverse -54 -73 3.83436 0.239
NP_442002.1_9 Forward -178 -171 13.0188 0.185
NP_441938.1_10 Reverse -273 -291 12.9005 0.236
NP_442438.1_10 Reverse -163 -177 8.06273 0.0832
NP_440147.1_4 Reverse -123 -136 6.31247 0.0963
NP_440016.1_9 Forward -313 -294 11.8975 0.259
NP_440569.1_7 Reverse -2 -21 9.3409 0.286
NP_441568.1_6 Reverse -207 -225 12.034 0.27
NP_441547.1_1 Forward -190 -171 4.03102 0.226
NP_442004.1_6 Reverse -18 -32 2.85119 0.255
NP_441725.1_5 Reverse -169 -179 1.74999 0.125
NP_441725.1_5 Forward -176 -166 -0.118297 0.232
NP_442941.1_3 Forward -176 -166 0.57002 0.199
NP_440289.1_2 Reverse -165 -178 3.5592 0.0767
NP_440289.1_2 Forward -180 -167 3.16588 0.0811
NP_440983.1_5 Reverse -286 -305 -5.60541 0.268
NP_440260.1_8 Forward -293 -275 1.78911 0.183
NP_441678.1_9 Reverse -297 -316 1.37609 0.223
NP_442281.1_1 Reverse -170 -184 6.0955 0.136
NP_442281.1_1 Reverse -88 -102 3.63724 0.224
NP_442281.1_1 Forward -182 -168 1.86729 0.285
NP_442500.1_8 Forward -153 -139 10.9496 0.271
NP_441644.1_6 Forward -177 -167 3.8145 0.261
NP_442215.1_2 Reverse -84 -100 -2.69473 0.202
NP_442215.1_2 Reverse -166 -182 -5.74299 0.256
NP_441751.2_8 Reverse -169 -183 4.62115 0.0481
NP_441751.2_8 Forward -176 -162 -5.90027 0.244
NP_442554.1_8 Forward -101 -91 4.20827 0.193
NP_442554.1_8 Reverse -169 -179 3.02829 0.245
NP_442142.1_4 Reverse -90 -103 8.96682 0.106
NP_442292.1_5 Reverse -240 -259 0.687771 0.257
NP_440919.1_1 Forward -70 -51 -9.047 0.296
NP_443009.1_5 Reverse -167 -178 5.56471 0.197
NP_441715.1_4 Forward -176 -166 9.7148 0.097
NP_441015.1_8 Forward -103 -84 1.67108 0.272
NP_441673.1_1 Reverse -168 -177 1.37636 0.114
NP_441673.1_1 Forward -177 -168 1.1797 0.163
NP_441876.1_9 Reverse -179 -189 12.3692 0.267
NP_441826.1_2 Forward -183 -169 6.58777 0.0916
NP_442811.1_2 Reverse -91 -110 3.14605 0.226
NP_441637.1_9 Reverse -72 -90 0.805796 0.292
NP_442719.1_2 Reverse -23 -41 -9.42131 0.264
NP_442808.1_1 Reverse -57 -67 1.25791 0.289
NP_441882.1_6 Reverse -85 -104 -3.14714 0.252
NP_440031.1_10 Reverse -291 -310 10.8159 0.167
NP_440145.1_3 Reverse -158 -177 -4.72043 0.245
NP_442050.1_5 Reverse -166 -176 11.4843 0.0959
NP_441937.1_5 Forward -194 -175 1.27776 0.278
NP_440558.1_2 Forward -186 -167 -4.22878 0.243
NP_440558.1_2 Reverse -305 -324 -7.17871 0.289
NP_441878.1_6 Forward -178 -168 2.14332 0.0501
NP_441878.1_6 Forward -185 -175 -7.68978 0.255
NP_442721.1_3 Reverse -250 -269 12.2908 0.29
NP_441557.1_5 Reverse -168 -177 0.491382 0.144
NP_441557.1_5 Forward -177 -168 0.29472 0.174
NP_441557.1_8 Reverse -176 -186 12.2709 0.236
NP_441433.1_8 Forward -71 -52 0.0977854 0.242
NP_441433.1_8 Reverse -32 -51 -4.72043 0.294
NP_441458.1_10 Reverse -84 -103 10.7175 0.123
NP_441116.1_9 Reverse -46 -60 11.0127 0.295
NP_442135.1_8 Forward -245 -227 9.95058 0.233
NP_442594.1_8 Forward -146 -127 5.40766 0.247
NP_442594.1_8 Reverse -306 -325 1.86774 0.295
NP_441633.1_3 Reverse -123 -136 -5.88057 0.236
NP_441633.1_3 Reverse -166 -179 -6.96221 0.283
NP_442998.1_5 Reverse -45 -55 9.41981 0.241
NP_440299.1_1 Reverse -89 -102 5.72191 0.166
NP_442333.2_5 Reverse -288 -307 -15.4385 0.294
NP_440256.1_1 Reverse -90 -109 2.0644 0.0683
NP_441559.1_8 Reverse -54 -68 -5.90027 0.271
NP_441296.1_9 Forward -311 -298 10.3434 0.266
NP_440717.1_3 Forward -311 -297 7.07881 0.285
NP_440319.1_6 Reverse -227 -246 18.7798 0.22
NP_440787.1_5 Forward -391 -377 9.5377 0.271
NP_442993.1_1 Forward -184 -168 -10.1679 0.21
NP_442386.1_9 Reverse -291 -300 8.06244 0.209
NP_440570.1_5 Forward -310 -291 6.58763 0.184
NP_440168.1_9 Reverse -281 -300 -5.70374 0.296
NP_441952.1_9 Forward -157 -138 14.4749 0.282
NP_440586.1_8 Reverse -94 -101 9.08521 0.178
NP_440684.1_9 Reverse -169 -183 7.17775 0.275
NP_439984.1_5 Reverse -19 -38 20.1573 0.086
NP_441665.1_2 Reverse -24 -43 7.7676 0.265
NP_440139.1_1 Forward -183 -164 6.98015 0.137
NP_440267.1_2 Forward -182 -168 4.62054 0.3
NP_442384.1_10 Forward -102 -89 0.215946 0.297
NP_442790.1_4 Forward -74 -55 -15.3402 0.293
NP_442262.1_10 Reverse -94 -101 9.18389 0.211
NP_441689.1_5 Reverse -166 -176 9.91099 0.132
NP_440282.1_10 Forward -400 -381 -8.16202 0.26
NP_440297.1_9 Reverse -169 -179 0.865012 0.282
NP_442280.1_10 Forward -310 -292 9.44784 0.233
NP_442280.1_10 Reverse -27 -45 9.35044 0.233
NP_440999.1_9 Reverse -250 -264 0.687908 0.177
NP_440888.1_2 Forward -177 -163 12.9786 0.0354
NP_440888.1_2 Forward -307 -293 10.2254 0.1
NP_442454.1_2 Forward -90 -71 6.34979 0.298
NP_440575.1_1 Reverse -137 -156 1.37531 0.267
NP_442077.1_8 Reverse -12 -31 8.65176 0.261
NP_442512.1_5 Forward -90 -71 9.63589 0.25
NP_442845.1_2 Forward -240 -226 3.44117 0.29
NP_441462.1_2 Reverse -168 -178 0.668351 0.135
NP_441621.1_7 Forward -303 -289 -2.65535 0.188
NP_440277.1_9 Reverse -94 -113 10.9142 0.228
NP_442204.1_1 Reverse -153 -164 8.7118 0.0852
NP_442204.1_1 Reverse -89 -100 2.71361 0.266
NP_440516.1_6 Reverse -144 -158 10.3237 0.226
NP_442428.1_7 Reverse -207 -226 10.7175 0.213
NP_440818.1_6 Reverse -367 -386 6.19431 0.284
NP_441443.1_10 Forward -305 -287 2.37835 0.275
NP_441052.1_1 Forward -166 -147 23.4013 0.0143
NP_441052.1_2 Forward -177 -167 0.963343 0.255
NP_440436.1_4 Forward -176 -167 4.32588 0.272
NP_441884.1_8 Reverse -291 -310 -8.35868 0.262
NP_441004.1_5 Forward -138 -124 7.57108 0.288
NP_442813.1_4 Reverse -27 -46 -7.57203 0.299
NP_443054.1_2 Reverse -166 -180 1.47456 0.245
NP_441851.1_10 Forward -178 -168 6.37155 0.172
NP_441668.1_5 Forward -156 -137 5.89931 0.297
NP_442689.1_8 Reverse -212 -229 -0.649475 0.202
NP_441051.1_3 Forward -400 -381 16.7157 0.293
NP_440389.1_5 Forward -397 -378 17.8141 0.156
NP_442843.1_1 Reverse -293 -312 -11.2103 0.286
NP_441477.1_5 Forward -315 -296 8.94757 0.268
NP_441124.1_5 Forward -147 -137 13.5811 0.215
NP_441124.1_5 Forward -221 -211 11.8623 0.239
NP_440588.1_2 Reverse -272 -291 -5.31042 0.247
NP_439950.1_1 Reverse -329 -338 13.5694 0.266
NP_442006.1_2 Forward -47 -30 -18.939 0.296
NP_441078.1_4 Reverse -168 -177 0.688044 0.164
NP_441078.1_4 Forward -177 -168 0.688044 0.164
NP_440526.1_3 Reverse -3 -14 3.79477 0.267
NP_441432.1_8 Reverse -167 -176 8.06287 0.0877
NP_442320.1_8 Reverse -162 -176 -4.52363 0.171
NP_442447.1_1 Forward -161 -142 5.70265 0.258
NP_440321.1_1 Forward -184 -167 12.0352 0.28
NP_440199.1_10 Reverse -165 -175 9.32148 0.203
NP_441945.1_10 Reverse -87 -106 8.75091 0.273
NP_441057.1_3 Reverse -14 -33 -11.6036 0.237
NP_439935.1_1 Reverse -321 -340 10.6192 0.229
NP_442400.1_10 Reverse -50 -63 12.5712 0.208
NP_440713.1_4 Reverse -292 -311 3.93269 0.234
NP_442489.1_7 Forward -177 -168 7.76787 0.0518
NP_442489.1_7 Reverse -168 -177 0.688044 0.152
NP_440559.1_1 Reverse -169 -178 4.32629 0.288
NP_441659.2_8 Reverse -168 -178 0.176696 0.271
NP_442346.1_5 Reverse -92 -102 5.09324 0.262
NP_442346.1_5 Reverse -167 -177 4.3066 0.291
NP_440352.1_5 Forward -164 -145 9.93029 0.289
NP_441629.1_1 Forward -185 -166 12.6841 0.154
NP_440010.1_4 Reverse -253 -272 -3.54122 0.299
NP_442311.1_5 Forward -386 -367 4.12936 0.245
NP_441888.1_7 Forward -107 -93 8.75105 0.178
NP_441888.1_7 Reverse -88 -102 1.47456 0.249
NP_443040.1_1 Forward -220 -206 11.1503 0.277
NP_441895.1_2 Forward -47 -28 -17.2085 0.213
NP_441895.1_2 Reverse -291 -310 -26.7466 0.247
NP_441895.1_2 Forward -46 -27 -26.9432 0.275
NP_441895.1_10 Forward -159 -140 -18.6834 0.282
NP_440671.1_2 Reverse -228 -242 16.9125 0.136
NP_440671.1_4 Forward -183 -169 6.78443 0.235
NP_440772.1_8 Forward -38 -19 7.17762 0.292
NP_442140.1_3 Reverse -293 -303 4.50326 0.243
NP_442254.1_1 Reverse -81 -100 3.04771 0.216
NP_442497.1_10 Reverse -169 -178 0.393051 0.175
NP_440821.1_4 Forward -179 -169 0.176696 0.198
NP_441239.1_9 Reverse -290 -302 10.5604 0.076
NP_441239.1_9 Forward -104 -92 3.38223 0.285
NP_440624.1_5 Reverse -200 -218 7.18536 0.298
NP_440665.1_1 Reverse -286 -305 -14.2585 0.261
NP_442105.1_9 Forward -163 -149 13.8664 0.294
NP_441017.1_8 Reverse -305 -320 9.22301 0.231
NP_442611.1_1 Reverse -262 -281 -2.45882 0.292
NP_442565.1_6 Forward -93 -79 15.4376 0.28
NP_442592.1_2 Forward -32 -13 5.11266 0.285
NP_441204.1_1 Forward -111 -92 7.27595 0.25
NP_441474.1_1 Forward -400 -381 5.2102 0.212
NP_442402.1_4 Reverse -15 -34 -6.58946 0.259
NP_442402.1_6 Forward -158 -149 12.9794 0.289
NP_442402.1_10 Reverse -147 -157 15.7125 0.175
NP_441848.1_7 Forward -219 -200 -4.32786 0.289
NP_441084.1_6 Forward -392 -378 10.9924 0.225
NP_442039.1_4 Reverse -245 -252 7.02061 0.269
NP_442039.1_7 Forward -159 -149 6.96153 0.286
NP_441811.1_8 Forward -140 -126 6.78443 0.263
NP_441180.1_2 Forward -61 -42 17.3473 0.287
NP_441926.1_3 Reverse -168 -184 5.07341 0.174
NP_442053.1_1 Forward -177 -168 4.91628 0.218
NP_440505.1_3 Reverse -166 -176 5.5849 0.222
NP_440914.1_1 Forward -276 -266 6.3705 0.283
NP_442533.1_1 Reverse -302 -321 -5.80207 0.155
NP_442533.1_6 Reverse -93 -102 4.71961 0.177
NP_442533.1_6 Forward -96 -87 1.96635 0.28
NP_442533.1_6 Reverse -251 -260 1.57302 0.294
NP_442322.1_4 Forward -314 -297 -8.90993 0.286
NP_439944.1_9 Forward -176 -166 5.5849 0.239
NP_441697.1_5 Reverse -199 -218 -2.53096 0.212
NP_440816.1_2 Forward -157 -138 5.95089 0.293
NP_441028.1_6 Forward -200 -190 12.3692 0.187
NP_441028.1_6 Reverse -148 -158 7.74772 0.218
NP_441028.1_6 Reverse -147 -157 5.48612 0.255
NP_441028.1_6 Reverse -179 -189 5.38779 0.255
NP_439965.1_7 Forward -208 -189 18.6906 0.11
NP_441286.1_1 Reverse -167 -179 4.46387 0.0326
NP_440670.1_8 Forward -177 -168 11.8978 0.03
NP_440886.1_7 Reverse -174 -184 4.7978 0.218
NP_442614.1_2 Forward -155 -141 6.09611 0.293
NP_440907.2_8 Reverse -126 -136 3.8145 0.297
NP_441463.1_3 Forward -322 -303 -5.50708 0.229
NP_441463.1_6 Reverse -166 -180 6.51256 0.269
NP_441836.1_2 Forward -108 -89 0.392778 0.202
NP_441836.1_2 Reverse -81 -100 -4.13045 0.254
NP_441836.1_2 Reverse -296 -315 -6.39206 0.297
NP_442084.1_6 Reverse -84 -102 7.39397 0.221
NP_442084.1_6 Reverse -148 -166 6.11567 0.226
NP_442698.1_10 Forward -100 -81 -0.197208 0.297
NP_440287.1_5 Reverse -137 -156 7.27514 0.286
NP_439910.1_2 Reverse -108 -125 -13.3342 0.162
NP_440457.1_1 Forward -181 -169 -0.0593532 0.25
NP_440987.1_4 Forward -339 -320 8.16093 0.18
NP_440801.1_10 Reverse -89 -108 8.45592 0.272
NP_440142.1_9 Forward -312 -298 13.2736 0.284
NP_441332.1_3 Reverse -168 -187 10.3242 0.173
NP_442509.1_9 Reverse -168 -178 11.4843 0.128
NP_442509.1_9 Reverse -59 -69 8.23937 0.192
NP_441489.1_3 Forward -225 -211 12.2346 0.198
NP_442439.1_3 Forward -55 -36 10.9142 0.163
YP_003858595.1_2 Reverse -20 -37 6.0363 0.248
NP_442737.1_4 Forward -362 -343 15.5357 0.226
NP_441885.1_5 Forward -177 -167 1.55333 0.109
NP_440628.1_6 Forward -89 -71 16.3413 0.139
NP_440478.1_10 Forward -104 -90 11.0127 0.193
NP_442341.1_7 Reverse -174 -188 3.63784 0.217
NP_441173.1_9 Reverse -148 -156 13.1954 0.184
NP_441173.1_9 Forward -166 -158 11.0321 0.228
NP_440191.1_4 Reverse -149 -159 15.9599 0.254
NP_440191.1_4 Reverse -26 -36 14.6025 0.266
NP_440727.1_3 Forward -106 -87 14.6508 0.193
NP_440275.1_3 Reverse -218 -228 3.61828 0.219
NP_441902.1_1 Forward -60 -41 9.7334 0.282
NP_443010.1_10 Reverse -165 -182 3.44723 0.253
NP_442451.1_2 Reverse -275 -294 -6.88371 0.232
NP_442451.1_2 Reverse -160 -179 -10.3253 0.267
NP_439962.1_4 Forward -170 -151 -7.57203 0.29
NP_440216.1_1 Reverse -168 -182 -11.8985 0.228
NP_440216.1_9 Forward -44 -35 7.57121 0.286
NP_440216.1_9 Forward -100 -91 5.89959 0.289
NP_440172.1_1 Forward -177 -167 10.1081 0.0551
NP_440172.1_1 Reverse -168 -178 3.32329 0.232
NP_442371.1_1 Forward -157 -147 15.3192 0.146
NP_441766.1_2 Forward -177 -168 3.83464 0.202
NP_440416.1_9 Reverse -86 -105 -19.8634 0.279
NP_440416.1_9 Forward -308 -289 -20.65 0.287
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGGCCTGAAAACACTCGCCAATATTGGGACAGGAAGCTTCTTCACAGACGGTATTTAATTGTAAATCTCGCAGAATATCCTTAACACTGCCCACCCTCTGCCATTGGGGCGCTTTGACTCGGAGCCAATCCGGTTTGACGGTCACGTCCAATCTCTCCTGCTATAGGAGATCCGATTGTATCAAAAATTCTTAACTCCCTTTCTCTCCATCTAGGGGAGAAGGGCGATTTCCATTCCACCAACTGGGGAAAATGAGTAAATTTGGGTTGATAGCTGAGAACTCTGTTTGATTACTCCATCCATGGCCAGGGTTAAAAAACATCAAACTGCCTGGGTTTACCGGGAAATTTAGCCCCCAAGGTAAAGTGGGGAAACCAACCCTGGAAGTTAGAATGGTTG

CDS

ATGGAAAAGGTTTTCCCTCATACTGCCATGACCCAAGCCAATGCTGATCCCTGTTTTGAAACCGGACATATTTGCCCCATTCAGCATGTGGTGGATTTACTTGATAATAAGTGGTCTATTTTGGTGTTGCGGGAACTGTTCAAGGGACAACGACGCACGGGGCAGTTGTTAGATGCCTTGCCCGGTTGTAGCACTAAAACGTTAACCCTAAGGCTTAGGCAACTAGAAACCCACGGCATTATCAATCGGGATGTGTACCCAGAAATTCCCCCTAGGGTGGAGTATTCCCTCACGGCCAGGGGTAGGGAAATTCAGCCAGTGCTGATTGCCATGCACAAACTAGGTTCCGACTGGTTAGAGCAAGAATCCTGTGAATGCAGTCTTCTGACCGGCGAAGGACCAAACTAA

Protein

MEKVFPHTAMTQANADPCFETGHICPIQHVVDLLDNKWSILVLRELFKGQRRTGQLLDALPGCSTKTLTLRLRQLETHGIINRDVYPEIPPRVEYSLTARGREIQPVLIAMHKLGSDWLEQESCECSLLTGEGPN