Your browser is old and dusty. Try Google Chrome!

Details for sll1511

ORF sll1511
Accession NP_440320.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441818.1_9 Reverse -280 -299 -10.9153 0.299
NP_441098.1_8 Forward -20 -1 11.7992 0.284
NP_440348.1_6 Reverse -115 -134 6.58763 0.203
NP_442287.1_5 Reverse -290 -300 17.8763 0.19
NP_442752.1_4 Reverse -291 -298 10.5605 0.1
NP_440110.1_8 Reverse -19 -38 -1.27885 0.238
NP_442062.1_3 Reverse -49 -68 5.99764 0.182
NP_442062.1_8 Forward -143 -133 10.2065 0.0504
NP_441900.1_2 Forward -310 -292 -1.9482 0.273
NP_442972.1_1 Forward -73 -55 7.67408 0.291
NP_440304.1_4 Reverse -132 -142 5.19158 0.223
NP_441925.1_2 Reverse -78 -97 6.4893 0.262
NP_441925.1_4 Forward -310 -291 -2.65624 0.167
NP_441083.1_5 Forward -292 -282 2.63497 0.193
NP_441738.1_2 Forward -119 -112 8.1019 0.204
NP_441558.1_2 Reverse -204 -223 9.73422 0.207
NP_440410.1_1 Forward -87 -68 19.9574 0.127
NP_442398.1_1 Forward -144 -125 11.2092 0.241
NP_441716.1_2 Forward -372 -353 5.65255 0.229
NP_440438.2_8 Reverse -49 -68 0.786102 0.289
NP_442145.1_4 Reverse -48 -67 9.11906 0.175
NP_442760.1_5 Reverse -133 -145 17.5413 0.208
NP_440842.1_4 Forward -66 -47 2.58085 0.223
NP_441014.1_10 Reverse -275 -294 9.34008 0.124
NP_442848.1_4 Reverse -307 -321 5.21113 0.299
NP_443018.1_3 Forward -142 -135 8.49558 0.141
NP_442687.1_7 Forward -388 -378 7.64985 0.127
NP_441077.1_6 Forward -72 -56 11.9605 0.136
NP_441077.1_6 Forward -131 -115 5.11563 0.255
NP_442530.1_6 Reverse -360 -373 17.058 0.279
NP_440642.1_10 Reverse -275 -289 4.8172 0.25
NP_440667.1_2 Reverse -291 -310 -7.57203 0.28
NP_441950.1_7 Reverse -291 -310 -8.06369 0.283
NP_440141.1_8 Reverse -125 -144 10.2259 0.211
NP_442782.1_2 Forward -158 -144 1.76955 0.281
NP_442782.1_3 Reverse -275 -292 20.2241 0.229
NP_440656.1_8 Reverse -138 -157 1.17943 0.124
NP_440184.1_1 Reverse -50 -69 3.64179 0.23
NP_442937.1_5 Reverse -286 -305 16.5191 0.042
NP_442605.1_4 Reverse -309 -328 10.7175 0.275
NP_439990.1_5 Forward -148 -135 12.6056 0.11
NP_442690.1_1 Reverse -146 -165 -3.73712 0.142
NP_442690.1_1 Forward -75 -56 -8.16202 0.183
NP_442690.1_1 Reverse -76 -95 -10.1286 0.21
NP_442690.1_1 Reverse -354 -373 -12.2919 0.241
NP_442690.1_1 Forward -279 -260 -12.6852 0.247
NP_442690.1_1 Reverse -60 -79 -14.9469 0.276
NP_443055.1_6 Forward -308 -290 5.1316 0.181
NP_440471.1_3 Reverse -287 -301 19.6658 0.0703
NP_441099.1_5 Forward -310 -291 -11.7019 0.288
NP_441654.1_6 Forward -123 -105 13.9438 0.296
NP_441000.1_6 Reverse -298 -312 -4.22864 0.231
NP_441725.1_5 Forward -142 -132 7.15819 0.103
NP_440260.1_8 Reverse -282 -300 -6.56903 0.293
NP_441079.1_7 Reverse -228 -247 -4.1312 0.241
NP_441079.1_7 Forward -123 -104 -5.80282 0.268
NP_442500.1_8 Forward -131 -117 11.1424 0.267
NP_442215.1_2 Forward -252 -236 -5.448 0.25
NP_442933.1_3 Forward -277 -258 14.4666 0.28
NP_440430.1_6 Reverse -180 -198 15.7609 0.264
NP_441371.1_3 Reverse -141 -159 5.23069 0.292
NP_440379.1_5 Forward -102 -83 -5.99873 0.227
NP_441758.1_10 Reverse -160 -179 1.57197 0.193
NP_441637.1_8 Forward -333 -316 11.5436 0.229
NP_442719.1_2 Reverse -69 -87 -0.178247 0.162
NP_441911.1_7 Reverse -258 -277 -9.53937 0.125
NP_441849.1_2 Forward -234 -215 1.19323 0.25
NP_441878.1_6 Reverse -133 -143 2.24165 0.0462
NP_441036.1_3 Forward -281 -262 7.47261 0.126
NP_442192.1_3 Reverse -133 -152 19.3707 0.204
NP_441116.1_9 Forward -280 -266 11.5043 0.277
NP_441459.1_3 Forward -315 -296 14.1404 0.223
NP_441574.1_1 Reverse -279 -298 0.884433 0.185
NP_442594.1_8 Reverse -21 -40 5.211 0.252
NP_442998.1_5 Forward -251 -241 12.6647 0.162
NP_442998.1_5 Reverse -315 -325 11.1898 0.191
NP_442998.1_5 Forward -88 -78 8.1415 0.271
NP_441799.1_1 Forward -125 -111 4.52221 0.247
NP_440456.1_7 Reverse -186 -200 10.226 0.294
NP_440525.1_1 Forward -68 -49 9.63589 0.254
NP_440915.1_6 Forward -399 -385 0.196253 0.173
NP_441866.1_4 Reverse -117 -130 13.6339 0.273
NP_442866.1_1 Reverse -297 -316 -9.24366 0.292
NP_440787.1_5 Forward -122 -108 16.2242 0.185
NP_440161.1_3 Forward -145 -126 7.37428 0.299
NP_442959.1_5 Reverse -103 -122 16.8141 0.166
NP_440027.1_3 Forward -318 -300 2.28001 0.292
NP_439937.1_9 Forward -329 -312 -10.1882 0.224
NP_440836.1_6 Forward -329 -315 7.9644 0.263
NP_441138.1_5 Forward -273 -260 12.1892 0.192
NP_440819.1_5 Reverse -188 -196 6.41093 0.285
NP_441877.1_9 Forward -67 -50 12.8219 0.127
NP_441877.1_9 Forward -68 -51 2.00546 0.292
NP_441018.1_7 Forward -394 -375 6.78429 0.282
NP_442262.1_10 Forward -142 -135 8.59391 0.22
NP_440344.1_10 Forward -197 -180 -10.5809 0.185
NP_441060.1_1 Forward -279 -260 11.2071 0.3
NP_440297.1_9 Forward -142 -132 7.05986 0.15
NP_440894.1_10 Forward -254 -235 5.60432 0.228
NP_441778.1_10 Reverse -112 -130 16.0547 0.217
NP_442454.1_2 Reverse -48 -67 7.68668 0.291
NP_441304.1_10 Forward -282 -273 13.5694 0.239
NP_441560.1_3 Forward -293 -275 7.00065 0.28
NP_442780.1_1 Reverse -51 -70 9.93088 0.195
NP_442780.1_3 Reverse -353 -372 6.82725 0.269
NP_440618.1_1 Forward -255 -236 -11.4069 0.297
NP_441052.1_2 Forward -300 -290 4.69992 0.149
NP_441052.1_2 Forward -30 -20 2.33998 0.209
NP_441884.1_8 Reverse -298 -317 -4.91709 0.17
NP_441884.1_8 Reverse -36 -55 -9.24366 0.268
NP_441733.1_10 Reverse -296 -309 5.42749 0.217
NP_441555.1_2 Forward -263 -244 11.4109 0.299
NP_442515.1_1 Reverse -133 -147 -1.37704 0.253
NP_442689.1_8 Reverse -150 -167 -4.48438 0.267
NP_440432.1_2 Forward -312 -293 -3.44213 0.268
NP_442843.1_1 Forward -285 -266 7.17762 0.135
NP_442843.1_1 Reverse -300 -319 -10.4236 0.278
NP_440431.1_3 Forward -144 -125 -10.817 0.278
NP_441031.1_1 Forward -70 -51 10.8718 0.193
NP_442006.1_2 Forward -294 -277 -9.40093 0.197
NP_441078.1_4 Reverse -134 -143 -1.6719 0.266
NP_442729.1_5 Reverse -290 -300 8.1415 0.248
NP_442443.1_4 Forward -128 -118 16.1058 0.155
NP_441432.1_9 Reverse -108 -121 11.7979 0.221
NP_441432.1_9 Reverse -323 -336 8.11358 0.294
NP_441030.1_6 Forward -320 -301 12.0813 0.248
NP_440578.1_10 Reverse -55 -74 11.0125 0.264
NP_442489.1_7 Reverse -134 -143 5.3096 0.0708
NP_442489.1_7 Forward -143 -134 -1.96689 0.28
NP_442079.1_7 Forward -394 -375 7.86593 0.13
NP_441022.1_1 Forward -156 -147 13.8484 0.188
NP_441022.1_1 Forward -155 -146 10.9707 0.284
NP_441022.1_1 Reverse -146 -155 10.9707 0.284
NP_439956.1_7 Reverse -138 -157 7.57094 0.257
NP_442346.1_5 Reverse -133 -143 4.60159 0.281
NP_440352.1_8 Reverse -357 -373 16.8764 0.223
NP_440459.1_2 Forward -294 -277 10.8552 0.189
NP_440010.1_10 Reverse -279 -298 5.40766 0.232
NP_441943.1_5 Forward -95 -76 16.2746 0.217
NP_442551.1_4 Forward -145 -130 -3.06836 0.285
NP_443040.1_1 Forward -133 -119 11.9233 0.276
NP_442404.1_9 Reverse -261 -275 16.7152 0.209
NP_441609.1_1 Reverse -115 -134 -1.57384 0.271
NP_440594.1_5 Reverse -272 -291 3.9319 0.293
NP_440227.1_6 Reverse -160 -174 13.667 0.28
NP_441951.1_9 Forward -334 -315 2.55606 0.254
NP_442568.1_8 Forward -131 -117 11.701 0.257
NP_442044.1_1 Forward -308 -289 -6.68705 0.21
NP_442193.1_1 Reverse -282 -300 7.29564 0.295
NP_441541.1_1 Forward -77 -59 -2.76728 0.264
NP_440833.1_6 Reverse -268 -282 8.65209 0.272
NP_441617.1_6 Forward -165 -146 -6.98204 0.29
NP_440462.1_6 Forward -310 -300 2.04498 0.294
NP_442465.1_9 Forward -130 -116 9.73436 0.298
NP_440401.1_8 Forward -282 -263 11.7008 0.117
NP_442499.1_6 Reverse -103 -122 10.0292 0.267
NP_442479.1_5 Reverse -105 -124 7.28887 0.228
NP_442402.1_4 Reverse -235 -254 -8.16275 0.278
NP_441848.1_4 Reverse -68 -84 11.1794 0.232
NP_441848.1_7 Reverse -269 -288 3.44025 0.217
NP_442882.1_8 Forward -330 -311 7.7676 0.267
NP_442829.1_2 Forward -131 -115 8.14109 0.287
NP_442786.1_6 Reverse -354 -367 20.2939 0.0576
NP_440505.1_7 Reverse -236 -255 3.93269 0.207
NP_441959.1_8 Forward -370 -357 12.2763 0.286
NP_441959.1_8 Reverse -360 -373 11.4087 0.286
NP_441536.1_10 Reverse -18 -37 9.53756 0.298
NP_441252.1_6 Reverse -296 -303 11.6422 0.288
NP_442844.1_2 Reverse -67 -82 18.2004 0.229
NP_441408.2_6 Reverse -102 -121 13.8641 0.191
NP_440914.1_7 Reverse -360 -379 5.49036 0.29
NP_440263.1_5 Forward -274 -260 8.65272 0.294
NP_441697.1_5 Forward -71 -52 -2.14899 0.207
NP_441697.1_5 Reverse -355 -374 -10.1703 0.278
NP_441028.1_6 Forward -322 -312 5.78111 0.243
NP_441286.1_1 Forward -144 -132 -5.17256 0.192
NP_441809.1_7 Reverse -265 -284 5.99764 0.245
NP_440886.1_7 Forward -31 -21 3.61784 0.272
NP_440326.1_5 Forward -145 -132 14.3756 0.228
NP_442020.1_1 Forward -131 -112 9.43841 0.157
NP_440935.1_6 Reverse -351 -368 8.26445 0.194
NP_441425.1_2 Reverse -61 -80 11.2181 0.292
NP_441858.1_6 Forward -285 -266 16.3224 0.0751
NP_441421.1_6 Reverse -51 -68 11.0337 0.279
NP_440422.1_10 Reverse -240 -259 4.98276 0.279
NP_440801.1_8 Forward -301 -282 0.491109 0.253
NP_440734.1_9 Reverse -139 -158 10.1275 0.282
NP_442862.1_3 Forward -275 -258 5.74204 0.268
NP_442862.1_3 Reverse -241 -258 5.64371 0.268
NP_441173.1_9 Forward -322 -314 12.0154 0.214
NP_442638.1_3 Reverse -362 -381 10.1695 0.298
NP_441207.1_7 Forward -85 -71 8.86815 0.282
NP_440216.1_9 Forward -284 -275 11.3078 0.269
NP_440117.1_1 Forward -181 -162 -2.36049 0.258
NP_442154.1_1 Reverse -283 -301 -16.8938 0.246
NP_442226.1_8 Reverse -79 -89 14.4347 0.256
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTGGATCTATGGCGTCATAGTTCCCTAATTATTAATAAAAAATGTTGGTTACACGACTGCTTAAATAGCTGGCTGATTTTACCCCAAGACCACGGATTGCACCATCACCAAATCGGCAAGGGAAATTTTGGTGCTAATTTAAAACTTTGGGACAAAATCCATGGTACCTATTTGAAAAATACCTTACCAAATCAACTTAGTATTTCTTCCGGAATGGGCATTAAACTTGAATTAACTTTGTGGCAAAAGCTTTTCTGGCCATTGACCTAAAAAATGCAAAAAATCGCTTAATCTTACGGCATCTAATTGTCAGGCAAAATTTATAATAGCTAAAGTTAAAATTTCTTAAGCCAACTAATCTCCCCGTACCGCTATCCAGACTAGTTCTTGTAACCAGCT

CDS

ATGACGCTGTTAAGTAAACTCCTAGCATTATTTCCCGGTCTAGTAATTACTTTAGCCCTTAGTTGTGTCATTTTCTGGGCAATGACTAGGGCTTGGTGGTGGCTACTATTATTATTATTAATTATTTATGGGCTGCCCCTGCTAACCTATCGGATTCATCAGCTCTTCTATCCTCTCCAACCCGGACTGAGTTATTTAGTGGGAAAAAATTACATTCCTTGGTGGGGAACCTATCAAATTCAATTGATTTATAGCACTTTTCCTGCCCTGGAAGGAATATTACACTTTGTCCCAGGCTTGTTTTCCCTGTGGCTCCGATTATGGGGATCCAGCATTGGCAAAAACGTGCTTTGGACCCCCAGCATACAAGTCCTAGACCGGGGTTTACTGCACATTGGCAACCAAGTGATATTTGGTCACCAAGTCAGCCTAGTGGGCCACGCCATTAAACCAAAACGACACAACCTTTTGCTTTACGTTGACCGGATCACAATTGGCAATAATGTTTTTATCAGTGCGGGGGTGGGGCTTGGCCCTGGAGTGGCGATCGCCGATGGCAGCTACATTCCCTTTGGCAAAATGATTTTTCCACGGCAAAAAGTTGGACTAGAAGAATAG

Protein

MTLLSKLLALFPGLVITLALSCVIFWAMTRAWWWLLLLLLIIYGLPLLTYRIHQLFYPLQPGLSYLVGKNYIPWWGTYQIQLIYSTFPALEGILHFVPGLFSLWLRLWGSSIGKNVLWTPSIQVLDRGLLHIGNQVIFGHQVSLVGHAIKPKRHNLLLYVDRITIGNNVFISAGVGLGPGVAIADGSYIPFGKMIFPRQKVGLEE