Your browser is old and dusty. Try Google Chrome!

Details for sll1510

ORF sll1510
Accession NP_440321.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -255 -241 1.37622 0.191
NP_441418.1_6 Reverse -238 -257 -22.3217 0.175
NP_441418.1_6 Reverse -241 -260 -30.5815 0.286
NP_440897.1_6 Reverse -251 -270 -4.72118 0.288
NP_441453.1_4 Reverse -156 -164 4.73931 0.252
NP_442151.1_6 Reverse -241 -255 11.996 0.0854
NP_441818.1_9 Forward -173 -154 -2.45882 0.203
NP_440259.1_4 Forward -288 -274 16.4448 0.131
NP_441098.1_3 Reverse -103 -122 2.30291 0.25
NP_440150.1_2 Forward -238 -219 8.84842 0.221
NP_443002.1_5 Forward -255 -237 11.7197 0.247
NP_442752.1_4 Reverse -156 -163 4.26735 0.293
NP_439997.1_4 Reverse -326 -345 14.8474 0.121
NP_442975.1_10 Reverse -237 -251 5.70218 0.212
NP_442975.1_10 Forward -342 -328 3.63724 0.252
NP_441470.1_7 Reverse -265 -284 9.83255 0.196
NP_440061.1_9 Reverse -334 -348 5.1122 0.294
NP_440110.1_8 Forward -167 -148 10.2259 0.0878
NP_441476.1_5 Reverse -236 -255 -2.75381 0.231
NP_441476.1_5 Forward -255 -236 -6.58872 0.274
NP_441476.1_5 Forward -258 -239 -7.76869 0.29
NP_442062.1_8 Reverse -156 -166 5.28991 0.176
NP_440761.1_4 Forward -81 -62 -3.14714 0.132
NP_441859.1_3 Reverse -155 -174 12.0933 0.102
NP_441802.1_1 Reverse -269 -288 12.8808 0.175
NP_440044.1_8 Reverse -242 -261 0.0977854 0.206
NP_441594.1_6 Forward -259 -240 12.9791 0.109
NP_441594.1_6 Reverse -235 -254 9.73422 0.14
NP_441594.1_6 Reverse -244 -263 8.55425 0.153
NP_441594.1_6 Reverse -339 -358 6.68596 0.187
NP_442726.1_7 Forward -257 -239 0.805796 0.254
NP_441925.1_4 Reverse -132 -151 -13.1776 0.257
NP_441434.1_1 Forward -118 -104 7.55548 0.274
NP_440447.1_1 Reverse -151 -169 18.8004 0.104
NP_441770.1_5 Reverse -328 -347 4.12936 0.224
NP_441716.1_1 Reverse -336 -350 4.42448 0.256
NP_441163.1_1 Reverse -240 -257 5.64298 0.271
NP_441387.1_8 Forward -339 -320 17.8088 0.175
NP_440747.1_10 Forward -253 -241 -11.8591 0.161
NP_440747.1_10 Reverse -153 -165 -12.1541 0.227
NP_442145.1_4 Forward -123 -104 16.1855 0.0898
NP_442145.1_4 Reverse -104 -123 2.33913 0.299
NP_441014.1_8 Reverse -151 -170 -8.55534 0.284
NP_442848.1_9 Forward -255 -236 -1.47551 0.291
NP_441634.1_8 Reverse -236 -250 5.50613 0.114
NP_441634.1_8 Forward -252 -238 -4.62196 0.295
NP_440376.1_1 Forward -262 -253 2.94966 0.213
NP_443065.1_6 Forward -316 -297 0.0977854 0.282
NP_442687.1_7 Forward -178 -168 6.27322 0.175
NP_442485.1_3 Reverse -242 -261 -1.08219 0.255
NP_442485.1_3 Forward -267 -248 -2.0655 0.261
NP_440781.1_1 Reverse -231 -245 13.0776 0.266
NP_440642.1_10 Forward -302 -288 11.7987 0.144
NP_441422.1_7 Reverse -239 -256 -0.452814 0.168
NP_441422.1_7 Forward -258 -241 -4.77938 0.247
NP_441950.1_7 Forward -158 -139 -8.752 0.287
NP_441950.1_8 Reverse -243 -257 25.074 0.0194
NP_440360.1_4 Forward -255 -236 7.86593 0.229
NP_440360.1_10 Reverse -158 -172 10.0294 0.214
NP_442658.1_1 Forward -382 -372 8.23937 0.199
NP_441855.2_4 Reverse -245 -264 10.9692 0.238
NP_442782.1_2 Reverse -247 -261 2.94952 0.269
NP_441414.1_9 Reverse -253 -272 -6.58872 0.199
NP_440184.1_1 Reverse -106 -125 3.45038 0.237
NP_442653.1_1 Reverse -317 -336 0.294447 0.29
NP_441127.1_1 Reverse -238 -252 19.7641 0.0282
NP_441127.1_1 Reverse -156 -170 9.73436 0.268
NP_439905.1_1 Forward -255 -242 8.9674 0.227
NP_440984.1_7 Reverse -242 -256 5.99778 0.231
NP_442364.1_7 Forward -287 -273 19.3701 0.222
NP_442376.1_1 Reverse -338 -356 12.3105 0.114
NP_442690.1_1 Forward -121 -102 -14.4552 0.272
NP_442911.1_2 Forward -175 -156 -2.85214 0.104
NP_440153.1_5 Forward -249 -235 0.982901 0.282
NP_440153.1_8 Forward -256 -243 14.2773 0.16
NP_440153.1_8 Forward -250 -237 -2.43899 0.238
NP_443055.1_6 Forward -255 -237 -1.55487 0.28
NP_442002.1_1 Forward -157 -139 -6.66736 0.249
NP_441294.1_2 Forward -256 -237 3.44104 0.274
NP_441646.1_1 Forward -263 -244 -1.86883 0.296
NP_442438.1_10 Forward -261 -247 5.99778 0.123
NP_442438.1_10 Reverse -236 -250 5.1128 0.139
NP_441000.1_6 Forward -248 -234 -3.83532 0.225
NP_441000.1_6 Forward -178 -164 -5.31028 0.273
NP_441674.1_6 Forward -255 -236 1.76941 0.297
NP_441916.1_7 Reverse -247 -257 2.33998 0.258
NP_441041.1_4 Reverse -235 -254 -10.4236 0.232
NP_441041.1_4 Reverse -241 -260 -13.8652 0.297
NP_440016.1_3 Forward -59 -40 14.0608 0.235
NP_442941.1_5 Forward -336 -322 16.0528 0.238
NP_440260.1_7 Forward -314 -295 0.392778 0.241
NP_442281.1_1 Reverse -151 -165 3.73557 0.221
NP_441334.1_7 Forward -167 -148 -12.6852 0.166
NP_442575.1_8 Reverse -235 -254 -5.99873 0.277
NP_442012.1_1 Forward -256 -237 6.09597 0.138
NP_440375.1_8 Forward -164 -145 -0.885524 0.274
NP_443030.1_4 Reverse -234 -253 -6.09707 0.272
NP_441644.1_6 Forward -256 -246 8.92768 0.0895
NP_441644.1_6 Reverse -241 -251 3.22451 0.293
NP_442029.1_6 Forward -326 -307 2.94938 0.286
NP_442029.1_10 Reverse -230 -249 7.7676 0.251
NP_440780.1_1 Forward -343 -324 9.31004 0.274
NP_442933.1_6 Forward -124 -105 14.5621 0.284
NP_442933.1_10 Reverse -336 -345 6.29291 0.128
NP_442926.1_3 Reverse -236 -255 11.0125 0.128
NP_442554.1_8 Forward -255 -245 6.46988 0.117
NP_442075.1_1 Reverse -230 -249 6.68596 0.269
NP_441762.1_7 Reverse -237 -249 -5.36923 0.203
NP_441762.1_7 Forward -51 -39 -6.74586 0.284
NP_442142.1_4 Reverse -305 -318 8.47516 0.113
NP_442142.1_4 Forward -348 -335 4.64028 0.214
NP_442142.1_4 Forward -253 -240 2.67367 0.281
NP_442142.1_4 Forward -250 -237 2.18201 0.299
NP_442143.1_8 Reverse -233 -252 12.9783 0.223
NP_443009.1_5 Forward -322 -311 9.00628 0.0965
NP_442301.1_2 Forward -257 -238 3.9319 0.284
NP_441448.1_1 Forward -258 -239 6.4893 0.249
NP_440183.1_9 Forward -254 -235 -19.0768 0.277
NP_440464.1_3 Forward -249 -230 10.9142 0.207
NP_441015.1_10 Reverse -242 -261 5.60432 0.114
NP_441015.1_10 Forward -255 -236 3.34271 0.137
NP_441015.1_10 Reverse -236 -255 -3.3438 0.189
NP_441015.1_10 Forward -153 -134 -9.83364 0.282
NP_441015.1_10 Reverse -239 -258 -11.0136 0.29
NP_441172.1_1 Forward -256 -238 11.0322 0.0587
NP_441826.1_2 Reverse -235 -249 -0.983719 0.23
NP_442227.1_2 Reverse -138 -157 6.88262 0.198
NP_442227.1_2 Reverse -40 -59 5.40766 0.202
NP_443058.1_7 Forward -229 -210 1.76941 0.294
NP_442808.1_1 Forward -248 -238 5.97777 0.134
NP_440031.1_10 Forward -159 -140 2.75272 0.257
NP_441315.1_2 Reverse -237 -255 14.6979 0.252
NP_442747.1_1 Reverse -236 -255 -6.78538 0.215
NP_440558.1_2 Reverse -243 -262 -4.91709 0.249
NP_440558.1_2 Forward -260 -241 -6.09707 0.271
NP_440558.1_2 Forward -348 -329 -6.1954 0.272
NP_440558.1_2 Forward -259 -240 -6.29373 0.273
NP_441878.1_6 Reverse -240 -250 -7.29646 0.217
NP_441445.1_1 Reverse -238 -257 3.14605 0.218
NP_442066.2_4 Forward -165 -146 -6.58872 0.253
NP_440101.1_3 Reverse -236 -255 0.982764 0.287
NP_440101.1_10 Reverse -241 -260 5.211 0.208
NP_442183.1_1 Reverse -156 -170 6.3911 0.176
NP_441574.1_1 Reverse -235 -254 -0.4922 0.206
NP_441574.1_1 Reverse -238 -257 -6.1954 0.276
NP_441549.1_9 Reverse -243 -261 -8.83064 0.238
NP_441549.1_9 Forward -349 -331 -10.1089 0.269
NP_442594.1_8 Forward -160 -141 3.93269 0.274
NP_442594.1_8 Forward -157 -138 3.24438 0.286
NP_441633.1_3 Reverse -129 -142 -3.02898 0.177
NP_441633.1_3 Reverse -154 -167 -4.30728 0.191
NP_442590.1_9 Forward -257 -238 7.57094 0.25
NP_442590.1_10 Reverse -235 -254 8.35759 0.208
NP_442998.1_5 Forward -151 -141 8.1415 0.271
NP_442998.1_10 Forward -163 -156 13.5105 0.0225
NP_440899.1_8 Forward -289 -270 -7.96535 0.246
NP_440299.1_1 Forward -254 -241 7.59019 0.109
NP_440299.1_1 Reverse -152 -165 2.87033 0.269
NP_441007.1_10 Reverse -242 -255 0.314277 0.233
NP_441007.1_10 Forward -170 -157 0.117615 0.25
NP_442283.1_2 Forward -255 -236 12.9791 0.164
NP_441559.1_8 Reverse -307 -321 2.94952 0.143
NP_441559.1_8 Reverse -308 -322 -7.57189 0.295
NP_440717.1_3 Reverse -48 -62 7.17714 0.284
NP_441464.1_8 Reverse -156 -170 6.6861 0.226
NP_440026.1_7 Forward -159 -144 14.1396 0.265
NP_442386.1_9 Forward -322 -313 6.78414 0.219
NP_442327.1_3 Reverse -98 -117 5.77684 0.276
NP_440168.1_8 Reverse -235 -254 2.55606 0.257
NP_441676.1_1 Reverse -31 -50 17.5024 0.179
NP_442240.1_2 Forward -164 -145 -4.81876 0.0848
NP_440161.1_3 Forward -249 -230 15.1424 0.117
NP_440586.1_1 Reverse -237 -256 8.16093 0.182
NP_440586.1_1 Reverse -243 -262 -0.688862 0.237
NP_440586.1_9 Reverse -240 -259 4.42435 0.289
NP_442959.1_4 Reverse -242 -261 7.96426 0.224
NP_441912.1_3 Forward -159 -140 10.9142 0.27
NP_441262.1_3 Reverse -156 -163 5.25066 0.215
NP_440027.1_3 Forward -250 -232 6.40989 0.225
NP_440027.1_3 Forward -256 -238 3.8533 0.263
NP_439937.1_8 Forward -255 -236 -3.44213 0.268
NP_439937.1_8 Reverse -236 -255 -4.22878 0.28
NP_439937.1_9 Forward -248 -231 -13.1381 0.28
NP_440836.1_3 Reverse -239 -258 12.7825 0.276
NP_440398.1_2 Reverse -232 -251 21.7306 0.0218
NP_440408.1_3 Forward -259 -240 -4.81876 0.272
NP_440408.1_3 Reverse -235 -254 -5.40875 0.289
NP_440408.1_10 Reverse -238 -257 5.40766 0.267
NP_440574.1_7 Forward -282 -263 10.9142 0.283
NP_441293.1_7 Forward -155 -136 18.9773 0.108
NP_441803.1_2 Forward -255 -236 21.5339 0.0174
NP_441803.1_2 Reverse -343 -362 -0.0988766 0.267
NP_442114.1_8 Reverse -184 -198 10.3237 0.234
NP_442114.1_8 Reverse -263 -277 9.93039 0.234
NP_441877.1_7 Reverse -236 -255 5.01354 0.218
NP_441877.1_7 Forward -258 -239 -0.197979 0.281
NP_441018.1_7 Reverse -243 -262 7.86593 0.263
NP_442262.1_10 Reverse -157 -164 9.18389 0.211
NP_442165.1_2 Reverse -359 -372 16.9322 0.277
NP_442556.1_1 Forward -159 -140 17.404 0.0604
NP_440350.1_5 Forward -282 -263 -6.09707 0.296
NP_441896.1_3 Forward -174 -155 0.884433 0.224
NP_440894.1_2 Reverse -132 -151 0.392778 0.246
NP_440894.1_10 Reverse -236 -255 11.7008 0.142
NP_440999.1_9 Forward -257 -243 6.29277 0.0991
NP_440999.1_9 Reverse -237 -251 3.8345 0.122
NP_440999.1_9 Forward -251 -237 -2.06536 0.257
NP_440888.1_2 Forward -250 -236 8.25877 0.167
NP_440888.1_2 Forward -102 -88 7.66879 0.186
NP_440600.1_1 Reverse -106 -125 14.7531 0.207
NP_441543.1_2 Forward -164 -155 7.07956 0.131
NP_442845.1_2 Reverse -241 -255 8.16106 0.195
NP_441469.1_8 Reverse -252 -261 5.01461 0.297
NP_442578.1_7 Reverse -157 -164 11.4455 0.0898
NP_440148.1_1 Reverse -321 -340 -5.50708 0.235
NP_441462.1_5 Forward -65 -46 0.884433 0.293
NP_441621.1_7 Forward -167 -153 -4.22864 0.214
NP_441621.1_7 Forward -252 -238 -6.19526 0.279
NP_441621.1_7 Forward -264 -250 -6.49025 0.295
NP_441621.1_7 Forward -249 -235 -6.49025 0.295
NP_443062.1_6 Reverse -230 -249 5.80098 0.193
NP_441410.1_3 Reverse -275 -294 9.73422 0.191
NP_442204.1_1 Reverse -152 -163 3.40192 0.266
NP_442204.1_5 Reverse -231 -250 16.7157 0.0372
NP_440504.1_5 Reverse -268 -286 10.5406 0.153
NP_440673.1_2 Reverse -237 -256 15.8525 0.0865
NP_440673.1_2 Forward -260 -241 8.1459 0.28
NP_441052.1_2 Reverse -241 -251 5.09324 0.132
NP_440436.1_4 Forward -363 -354 4.22755 0.277
NP_441884.1_9 Reverse -235 -254 -21.0434 0.225
NP_441719.1_4 Reverse -157 -164 3.77569 0.285
NP_441004.1_1 Forward -268 -249 -6.88371 0.192
NP_441004.1_1 Reverse -226 -245 -16.7168 0.287
NP_441004.1_1 Forward -157 -138 -17.1101 0.289
NP_441004.1_1 Forward -171 -152 -17.6018 0.292
NP_441004.1_1 Reverse -235 -254 -17.8968 0.295
NP_441004.1_2 Reverse -236 -255 -0.000545616 0.247
NP_441004.1_6 Forward -251 -232 18.6823 0.268
NP_442873.1_2 Forward -254 -235 16.7149 0.178
NP_442873.1_9 Forward -257 -238 3.24359 0.296
NP_442694.1_4 Forward -274 -265 11.6028 0.277
NP_442206.1_1 Reverse -247 -266 -13.6686 0.257
NP_440328.1_4 Reverse -150 -169 0.982764 0.236
NP_443054.1_2 Reverse -130 -144 2.2612 0.245
NP_442430.1_6 Reverse -317 -336 10.0292 0.271
NP_442308.1_4 Reverse -126 -145 5.80098 0.267
NP_442208.1_5 Forward -264 -245 -10.1286 0.296
NP_442856.1_7 Reverse -232 -251 1.27776 0.172
NP_441668.1_4 Forward -64 -45 -0.787193 0.262
NP_442515.1_1 Reverse -155 -169 4.71948 0.107
NP_440593.1_3 Reverse -236 -255 7.17762 0.109
NP_440593.1_3 Forward -255 -236 -7.4737 0.295
NP_441046.1_2 Reverse -236 -255 -0.197208 0.276
NP_441409.1_8 Reverse -181 -200 7.11289 0.297
NP_442843.1_1 Reverse -324 -343 -5.99873 0.244
NP_442843.1_1 Forward -157 -138 -11.1119 0.286
NP_439960.1_10 Reverse -237 -255 -1.75081 0.245
NP_441570.1_1 Reverse -241 -259 -12.7639 0.218
NP_440078.1_10 Reverse -336 -355 1.86774 0.291
NP_441078.1_4 Forward -165 -156 -1.57357 0.266
NP_441078.1_4 Reverse -241 -250 -1.86856 0.272
NP_442729.1_8 Forward -266 -253 5.91914 0.223
NP_441663.1_8 Reverse -150 -169 -3.54046 0.291
NP_440707.1_8 Forward -258 -239 18.7807 0.108
NP_441432.1_9 Forward -336 -323 8.11358 0.294
NP_440313.1_5 Forward -243 -225 13.9813 0.214
NP_440629.1_4 Forward -344 -325 7.96426 0.284
NP_440321.1_1 Forward -148 -131 29.1448 0.0000747
NP_442815.1_2 Reverse -251 -269 4.14905 0.244
NP_442727.1_1 Forward -274 -260 11.111 0.297
NP_441072.1_2 Forward -266 -247 12.1925 0.173
NP_442489.1_7 Reverse -241 -250 -1.37691 0.195
NP_440757.1_7 Reverse -236 -254 1.19912 0.269
NP_441452.1_10 Reverse -90 -109 16.4207 0.192
NP_442763.1_10 Forward -255 -236 2.26107 0.26
NP_442913.1_10 Reverse -232 -251 8.84924 0.0464
NP_441040.1_2 Reverse -233 -252 -7.76869 0.224
NP_440315.1_6 Reverse -256 -272 1.82849 0.227
NP_442346.1_5 Reverse -246 -256 10.4031 0.0967
NP_442346.1_5 Forward -251 -241 8.33817 0.14
NP_440545.1_3 Forward -254 -237 10.5603 0.0314
NP_440545.1_3 Reverse -243 -260 -3.20608 0.201
NP_441653.1_2 Reverse -157 -176 12.3233 0.0959
NP_440010.1_4 Forward -260 -241 2.85027 0.222
NP_440010.1_4 Reverse -237 -256 -2.8529 0.291
NP_442900.1_1 Forward -68 -49 -3.3438 0.202
NP_440449.1_6 Reverse -233 -251 9.52025 0.174
NP_441948.1_4 Reverse -231 -249 4.34571 0.0959
NP_441329.1_6 Reverse -285 -304 1.76618 0.231
NP_441329.1_6 Reverse -274 -293 -0.907597 0.286
NP_441895.1_10 Reverse -326 -345 -18.5851 0.282
NP_440671.1_4 Reverse -225 -239 5.30946 0.286
NP_441915.1_4 Forward -251 -232 10.52 0.272
NP_442199.1_5 Forward -264 -245 -6.58872 0.277
NP_442140.1_3 Reverse -239 -249 7.35486 0.142
NP_441671.1_1 Forward -267 -248 -0.983855 0.273
NP_440875.1_9 Forward -163 -153 7.69067 0.255
NP_441813.1_5 Reverse -154 -164 -0.0199663 0.227
NP_441259.1_7 Reverse -331 -349 16.0471 0.188
NP_440590.1_4 Forward -164 -151 -5.97891 0.296
NP_440821.1_4 Forward -167 -157 -0.708283 0.287
NP_441951.1_4 Reverse -238 -257 4.81767 0.273
NP_442568.1_8 Reverse -278 -292 11.701 0.257
NP_442568.1_8 Reverse -265 -279 10.226 0.257
NP_442270.1_9 Forward -238 -219 -10.6203 0.259
NP_441541.1_1 Forward -123 -105 8.97823 0.116
NP_441541.1_1 Forward -122 -104 -1.62138 0.24
NP_440833.1_6 Forward -342 -328 11.2087 0.225
NP_440833.1_6 Reverse -166 -180 8.06211 0.277
NP_442138.1_1 Reverse -245 -264 2.6536 0.24
NP_441119.1_6 Reverse -88 -107 10.1275 0.211
NP_440546.1_6 Reverse -231 -250 7.57094 0.268
NP_440462.1_6 Reverse -154 -164 4.3066 0.205
NP_442340.1_3 Forward -254 -235 -11.0136 0.295
NP_441582.1_5 Forward -252 -233 2.85027 0.281
NP_442402.1_10 Forward -303 -293 10.1076 0.3
NP_441084.1_6 Forward -366 -352 9.15021 0.292
NP_442679.1_1 Reverse -282 -301 9.93088 0.147
NP_442679.1_1 Reverse -269 -288 -3.63879 0.261
NP_442679.1_1 Reverse -281 -300 -4.03212 0.269
NP_439994.1_3 Forward -381 -362 8.5361 0.287
NP_440505.1_3 Reverse -154 -164 5.5849 0.222
NP_440505.1_7 Reverse -234 -253 -1.18052 0.271
NP_441701.1_3 Reverse -238 -255 5.84037 0.299
NP_442255.1_5 Reverse -337 -356 14.7491 0.195
NP_442532.1_7 Reverse -238 -252 3.34284 0.201
NP_442533.1_1 Forward -157 -138 2.45773 0.105
NP_442533.1_1 Forward -148 -129 -5.99873 0.158
NP_442533.1_6 Forward -250 -241 5.60459 0.137
NP_442533.1_6 Reverse -247 -256 5.11294 0.155
NP_442533.1_6 Forward -256 -247 4.12963 0.191
NP_442533.1_6 Reverse -241 -250 3.7363 0.204
NP_442533.1_6 Forward -345 -336 2.55633 0.25
NP_442232.1_3 Forward -58 -39 -13.5702 0.282
NP_442322.1_4 Reverse -39 -56 -4.68172 0.26
NP_441697.1_5 Reverse -100 -119 -5.01375 0.224
NP_441028.1_6 Forward -302 -292 3.51951 0.292
NP_442202.1_4 Forward -252 -238 17.0045 0.143
NP_441527.1_4 Reverse -266 -285 0.90675 0.134
NP_441527.1_4 Reverse -263 -282 -4.05883 0.179
NP_441527.1_4 Reverse -278 -297 -4.63178 0.188
NP_441527.1_4 Reverse -276 -295 -10.4568 0.27
NP_441602.1_3 Forward -255 -236 0.884433 0.217
NP_441602.1_3 Reverse -242 -261 -5.21209 0.28
NP_441972.1_5 Reverse -242 -261 2.75272 0.121
NP_440429.1_2 Reverse -248 -267 10.7175 0.267
NP_441705.1_3 Reverse -282 -301 -4.81876 0.291
NP_440886.1_7 Reverse -138 -148 10.4026 0.0805
NP_440886.1_7 Forward -248 -238 7.25606 0.0993
NP_440886.1_7 Forward -251 -241 6.0761 0.147
NP_440886.1_7 Reverse -252 -262 3.8145 0.265
NP_440828.1_1 Forward -248 -229 4.03023 0.219
NP_440828.1_4 Forward -257 -238 9.53674 0.0908
NP_440828.1_4 Forward -266 -247 -1.37794 0.206
NP_442614.1_2 Forward -240 -226 5.80112 0.297
NP_440823.1_4 Forward -390 -371 10.1275 0.0595
NP_442963.1_6 Forward -255 -236 22.004 0.0166
NP_440907.2_8 Reverse -157 -167 4.60114 0.257
NP_441626.1_2 Reverse -157 -164 4.66067 0.267
NP_441962.1_4 Forward -255 -236 1.37609 0.103
NP_441962.1_4 Reverse -239 -258 -6.88371 0.183
NP_440387.1_1 Reverse -156 -172 -6.62797 0.298
NP_441488.1_7 Forward -145 -126 2.26107 0.271
NP_441836.1_2 Forward -262 -243 10.5209 0.0879
NP_441836.1_2 Reverse -235 -254 -2.16383 0.226
NP_441836.1_2 Forward -357 -338 -6.58872 0.3
NP_441993.1_1 Reverse -238 -257 3.01872 0.244
NP_440114.1_10 Forward -227 -213 7.9644 0.219
NP_440293.1_3 Reverse -239 -258 -2.26216 0.239
NP_440293.1_3 Forward -258 -239 -6.39206 0.288
NP_440457.1_1 Forward -158 -146 2.59558 0.207
NP_442680.1_5 Reverse -271 -290 -0.513913 0.284
NP_441885.1_5 Reverse -253 -263 -1.19994 0.255
NP_442341.1_7 Forward -251 -237 10.9143 0.0591
NP_441756.1_5 Forward -157 -138 -0.688862 0.249
NP_442395.2_4 Forward -241 -222 2.45694 0.223
NP_441662.1_8 Reverse -182 -201 6.88262 0.244
NP_443010.1_7 Reverse -243 -262 12.29 0.278
NP_441635.1_2 Reverse -105 -124 12.9387 0.241
NP_439962.1_4 Forward -255 -236 5.50599 0.173
NP_440149.1_8 Reverse -241 -260 -1.86883 0.162
NP_440216.1_1 Forward -165 -151 -11.8001 0.219
NP_440216.1_9 Reverse -381 -390 13.9627 0.184
NP_442371.1_1 Reverse -293 -303 12.3692 0.254
NP_442418.1_4 Reverse -98 -116 11.3655 0.259
NP_440416.1_9 Reverse -138 -157 -19.5684 0.276
NP_443052.1_9 Forward -254 -235 4.42435 0.155
NP_443052.1_9 Reverse -139 -158 -6.68705 0.287
NP_442154.1_1 Reverse -239 -257 -1.84914 0.123
NP_440988.1_10 Reverse -239 -253 4.99564 0.247
NP_440988.1_10 Forward -258 -244 4.51157 0.259
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTAAGGTAATTTGCCATGCAGCGCACCCGATTAAATACCATTGTTGAAGTTCGTGGCCAGCAACTTTCCCAATTTTTTAGGAATCCCTGGCGACGTATTTCCCTCAGTTTATTGTCCTTTTTATTCGGCTTTTTTGTCGGGACAGCCGTGGCCACCACCGCCGGTCAGAATTCCCAATGGGACGTAGTTTGTGCTGCCTTCATTCTGCTTTTTTGTGAATTGGTCAATCGTTGGTTCTATCGCCGGGGGGTGAAGATGGGGGACTTGCAGGCTGAAGTATTAAATATTTTTAAAATGGGTGTTTCCTACAGTTTATTCTTAGAAGCTTTCAAGTTGGGTTCCTAGGGAGAGGGATAGTGGAACCGTACTTAATTTAGAAATTCAATTTGGATTTAATAA

CDS

ATGGCATCATTAATCAGCTTTTGGTTATTTTTTGCCCTCAGTTTACTGCAACCTCAACAAAGACAATTTTTAGCTAGTAAACCTTGGCAAGACTGGTTGTTAGATGGGGTAAGTTTAGGTATACAAGGAGCGATTATCCCCCTGCTGCAATTGTTATTAGTAATCAATTTTTACTCCTTGATTATTCCCCACTGGCAACATAGTTTTAACCTATTTGCTGGGGGGCAATTTCTCCTCGGCTTTGTGGCTATTGATTACGTTTATTATTGGAGCCATCGAGCACTACACAGCAAATTGCTATTTCCCATTCACCAAGTCCACCACACCGTTAGTCAAATGGATATGGTTAGTTGTGCACGCAACACTTTTTGGTCTAGCTTGTTTTTGCCCTACGTTTGGCTAAATAGCCTCATAATTTATTTATTGCACGATGCCAGGGGATATATTCTCGCCATTAGTTGCACCTACTTACTGGATCTATGGCGTCATAGTTCCCTAATTATTAATAAAAAATGTTGGTTACACGACTGCTTAAATAGCTGGCTGATTTTACCCCAAGACCACGGATTGCACCATCACCAAATCGGCAAGGGAAATTTTGGTGCTAATTTAAAACTTTGGGACAAAATCCATGGTACCTATTTGAAAAATACCTTACCAAATCAACTTAGTATTTCTTCCGGAATGGGCATTAAACTTGAATTAACTTTGTGGCAAAAGCTTTTCTGGCCATTGACCTAA

Protein

MASLISFWLFFALSLLQPQQRQFLASKPWQDWLLDGVSLGIQGAIIPLLQLLLVINFYSLIIPHWQHSFNLFAGGQFLLGFVAIDYVYYWSHRALHSKLLFPIHQVHHTVSQMDMVSCARNTFWSSLFLPYVWLNSLIIYLLHDARGYILAISCTYLLDLWRHSSLIINKKCWLHDCLNSWLILPQDHGLHHHQIGKGNFGANLKLWDKIHGTYLKNTLPNQLSISSGMGIKLELTLWQKLFWPLT