Your browser is old and dusty. Try Google Chrome!

Details for sll1507

ORF sll1507
Accession NP_440328.1
Symbol
Category salt-induced periplasmic protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -364 -378 -1.5737 0.265
NP_440557.1_1 Reverse -359 -378 -0.295539 0.269
NP_441418.1_6 Reverse -201 -220 -28.8115 0.211
NP_441418.1_6 Reverse -195 -214 -28.9099 0.213
NP_441418.1_6 Reverse -126 -145 -29.0082 0.215
NP_441453.1_4 Reverse -217 -225 3.756 0.288
NP_441818.1_9 Reverse -189 -208 3.6377 0.18
NP_441818.1_9 Reverse -186 -205 -10.522 0.295
NP_442169.1_1 Reverse -230 -249 -1.96717 0.271
NP_441630.1_3 Forward -234 -215 -1.37718 0.298
NP_440150.1_6 Forward -229 -210 3.53937 0.248
NP_440150.1_6 Reverse -138 -157 2.75272 0.268
NP_442744.1_8 Reverse -135 -154 -5.01543 0.297
NP_440061.1_9 Forward -152 -138 5.80051 0.272
NP_440110.1_8 Reverse -46 -65 1.86774 0.211
NP_441054.1_2 Reverse -235 -254 11.2092 0.271
NP_442062.1_8 Reverse -217 -227 4.20827 0.228
NP_441641.1_6 Forward -59 -40 12.0375 0.25
NP_440304.1_4 Reverse -215 -225 7.15819 0.129
NP_439918.1_2 Reverse -195 -214 -3.14714 0.251
NP_441594.1_6 Forward -153 -134 4.12936 0.222
NP_441082.1_10 Forward -186 -173 10.7374 0.236
NP_441925.1_2 Reverse -12 -31 -0.000545616 0.298
NP_441925.1_4 Forward -226 -207 -14.4559 0.263
NP_441925.1_4 Forward -219 -200 -16.3242 0.282
NP_441925.1_4 Forward -148 -129 -17.0125 0.287
NP_441083.1_5 Forward -226 -216 6.76487 0.0775
NP_441083.1_5 Reverse -351 -361 3.32329 0.173
NP_441083.1_5 Reverse -217 -227 1.16001 0.215
NP_441558.1_5 Forward -228 -209 5.89931 0.236
NP_442889.1_1 Reverse -189 -208 -10.522 0.217
NP_442889.1_1 Forward -291 -272 -15.1435 0.288
NP_441716.1_1 Forward -226 -212 12.586 0.0741
NP_440343.1_9 Reverse -233 -252 7.47261 0.279
NP_440343.1_9 Reverse -104 -123 7.07928 0.291
NP_440343.1_9 Reverse -200 -219 6.98095 0.292
NP_440747.1_10 Forward -229 -217 7.11881 0.00789
NP_441014.1_8 Forward -121 -102 -9.83364 0.299
NP_443018.1_3 Forward -225 -218 4.07068 0.299
NP_441634.1_8 Reverse -145 -159 -1.08205 0.278
NP_441634.1_8 Forward -228 -214 -3.54032 0.295
NP_441634.1_8 Forward -152 -138 -4.62196 0.295
NP_440376.1_1 Forward -226 -217 6.68623 0.0902
NP_440376.1_1 Reverse -217 -226 -0.196935 0.285
NP_441002.1_3 Reverse -341 -360 8.84842 0.293
NP_442687.1_1 Reverse -9 -22 10.9334 0.285
NP_442687.1_7 Forward -309 -299 9.61647 0.0994
NP_442687.1_7 Reverse -216 -226 7.15819 0.138
NP_442191.1_4 Forward -71 -57 11.4779 0.256
NP_442191.1_4 Reverse -196 -210 10.7022 0.288
NP_441846.1_10 Reverse -233 -252 -14.9469 0.241
NP_441846.1_10 Reverse -200 -219 -23.305 0.282
NP_440042.1_1 Reverse -340 -359 8.45592 0.238
NP_441029.1_3 Forward -208 -189 8.16093 0.277
NP_440533.1_4 Forward -228 -209 15.3391 0.297
NP_441950.1_7 Reverse -225 -244 0.982764 0.175
NP_441950.1_7 Reverse -189 -208 -2.85214 0.203
NP_440360.1_10 Forward -148 -134 4.03116 0.227
NP_441487.1_6 Forward -234 -215 -0.000545616 0.259
NP_442653.1_4 Reverse -243 -262 15.7324 0.136
NP_439959.1_6 Reverse -130 -149 5.99764 0.274
NP_442321.1_4 Reverse -360 -379 -5.60541 0.284
NP_441317.1_4 Forward -16 -2 13.4746 0.175
NP_441958.1_5 Reverse -216 -226 0.865012 0.12
NP_439905.1_1 Forward -203 -190 6.4108 0.288
NP_440984.1_7 Forward -231 -217 4.81781 0.287
NP_443055.1_6 Forward -203 -185 2.37835 0.212
NP_441099.1_5 Forward -71 -52 -9.63698 0.229
NP_441654.1_6 Reverse -8 -26 13.4663 0.296
NP_441294.1_7 Forward -312 -298 10.3065 0.197
NP_442438.1_10 Forward -231 -217 -1.08205 0.291
NP_442431.1_10 Reverse -228 -246 -0.7675 0.294
NP_441752.1_6 Forward -205 -186 1.37609 0.257
NP_440147.1_4 Reverse -215 -228 6.31247 0.0963
NP_441916.1_7 Forward -226 -216 4.40493 0.178
NP_441916.1_10 Forward -272 -253 0.982764 0.27
NP_441041.1_4 Reverse -58 -77 -3.44213 0.122
NP_441041.1_4 Reverse -225 -244 -11.7019 0.251
NP_440703.1_9 Reverse -172 -185 4.44361 0.298
NP_441725.1_5 Forward -225 -215 2.04498 0.115
NP_440202.1_8 Forward -71 -52 11.7516 0.272
NP_442941.1_3 Reverse -218 -228 -0.118297 0.249
NP_440983.1_5 Forward -219 -200 -2.26216 0.231
NP_442281.1_1 Forward -231 -217 4.32555 0.199
NP_441079.1_1 Reverse -120 -139 15.4374 0.247
NP_440437.1_1 Forward -228 -209 -4.32711 0.256
NP_441164.1_3 Reverse -90 -109 9.53756 0.0703
NP_441556.1_10 Reverse -250 -264 10.2218 0.273
NP_441644.1_6 Reverse -217 -227 5.97777 0.172
NP_441644.1_6 Forward -226 -216 4.30615 0.242
NP_442029.1_1 Reverse -127 -146 -11.4069 0.229
NP_442029.1_6 Reverse -195 -214 7.7676 0.222
NP_442029.1_6 Forward -99 -80 6.58763 0.238
NP_442933.1_10 Forward -226 -217 4.62128 0.227
NP_441751.2_8 Forward -225 -211 -4.22864 0.166
NP_442926.1_3 Reverse -226 -245 3.93269 0.277
NP_442554.1_8 Forward -225 -215 11.0914 0.0391
NP_442554.1_8 Reverse -218 -228 5.28991 0.153
NP_442554.1_8 Reverse -142 -152 1.94665 0.288
NP_442292.1_1 Reverse -218 -227 5.70292 0.135
NP_441523.1_3 Forward -223 -205 24.4052 0.00833
NP_441715.1_4 Reverse -218 -228 4.99491 0.24
NP_441448.1_1 Reverse -139 -158 8.06259 0.21
NP_441448.1_1 Reverse -130 -149 6.39097 0.249
NP_440464.1_10 Reverse -86 -96 12.4352 0.225
NP_441468.1_1 Forward -225 -218 10.9539 0.0726
NP_441015.1_10 Reverse -136 -155 4.52268 0.125
NP_441015.1_10 Reverse -142 -161 -3.63879 0.19
NP_441015.1_10 Reverse -226 -245 -7.57203 0.269
NP_441015.1_10 Reverse -202 -221 -10.3253 0.284
NP_441673.1_1 Forward -226 -217 1.37636 0.114
NP_441673.1_1 Reverse -217 -226 1.1797 0.163
NP_441826.1_2 Reverse -211 -225 1.37622 0.154
NP_442868.1_6 Forward -228 -218 -0.216628 0.273
NP_441056.1_1 Reverse -351 -370 -8.35868 0.282
NP_440785.1_1 Reverse -1 -20 1.57275 0.238
NP_443058.1_9 Forward -149 -131 12.5072 0.195
NP_442808.1_1 Forward -211 -201 4.30615 0.2
NP_441101.1_10 Forward -230 -211 -0.590531 0.189
NP_442113.1_10 Forward -244 -225 -9.44032 0.295
NP_441518.1_3 Reverse -89 -108 -15.0452 0.286
NP_441878.1_6 Reverse -216 -226 9.41981 0.0266
NP_441878.1_6 Reverse -140 -150 1.65166 0.0795
NP_441878.1_6 Forward -227 -217 1.65166 0.0795
NP_441878.1_6 Reverse -210 -220 -7.78811 0.266
NP_441557.1_5 Forward -226 -217 0.491382 0.144
NP_441557.1_5 Reverse -217 -226 0.29472 0.174
NP_441557.1_8 Reverse -218 -228 11.5826 0.244
NP_441445.1_1 Reverse -208 -227 1.27776 0.259
NP_442066.2_9 Forward -246 -233 10.934 0.154
NP_440676.1_9 Forward -92 -74 19.7837 0.249
NP_441574.1_1 Reverse -117 -136 -2.36049 0.226
NP_441549.1_9 Forward -224 -206 -10.8956 0.291
NP_442347.1_2 Reverse -86 -95 8.06287 0.116
NP_442347.1_2 Reverse -352 -361 6.09625 0.191
NP_442594.1_8 Reverse -199 -218 1.86774 0.295
NP_441633.1_3 Forward -228 -215 -6.37223 0.248
NP_442590.1_9 Reverse -104 -123 5.70265 0.269
NP_442590.1_10 Reverse -351 -370 7.7676 0.219
NP_442998.1_5 Reverse -240 -250 7.05986 0.3
NP_440899.1_8 Reverse -245 -264 -9.73531 0.268
NP_440299.1_1 Reverse -213 -226 8.86849 0.0835
NP_441799.1_1 Reverse -213 -227 6.48882 0.17
NP_441007.1_10 Reverse -136 -149 -0.275709 0.273
NP_441007.1_10 Reverse -127 -140 -0.472371 0.285
NP_442334.1_2 Reverse -233 -250 -14.3175 0.3
NP_442333.2_5 Reverse -53 -72 -15.5368 0.298
NP_442333.2_5 Forward -214 -195 -15.6352 0.299
NP_440256.1_1 Reverse -296 -315 -8.06369 0.251
NP_441559.1_8 Reverse -80 -94 3.14618 0.143
NP_441559.1_8 Reverse -261 -275 -4.81863 0.238
NP_442756.1_10 Reverse -257 -276 17.8957 0.105
NP_441270.1_5 Reverse -197 -216 13.1894 0.236
NP_440915.1_6 Forward -230 -216 -1.37704 0.233
NP_441296.1_9 Forward -77 -64 19.1932 0.0761
NP_440748.1_4 Reverse -201 -220 17.8948 0.14
NP_441464.1_8 Forward -150 -136 10.1277 0.183
NP_441113.1_3 Forward -310 -296 16.3219 0.23
NP_439985.1_7 Reverse -211 -230 12.6841 0.163
NP_442993.1_1 Forward -226 -210 -9.08625 0.179
NP_440570.1_5 Forward -236 -217 1.67108 0.236
NP_442484.1_2 Reverse -359 -378 5.30933 0.172
NP_440327.1_6 Reverse -195 -214 9.0459 0.212
NP_441254.1_3 Forward -66 -47 10.4225 0.217
NP_442240.1_1 Reverse -130 -149 5.60352 0.264
NP_442714.1_5 Forward -59 -40 1.57275 0.238
NP_440586.1_1 Reverse -197 -216 -1.7705 0.241
NP_440684.1_9 Forward -225 -211 8.84938 0.223
NP_440027.1_3 Forward -204 -186 2.77167 0.286
NP_440027.1_8 Reverse -354 -373 8.25844 0.249
NP_439937.1_8 Reverse -133 -152 -3.04881 0.265
NP_439937.1_9 Forward -253 -236 -12.9415 0.278
NP_443039.1_7 Forward -78 -64 7.57046 0.19
NP_440408.1_7 Reverse -63 -82 12.7825 0.202
NP_440408.1_7 Forward -379 -360 7.47261 0.288
NP_440770.1_3 Forward -19 -5 14.9459 0.257
NP_441138.1_5 Forward -14 -1 2.92653 0.297
NP_441789.1_7 Forward -250 -231 0.588665 0.245
NP_441789.1_7 Forward -235 -216 -2.95123 0.267
NP_441803.1_2 Reverse -142 -161 6.88262 0.147
NP_441572.1_7 Forward -232 -213 -1.18052 0.186
NP_442384.1_10 Forward -226 -213 8.77074 0.0608
NP_441604.1_4 Reverse -362 -381 -7.08038 0.293
NP_441018.1_7 Reverse -295 -314 13.5691 0.132
NP_442262.1_10 Forward -225 -218 9.47889 0.187
NP_440163.1_10 Forward -111 -101 8.73149 0.262
NP_440163.1_10 Reverse -182 -192 8.23984 0.282
NP_440344.1_10 Forward -315 -298 -8.12263 0.123
NP_440282.1_10 Reverse -131 -150 -5.9004 0.25
NP_440282.1_10 Reverse -207 -226 -6.88371 0.25
NP_440531.1_6 Forward -189 -170 1.57275 0.173
NP_440297.1_9 Forward -225 -215 9.02648 0.0943
NP_440999.1_9 Forward -244 -230 0.687908 0.177
NP_440999.1_9 Reverse -81 -95 -2.06536 0.257
NP_440888.1_2 Reverse -217 -231 11.7003 0.0611
NP_440888.1_2 Forward -240 -226 8.55376 0.156
NP_440888.1_2 Reverse -357 -371 6.58715 0.228
NP_440822.1_10 Reverse -103 -117 14.6509 0.287
NP_442277.1_4 Forward -246 -227 0.981987 0.291
NP_441543.1_2 Reverse -218 -227 5.01461 0.209
NP_441469.1_8 Reverse -140 -149 7.27622 0.227
NP_441462.1_2 Forward -226 -216 0.668351 0.135
NP_441462.1_5 Reverse -230 -249 4.916 0.27
NP_443062.1_6 Forward -293 -274 5.11266 0.209
NP_441601.1_4 Forward -71 -52 -5.99873 0.295
NP_442204.1_1 Forward -230 -219 -0.0396598 0.285
NP_441560.1_10 Forward -161 -142 6.58763 0.287
NP_442428.1_5 Forward -225 -218 4.66067 0.244
NP_441052.1_2 Reverse -217 -227 7.55152 0.0685
NP_441052.1_2 Forward -308 -298 -0.609952 0.288
NP_440436.1_4 Reverse -218 -227 4.62087 0.248
NP_441336.1_3 Reverse -51 -65 16.7159 0.264
NP_440041.1_2 Reverse -46 -65 -7.17871 0.298
NP_441004.1_1 Reverse -195 -214 4.22769 0.106
NP_441004.1_2 Reverse -232 -251 -2.55715 0.264
NP_441004.1_2 Reverse -130 -149 -2.65548 0.264
NP_442206.1_1 Forward -150 -131 -2.16383 0.153
NP_440328.1_4 Reverse -103 -122 0.196116 0.258
NP_440328.1_5 Forward -326 -307 21.1406 0.11
NP_440328.1_8 Forward -222 -203 18.1255 0.249
NP_441851.1_10 Forward -227 -217 5.09324 0.227
NP_442208.1_5 Reverse -228 -247 -10.1286 0.296
NP_442856.1_5 Forward -236 -217 17.3424 0.205
NP_442515.1_1 Forward -151 -137 -4.52363 0.298
NP_441396.1_5 Reverse -133 -142 7.66954 0.241
NP_440463.1_7 Forward -326 -312 15.2409 0.275
NP_441349.1_10 Forward -230 -211 -4.91709 0.186
NP_441349.1_10 Reverse -65 -84 -6.68705 0.235
NP_441349.1_10 Reverse -207 -226 -9.83364 0.297
NP_441409.1_6 Reverse -211 -230 -8.65367 0.172
NP_440431.1_3 Forward -380 -361 -9.93197 0.264
NP_442450.1_5 Reverse -215 -225 6.76487 0.155
NP_440195.1_4 Forward -301 -282 6.09597 0.279
NP_442006.1_2 Reverse -55 -72 -7.04099 0.169
NP_442243.1_1 Reverse -204 -222 -2.14486 0.287
NP_441570.1_1 Reverse -217 -235 -11.2889 0.191
NP_441078.1_4 Forward -226 -217 7.66954 0.052
NP_441078.1_4 Reverse -217 -226 0.688044 0.164
NP_440707.1_9 Reverse -106 -125 4.03102 0.259
NP_442443.1_1 Reverse -226 -245 4.22769 0.16
NP_442443.1_1 Reverse -202 -221 0.392778 0.218
NP_441432.1_8 Forward -227 -218 4.32629 0.223
NP_442797.1_1 Forward -208 -189 -5.60541 0.288
NP_442353.1_4 Forward -66 -47 4.22689 0.205
NP_442489.1_7 Forward -226 -217 8.1612 0.0294
NP_442489.1_7 Reverse -217 -226 0.491382 0.178
NP_441659.2_8 Reverse -217 -227 6.27322 0.0797
NP_441659.2_8 Forward -226 -216 -0.118297 0.287
NP_442008.1_2 Reverse -214 -233 4.916 0.232
NP_442346.1_5 Reverse -216 -226 7.15819 0.178
NP_442346.1_5 Forward -227 -217 6.27322 0.208
NP_440545.1_3 Forward -154 -137 0.235503 0.143
NP_440545.1_3 Forward -230 -213 -0.747806 0.157
NP_440025.1_3 Forward -178 -164 13.4183 0.24
NP_440831.1_3 Forward -235 -216 9.59069 0.191
NP_441629.1_1 Reverse -209 -228 17.0107 0.147
NP_441629.1_3 Forward -244 -225 -1.77127 0.268
NP_440486.1_6 Reverse -134 -153 9.0459 0.235
NP_440459.1_2 Reverse -55 -72 8.29864 0.266
NP_440010.1_10 Forward -153 -134 2.45773 0.277
NP_440010.1_10 Reverse -189 -208 1.86774 0.292
NP_440847.1_3 Forward -121 -107 12.9786 0.231
NP_440671.1_4 Reverse -147 -161 8.16106 0.202
NP_442045.1_5 Reverse -90 -109 -0.295539 0.269
NP_441813.1_7 Forward -204 -190 20.2551 0.0796
NP_440590.1_4 Forward -66 -53 -5.48725 0.28
NP_442497.1_10 Forward -225 -216 0.393051 0.175
NP_440821.1_4 Reverse -215 -225 0.176696 0.198
NP_441239.1_9 Forward -228 -216 4.16888 0.26
NP_440156.1_4 Forward -251 -241 14.5325 0.176
NP_440400.1_1 Forward -82 -63 5.2102 0.22
NP_440400.1_1 Forward -157 -138 -2.45958 0.285
NP_442270.1_9 Forward -65 -46 -6.78538 0.209
NP_441526.1_6 Reverse -130 -149 5.60432 0.265
NP_440949.1_7 Forward -380 -361 10.815 0.233
NP_442041.1_2 Reverse -194 -212 10.2456 0.283
NP_441230.1_6 Forward -211 -192 13.0775 0.212
NP_440675.1_1 Reverse -185 -204 3.44104 0.252
NP_442402.1_1 Forward -126 -107 10.4225 0.254
NP_442402.1_4 Reverse -247 -266 -6.58946 0.259
NP_442402.1_10 Reverse -256 -266 13.7459 0.199
NP_442402.1_10 Forward -249 -239 11.8776 0.231
NP_440653.1_10 Forward -378 -359 3.73603 0.265
NP_442358.1_9 Reverse -188 -207 13.7658 0.28
NP_442380.1_10 Reverse -131 -149 12.9988 0.19
NP_440160.1_9 Forward -338 -319 10.2259 0.235
NP_442053.1_1 Reverse -217 -226 4.91628 0.218
NP_441959.1_8 Forward -51 -38 8.32366 0.296
NP_440207.2_10 Forward -230 -216 18.7808 0.174
NP_440013.1_5 Reverse -5 -19 17.8871 0.198
NP_440914.1_1 Forward -258 -248 7.15123 0.249
NP_440914.1_1 Reverse -173 -183 6.46809 0.279
NP_442101.1_10 Forward -234 -215 15.0441 0.0155
NP_442533.1_1 Reverse -123 -142 -9.047 0.218
NP_442533.1_1 Reverse -225 -244 -12.6852 0.236
NP_442533.1_1 Reverse -132 -151 -13.6686 0.237
NP_442533.1_6 Reverse -217 -226 8.55452 0.0747
NP_442533.1_6 Forward -226 -217 6.48957 0.109
NP_442533.1_6 Reverse -141 -150 4.12963 0.191
NP_442541.1_10 Reverse -217 -231 1.08065 0.292
NP_439944.1_9 Forward -225 -215 5.19158 0.27
NP_441697.1_5 Forward -53 -34 -7.21006 0.242
NP_441028.1_6 Reverse -16 -26 7.84605 0.218
NP_440007.1_9 Reverse -263 -277 4.32615 0.267
NP_440007.1_9 Forward -370 -356 0.589577 0.294
NP_441680.1_4 Forward -241 -222 -2.16383 0.266
NP_441680.1_4 Forward -218 -199 -2.65548 0.27
NP_441602.1_3 Reverse -189 -208 -3.93378 0.256
NP_440429.1_9 Reverse -216 -235 -0.39387 0.297
NP_442306.1_10 Forward -155 -136 -21.9284 0.296
NP_441286.1_1 Forward -227 -215 4.46387 0.0326
NP_441286.1_10 Forward -77 -58 14.0608 0.232
NP_442674.1_10 Forward -393 -374 14.7491 0.2
NP_440670.1_8 Reverse -217 -226 5.3096 0.167
NP_440886.1_7 Forward -142 -132 10.0093 0.0805
NP_440886.1_7 Reverse -216 -226 5.87944 0.158
NP_440886.1_7 Forward -217 -207 5.28945 0.188
NP_440886.1_7 Forward -235 -225 3.71617 0.267
NP_440828.1_1 Forward -71 -52 4.42355 0.215
NP_440828.1_1 Forward -235 -216 2.9486 0.231
NP_440828.1_5 Reverse -176 -195 5.50599 0.278
NP_441001.1_10 Reverse -131 -150 7.07928 0.249
NP_442800.1_2 Reverse -136 -155 6.88262 0.26
NP_441808.1_8 Reverse -192 -211 5.89931 0.294
NP_442459.1_7 Reverse -244 -263 5.30933 0.212
NP_442211.1_3 Reverse -52 -71 11.6543 0.257
NP_442238.1_3 Reverse -64 -83 5.89931 0.254
NP_440107.1_5 Forward -148 -129 -3.73712 0.18
NP_442794.1_1 Forward -230 -218 6.43049 0.18
NP_442467.1_4 Reverse -217 -236 11.5042 0.156
NP_441742.1_7 Forward -153 -134 18.0924 0.244
NP_440387.1_5 Forward -76 -57 19.9763 0.0798
NP_440855.1_5 Forward -68 -49 7.4718 0.285
NP_441836.1_2 Reverse -308 -327 -6.49039 0.298
NP_442323.1_7 Reverse -352 -371 1.57197 0.278
NP_440492.1_9 Forward -57 -43 9.69621 0.294
NP_440311.1_2 Forward -384 -365 10.2259 0.299
NP_440311.1_8 Forward -263 -249 18.2892 0.25
NP_441500.1_8 Forward -357 -343 17.0456 0.261
NP_442833.1_2 Reverse -194 -212 16.3413 0.27
NP_442087.1_2 Reverse -233 -252 12.631 0.288
NP_440293.1_3 Reverse -139 -158 -4.72043 0.264
NP_441246.1_2 Reverse -88 -107 2.65439 0.222
NP_440457.1_1 Reverse -60 -72 3.87389 0.182
NP_440457.1_1 Reverse -213 -225 1.61227 0.232
NP_442940.1_2 Forward -150 -131 8.25926 0.167
NP_440801.1_8 Forward -157 -138 2.26107 0.229
NP_440801.1_10 Reverse -134 -153 4.71934 0.289
NP_441332.1_6 Forward -149 -139 13.2926 0.19
NP_441332.1_6 Forward -211 -201 11.1627 0.269
NP_441436.1_8 Reverse -216 -235 11.3075 0.261
NP_442514.1_5 Forward -222 -203 -9.83437 0.298
NP_441440.1_8 Reverse -231 -244 18.6038 0.138
NP_441885.1_5 Reverse -217 -227 2.14332 0.0827
NP_441173.1_9 Reverse -258 -266 14.3753 0.161
NP_443000.1_7 Forward -228 -218 0.668351 0.293
NP_440727.1_2 Reverse -187 -206 -3.3438 0.295
NP_442932.1_9 Reverse -135 -154 6.88262 0.249
NP_442932.1_9 Reverse -228 -247 5.30933 0.266
NP_440679.1_10 Reverse -307 -326 -11.9969 0.185
NP_442451.1_2 Reverse -306 -325 -9.44032 0.259
NP_442214.1_1 Forward -112 -93 7.07928 0.298
NP_441105.1_3 Forward -231 -212 -7.08038 0.245
NP_442373.1_2 Reverse -198 -217 -7.17871 0.233
NP_440216.1_1 Reverse -217 -231 -2.55701 0.0521
NP_440216.1_1 Forward -226 -212 -11.5051 0.192
NP_440172.1_1 Forward -226 -216 3.81494 0.216
NP_440172.1_1 Reverse -217 -227 3.51995 0.224
NP_440172.1_6 Reverse -225 -244 4.22769 0.299
NP_442015.1_10 Reverse -54 -67 0.0192843 0.245
NP_442015.1_10 Forward -230 -217 -0.37404 0.264
NP_441766.1_2 Reverse -217 -226 3.83464 0.202
NP_440416.1_9 Forward -74 -55 -15.8318 0.201
NP_440416.1_9 Forward -233 -214 -17.0118 0.229
NP_443052.1_9 Forward -241 -222 5.30933 0.149
NP_443052.1_9 Forward -244 -225 5.211 0.149
NP_443052.1_9 Forward -217 -198 1.96607 0.179
NP_443052.1_9 Forward -214 -195 -0.197208 0.207
NP_443052.1_9 Forward -211 -192 -5.80207 0.274
NP_442154.1_1 Reverse -130 -148 -9.42063 0.179
NP_442154.1_1 Reverse -187 -205 -15.0255 0.218
NP_440261.1_5 Forward -225 -212 -6.17557 0.196
NP_440988.1_2 Forward -241 -223 18.8004 0.116
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCAACAGGATAGAAAGGATAAGGATAATGCCAAAGGAAATGCGGATCAGGTAAAACAACACCTGCCAAATGCTTTGGAGCCAACTCTGGAACCGTAAACGCCAATACTTATTGCGGAGAATTGTCCGGAACTGCTTGGGAAAAGCAAACACAATTTCCCCCGACTCCGCCACCTGGAGATGGCCCTCCACCTCCGACGCCAAAGTCAGCAACCCCTGTTGGGTTTGGTTAATTTCTAATCCAGCCTGGCTGGCCACGTCCCCCACCGTGACTACATAGTCCAACTGCTCCACAGCGGTCATAATTTGGGGATTAAAGGCGACACTCATTCCACTGCCCTCGGAGGCGACAATCATTAAAAATTATTCTTCTAGTATAGAGAGAAGATTTTTTGTCGATAT

CDS

GTGGATTTAGTGGTTATGAATGTGCGTTTTCCTCACTTTTGTTTAAGTTTAATGTTTGCTAGCCTGTTGGCTGGTGCTGGAACTCTTCCCCTGGCTGCAGCGGAACGGGTGGTGCTGACCTATAGTGTTTTGCGAGAATCCATCTCCATTGAGGAGTTAGGGGAGTTGAGCCGCACTGGGAAAGTGTCCCCCTCCCTCAAAGCCTATTTAAAAATGGCCAATAAAAACCCTGAAGAATTGCGGGGTTGGCTCAATCGACCGTTTCAGGCAGATCCAGTTACCCTCTCCCGGGTGCTCAACAGTTTTGCCGGGGAATATGTGCTCAATCAGGTGGGTCAGGTAATCCACACCCCTTCTAAGCGGGACAATAAAGAAGCTCTGCGGGGAGCTATTATCAGCTCTGCAGAAAAAGACAATCAGGTACGACTGATCGAAGTGTTGGAAAATTATCCCACCCCAGAACTCCACGTCAACGGTGATCGCCTGATGGAATTGTACCAACAAGTGGAAGGGTTGACGGCCATGTTAGGTCGACTACCTTTTTAG

Protein

MDLVVMNVRFPHFCLSLMFASLLAGAGTLPLAAAERVVLTYSVLRESISIEELGELSRTGKVSPSLKAYLKMANKNPEELRGWLNRPFQADPVTLSRVLNSFAGEYVLNQVGQVIHTPSKRDNKEALRGAIISSAEKDNQVRLIEVLENYPTPELHVNGDRLMELYQQVEGLTAMLGRLPF