Your browser is old and dusty. Try Google Chrome!

Details for sll1486

ORF sll1486
Accession NP_442908.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -216 -230 11.5043 0.242
NP_441061.1_2 Reverse -217 -231 15.7325 0.0328
NP_441061.1_2 Forward -224 -210 2.94952 0.168
NP_441061.1_2 Forward -326 -312 0.294584 0.213
NP_440557.1_1 Forward -23 -4 2.65439 0.229
NP_440557.1_1 Forward -218 -199 -2.26216 0.286
NP_440795.1_7 Forward -224 -217 14.6904 0.0123
NP_440795.1_7 Reverse -217 -224 14.6904 0.0123
NP_441418.1_6 Reverse -216 -235 -1.47551 0.0136
NP_441418.1_6 Forward -225 -206 -11.7019 0.0555
NP_442291.1_5 Forward -226 -210 19.9214 0.0165
NP_440897.1_9 Reverse -85 -103 17.1279 0.16
NP_441453.1_4 Reverse -216 -224 16.539 0.00633
NP_441453.1_4 Forward -225 -217 16.539 0.00633
NP_441453.1_4 Reverse -165 -173 3.85433 0.284
NP_441960.1_4 Forward -374 -358 12.3492 0.248
NP_442151.1_6 Forward -225 -211 7.76774 0.19
NP_441818.1_1 Forward -224 -213 18.8393 0.00301
NP_441818.1_1 Reverse -166 -177 9.89126 0.232
NP_441818.1_9 Reverse -330 -349 -8.06369 0.274
NP_440226.1_1 Forward -225 -206 20.4523 0.0102
NP_442169.1_1 Reverse -148 -167 -2.45882 0.277
NP_442169.1_1 Reverse -346 -365 -3.44213 0.295
NP_440120.1_8 Forward -90 -72 17.7187 0.168
NP_442744.1_9 Reverse -210 -224 13.9988 0.266
NP_442173.1_1 Forward -224 -216 15.4574 0.00633
NP_442173.1_1 Reverse -217 -225 15.4574 0.00633
NP_442752.1_3 Forward -276 -266 15.943 0.239
NP_442752.1_4 Forward -225 -218 13.8055 0.0199
NP_442752.1_4 Reverse -216 -223 13.8055 0.0199
NP_442752.1_4 Reverse -350 -357 5.25066 0.256
NP_442752.1_4 Reverse -165 -172 5.25066 0.256
NP_443027.1_4 Reverse -214 -224 14.0414 0.0452
NP_443027.1_4 Forward -227 -217 13.943 0.0452
NP_443027.1_4 Reverse -339 -349 6.8632 0.262
NP_441812.1_3 Forward -226 -212 8.55439 0.251
NP_442975.1_10 Forward -229 -215 21.6317 0.000774
NP_442975.1_10 Reverse -212 -226 4.71887 0.241
NP_440784.1_7 Forward -224 -217 15.9687 0.0123
NP_440784.1_7 Reverse -217 -224 15.9687 0.0123
NP_442909.1_7 Forward -224 -210 11.1104 0.131
NP_441934.1_9 Reverse -378 -397 16.6174 0.161
NP_440061.1_9 Reverse -163 -177 8.25877 0.177
NP_441054.1_2 Reverse -357 -376 14.9458 0.155
NP_442062.1_8 Reverse -216 -226 19.4496 0.000558
NP_442062.1_8 Forward -225 -215 17.3846 0.00193
NP_442062.1_8 Reverse -165 -175 10.4031 0.0493
NP_441859.1_3 Reverse -215 -234 12.88 0.0884
NP_440304.1_4 Reverse -214 -224 10.8948 0.051
NP_440304.1_4 Forward -227 -217 9.91146 0.051
NP_442242.1_1 Reverse -333 -352 15.922 0.28
NP_442242.1_4 Forward -224 -217 14.3954 0.0124
NP_442242.1_4 Reverse -217 -224 14.3954 0.0124
NP_440044.1_8 Reverse -217 -236 8.94757 0.0723
NP_440044.1_8 Forward -224 -205 7.86593 0.0803
NP_441581.1_6 Forward -234 -215 9.97118 0.29
NP_442097.1_7 Reverse -203 -222 9.83255 0.121
NP_441208.1_9 Reverse -213 -227 5.01447 0.282
NP_441594.1_6 Forward -234 -215 13.0775 0.109
NP_440132.1_1 Reverse -158 -176 16.0471 0.095
NP_440132.1_1 Forward -96 -78 11.3272 0.207
NP_442110.1_7 Reverse -216 -230 1.27789 0.233
NP_442110.1_7 Forward -225 -211 0.196253 0.266
NP_441083.1_5 Forward -225 -215 20.3345 0.00053
NP_441083.1_5 Reverse -216 -226 11.3864 0.0159
NP_442827.1_8 Forward -250 -231 -2.95123 0.294
NP_441738.1_2 Forward -223 -216 15.28 0.0102
NP_441738.1_2 Reverse -218 -225 15.28 0.0102
NP_440209.1_1 Reverse -216 -224 18.1123 0.00295
NP_440209.1_1 Forward -225 -217 18.1123 0.00295
NP_442889.1_8 Forward -228 -214 20.6484 0.00372
NP_442889.1_8 Forward -183 -169 5.30886 0.231
NP_442398.1_1 Forward -119 -100 11.7992 0.241
NP_441770.1_4 Forward -320 -301 -8.752 0.245
NP_441770.1_5 Forward -233 -214 -0.983855 0.259
NP_440178.1_7 Forward -226 -207 -5.11376 0.0603
NP_440053.1_5 Forward -128 -109 17.2074 0.0568
NP_442706.1_5 Reverse -184 -203 18.7259 0.108
NP_442570.1_3 Forward -150 -131 -4.6221 0.233
NP_441716.1_1 Forward -225 -211 10.7177 0.0936
NP_441716.1_1 Forward -118 -104 5.01447 0.243
NP_442111.1_4 Reverse -215 -229 12.586 0.0422
NP_441163.1_7 Reverse -230 -249 17.699 0.195
NP_440906.1_5 Forward -224 -217 15.8704 0.0124
NP_440906.1_5 Reverse -217 -224 15.8704 0.0124
NP_440747.1_10 Reverse -213 -225 7.51213 0.00286
NP_440747.1_10 Forward -228 -216 -2.02597 0.0196
NP_440747.1_10 Forward -177 -165 -12.5474 0.297
NP_441130.1_10 Reverse -214 -228 17.3058 0.0167
NP_441130.1_10 Forward -227 -213 10.3243 0.114
NP_441486.1_1 Reverse -213 -227 12.8809 0.00979
NP_441486.1_1 Forward -228 -214 11.701 0.0149
NP_441486.1_1 Reverse -162 -176 -5.70361 0.254
NP_442330.1_4 Forward -69 -50 16.9955 0.233
NP_442634.1_2 Forward -138 -119 4.32602 0.274
NP_442634.1_4 Forward -227 -213 -3.63866 0.161
NP_440403.1_4 Forward -234 -215 4.916 0.111
NP_440403.1_10 Forward -234 -215 8.45592 0.203
NP_441014.1_8 Forward -161 -142 6.98095 0.165
NP_441014.1_8 Reverse -74 -93 -6.98204 0.276
NP_441014.1_10 Reverse -215 -234 5.40686 0.185
NP_441014.1_10 Forward -328 -309 1.17865 0.231
NP_441014.1_10 Forward -226 -207 0.588665 0.241
NP_442848.1_1 Reverse -210 -224 16.1259 0.0143
NP_442848.1_1 Forward -231 -217 5.70279 0.0803
NP_442848.1_5 Reverse -191 -209 -3.81576 0.299
NP_443018.1_3 Forward -224 -217 14.8871 0.0123
NP_443018.1_3 Reverse -217 -224 14.8871 0.0123
NP_441634.1_8 Reverse -214 -228 21.7307 0.0101
NP_440376.1_1 Forward -225 -216 19.4693 0.000692
NP_440376.1_1 Reverse -216 -225 19.4693 0.000692
NP_440376.1_1 Reverse -275 -284 -1.08191 0.294
NP_440376.1_1 Reverse -357 -366 -1.18024 0.294
NP_441588.1_4 Forward -223 -213 8.63316 0.14
NP_441588.1_4 Reverse -218 -228 6.96153 0.178
NP_442687.1_7 Forward -226 -216 15.8113 0.0125
NP_442687.1_7 Reverse -215 -225 8.92815 0.0994
NP_442687.1_7 Forward -130 -120 8.4365 0.107
NP_442687.1_7 Forward -95 -85 4.3066 0.255
NP_442485.1_3 Forward -158 -139 -6.09707 0.299
NP_442958.1_3 Reverse -149 -168 -1.67217 0.285
NP_442958.1_3 Reverse -339 -358 -2.36049 0.293
NP_441013.1_2 Reverse -74 -92 1.88744 0.242
NP_442483.1_6 Reverse -179 -198 22.3197 0.0405
NP_442658.1_1 Forward -227 -217 18.7607 0.00222
NP_442658.1_1 Reverse -214 -224 6.76441 0.214
NP_440141.1_4 Forward -81 -62 -11.5053 0.298
NP_442496.1_5 Forward -142 -124 9.85225 0.217
NP_441414.1_9 Reverse -216 -235 -7.76869 0.225
NP_440720.1_5 Reverse -26 -45 7.07928 0.29
NP_441256.1_8 Forward -95 -76 10.6192 0.182
NP_442937.1_5 Forward -230 -211 11.3075 0.141
NP_442937.1_5 Reverse -211 -230 8.25926 0.229
NP_441958.1_5 Forward -226 -216 12.2714 0.00183
NP_441958.1_5 Reverse -215 -225 12.2714 0.00183
NP_441958.1_5 Reverse -164 -174 0.373358 0.154
NP_442836.1_5 Forward -231 -212 1.86774 0.271
NP_439905.1_1 Reverse -233 -246 6.21414 0.295
NP_442911.1_2 Forward -235 -216 2.45773 0.0508
NP_442911.1_2 Reverse -206 -225 -2.65548 0.1
NP_440153.1_5 Forward -224 -210 5.50613 0.191
NP_440153.1_5 Reverse -217 -231 0.687908 0.291
NP_442064.1_4 Forward -336 -317 8.06178 0.237
NP_442536.1_8 Forward -99 -80 12.6841 0.251
NP_440993.1_2 Reverse -211 -227 7.92501 0.157
NP_440993.1_4 Reverse -133 -150 13.6085 0.171
NP_440934.1_2 Forward -165 -146 4.22769 0.239
NP_440827.1_3 Forward -159 -140 11.7992 0.268
NP_440602.1_8 Forward -225 -211 15.6342 0.116
NP_442995.1_5 Reverse -211 -230 13.6675 0.183
NP_441099.1_5 Reverse -140 -159 -5.60541 0.152
NP_441099.1_5 Reverse -206 -225 -10.4236 0.253
NP_442002.1_9 Forward -226 -219 10.7572 0.185
NP_441294.1_7 Forward -229 -215 17.2177 0.0101
NP_441646.1_1 Forward -232 -213 9.63589 0.125
NP_442438.1_10 Forward -230 -216 9.63603 0.0617
NP_442438.1_10 Reverse -211 -225 -0.295402 0.256
NP_441000.1_6 Forward -226 -212 3.53951 0.111
NP_441000.1_6 Reverse -215 -229 -3.44199 0.221
NP_442771.1_1 Reverse -214 -232 -8.63398 0.2
NP_442771.1_1 Forward -96 -78 -10.2073 0.248
NP_440147.1_4 Reverse -214 -227 10.2457 0.0355
NP_440147.1_4 Reverse -163 -176 6.50913 0.0911
NP_440147.1_4 Forward -227 -214 3.36254 0.188
NP_441550.1_8 Reverse -214 -224 12.3692 0.0336
NP_441550.1_8 Forward -227 -217 10.501 0.066
NP_441916.1_7 Reverse -216 -226 18.4663 0.00144
NP_441916.1_7 Forward -225 -215 10.3048 0.0261
NP_441916.1_7 Forward -174 -164 7.05986 0.0779
NP_441916.1_10 Reverse -208 -227 0.491109 0.281
NP_441041.1_4 Forward -225 -206 -5.40875 0.152
NP_441041.1_4 Reverse -216 -235 -12.2919 0.262
NP_441041.1_4 Forward -174 -155 -12.4886 0.266
NP_441041.1_7 Forward -228 -216 19.5648 0.00277
NP_442642.1_9 Forward -232 -215 15.5751 0.114
NP_442004.1_6 Forward -174 -160 14.9459 0.0661
NP_441725.1_5 Forward -224 -214 11.2881 0.0247
NP_441725.1_5 Reverse -217 -227 9.02648 0.0553
NP_439966.1_7 Forward -227 -217 17.4824 0.00636
NP_439966.1_7 Reverse -214 -224 15.8108 0.0124
NP_439966.1_7 Forward -352 -342 10.206 0.0958
NP_439966.1_7 Forward -361 -351 5.87944 0.204
NP_439966.1_9 Forward -227 -218 10.7178 0.0863
NP_442941.1_3 Forward -224 -214 19.9412 0.00262
NP_442941.1_3 Reverse -166 -176 4.60159 0.14
NP_442941.1_3 Reverse -217 -227 2.53664 0.14
NP_440289.1_2 Forward -228 -215 19.6855 0.00426
NP_440289.1_2 Reverse -213 -226 6.60746 0.0591
NP_440289.1_2 Forward -183 -170 3.46087 0.078
NP_440260.1_8 Forward -43 -25 -2.63579 0.245
NP_440260.1_8 Forward -336 -318 -5.97904 0.282
NP_441678.1_9 Forward -129 -110 -0.197208 0.225
NP_441678.1_9 Forward -94 -75 -3.54046 0.288
NP_442281.1_1 Forward -230 -216 18.3868 0.00441
NP_442281.1_1 Reverse -211 -225 17.8952 0.00513
NP_441334.1_7 Forward -176 -157 -15.3402 0.275
NP_441079.1_7 Forward -274 -255 -7.17944 0.288
NP_442256.1_2 Forward -227 -209 -9.91228 0.299
NP_440437.1_1 Forward -231 -212 3.83436 0.115
NP_441556.1_4 Reverse -324 -343 9.61947 0.297
NP_441556.1_10 Reverse -227 -241 9.44312 0.298
NP_442982.1_5 Forward -139 -120 -1.37718 0.266
NP_442068.1_2 Reverse -110 -129 9.0459 0.3
NP_441644.1_6 Forward -225 -215 17.3841 0.00127
NP_441644.1_6 Reverse -216 -226 10.1076 0.0628
NP_441644.1_6 Forward -174 -164 5.38779 0.194
NP_440867.1_9 Reverse -155 -174 12.4875 0.249
NP_442215.1_2 Forward -227 -211 2.51681 0.114
NP_442215.1_2 Forward -329 -313 -2.00642 0.191
NP_442177.1_5 Reverse -339 -353 10.226 0.229
NP_442029.1_1 Reverse -339 -358 -19.4701 0.29
NP_442029.1_6 Forward -179 -160 7.57094 0.223
NP_442029.1_6 Forward -105 -86 5.70265 0.249
NP_442029.1_6 Reverse -129 -148 3.34271 0.282
NP_440253.1_2 Forward -225 -207 18.8987 0.00774
NP_440253.1_2 Reverse -216 -234 10.0489 0.0419
NP_440929.1_8 Forward -225 -216 19.2726 0.000701
NP_440929.1_8 Reverse -216 -225 19.2726 0.000701
NP_442933.1_2 Reverse -1 -19 6.11347 0.278
NP_442933.1_10 Forward -225 -216 17.601 0.00325
NP_442933.1_10 Reverse -216 -225 17.601 0.00325
NP_442933.1_10 Forward -174 -165 4.42462 0.246
NP_441751.2_8 Forward -224 -210 5.50613 0.0423
NP_441751.2_8 Reverse -217 -231 -3.83532 0.156
NP_442554.1_8 Reverse -217 -227 16.008 0.0065
NP_442554.1_8 Forward -224 -214 15.9097 0.00747
NP_442554.1_8 Forward -173 -163 5.48657 0.146
NP_441762.1_7 Reverse -215 -227 12.4287 0.0142
NP_441762.1_7 Forward -226 -214 2.30059 0.0676
NP_442313.1_5 Reverse -166 -185 9.53756 0.191
NP_442142.1_4 Reverse -213 -226 16.7349 0.0264
NP_442142.1_4 Forward -228 -215 13.8833 0.0324
NP_442292.1_1 Forward -224 -215 18.486 0.00229
NP_442292.1_1 Reverse -217 -226 9.63616 0.0183
NP_442381.1_8 Forward -228 -209 -5.70374 0.148
NP_441711.1_4 Reverse -207 -226 3.04771 0.255
NP_443009.1_5 Reverse -215 -226 18.3477 0.00265
NP_443009.1_5 Reverse -164 -175 5.26972 0.21
NP_441865.1_3 Forward -213 -195 17.3254 0.133
NP_441715.1_4 Forward -224 -214 14.828 0.0268
NP_441715.1_4 Reverse -217 -227 9.32148 0.097
NP_441448.1_2 Reverse -179 -198 -1.67294 0.282
NP_440183.1_9 Reverse -140 -159 -12.2919 0.256
NP_441198.1_8 Reverse -163 -173 12.49 0.129
NP_440970.1_1 Reverse -329 -343 19.4691 0.272
NP_440379.1_5 Reverse -105 -124 -8.45701 0.252
NP_441468.1_1 Forward -224 -217 15.8704 0.0124
NP_441468.1_1 Reverse -217 -224 15.8704 0.0124
NP_441468.1_1 Forward -173 -166 3.97235 0.277
NP_441020.2_6 Reverse -214 -231 16.8534 0.0241
NP_441020.2_6 Forward -227 -210 10.1669 0.151
NP_441015.1_10 Reverse -345 -364 -3.44213 0.189
NP_441673.1_1 Forward -225 -216 20.8459 0.000698
NP_441673.1_1 Reverse -216 -225 20.8459 0.000698
NP_441673.1_1 Reverse -275 -284 -8.06341 0.254
NP_441339.1_4 Forward -181 -162 -3.14714 0.227
NP_441956.1_9 Forward -181 -162 6.09597 0.274
NP_441826.1_2 Forward -231 -217 10.9143 0.0428
NP_441826.1_2 Reverse -210 -224 10.816 0.044
NP_441826.1_2 Forward -124 -110 -3.34366 0.284
NP_441826.1_5 Forward -159 -140 3.14605 0.271
NP_442868.1_6 Reverse -214 -224 9.91146 0.038
NP_442868.1_6 Forward -227 -217 8.53483 0.0555
NP_441056.1_1 Forward -225 -206 -0.688862 0.166
NP_441612.1_2 Forward -225 -215 8.54929 0.21
NP_443058.1_7 Reverse -215 -234 5.50599 0.238
NP_442361.1_3 Forward -231 -218 8.67241 0.285
NP_442427.1_3 Forward -230 -212 4.14905 0.171
NP_442427.1_8 Reverse -207 -226 5.40766 0.266
NP_442808.1_1 Forward -226 -216 18.4657 0.00201
NP_442808.1_1 Forward -360 -350 15.3192 0.0233
NP_442808.1_1 Reverse -215 -225 8.63269 0.0481
NP_442808.1_1 Forward -351 -341 2.73286 0.256
NP_442808.1_1 Reverse -77 -87 1.94622 0.281
NP_442692.1_1 Reverse -140 -159 5.40766 0.111
NP_442542.1_2 Forward -227 -214 21.0621 0.00555
NP_442542.1_2 Forward -182 -169 8.08242 0.163
NP_442542.1_9 Forward -154 -140 13.1753 0.108
NP_442050.1_5 Reverse -214 -224 16.4991 0.00812
NP_442050.1_5 Forward -227 -217 8.23937 0.234
NP_440558.1_2 Reverse -308 -327 -2.75381 0.229
NP_440558.1_2 Reverse -129 -148 -7.37537 0.293
NP_441518.1_3 Forward -235 -216 -8.16202 0.181
NP_441518.1_3 Reverse -206 -225 -13.5702 0.264
NP_441878.1_6 Forward -226 -216 10.4031 0.0176
NP_441878.1_6 Reverse -215 -225 10.4031 0.0176
NP_441036.1_8 Forward -226 -216 17.7779 0.000554
NP_441036.1_8 Reverse -215 -225 8.33817 0.174
NP_441557.1_5 Forward -225 -216 19.9609 0.000699
NP_441557.1_5 Reverse -216 -225 19.9609 0.000699
NP_441557.1_5 Reverse -165 -174 -0.885252 0.26
NP_441445.1_1 Reverse -207 -226 7.47261 0.134
NP_441445.1_1 Forward -234 -215 6.4893 0.148
NP_441445.1_1 Forward -293 -274 5.40766 0.171
NP_442066.2_4 Reverse -216 -235 -1.47551 0.193
NP_442066.2_9 Forward -229 -216 8.37742 0.185
NP_442066.2_9 Reverse -49 -62 7.49244 0.224
NP_441914.1_5 Forward -117 -98 8.55425 0.298
NP_441914.1_9 Forward -129 -115 15.8309 0.246
NP_441739.1_2 Reverse -184 -200 17.659 0.0669
NP_441308.1_8 Forward -227 -217 9.22315 0.226
NP_440101.1_3 Forward -80 -61 4.62101 0.212
NP_441458.1_10 Forward -234 -215 3.83436 0.24
NP_442183.1_1 Reverse -216 -230 20.6491 0.00378
NP_442183.1_1 Forward -225 -211 16.6175 0.0139
NP_442183.1_1 Reverse -277 -291 7.47274 0.141
NP_441574.1_1 Reverse -362 -381 -7.08038 0.283
NP_442347.1_2 Forward -224 -215 12.4878 0.056
NP_442347.1_2 Reverse -217 -226 11.1111 0.056
NP_442645.1_2 Reverse -208 -227 -4.6221 0.0598
NP_442645.1_2 Reverse -163 -182 -17.7985 0.264
NP_441037.1_4 Forward -227 -217 16.2838 0.0168
NP_442594.1_8 Forward -84 -65 11.0125 0.173
NP_442317.1_6 Forward -230 -211 5.11266 0.24
NP_441633.1_3 Reverse -214 -227 11.1307 0.0286
NP_441633.1_3 Forward -227 -214 -3.81562 0.177
NP_440136.1_2 Forward -224 -217 15.9687 0.0123
NP_440136.1_2 Reverse -217 -224 15.9687 0.0123
NP_442998.1_2 Reverse -68 -87 11.405 0.132
NP_442998.1_5 Reverse -362 -372 11.2881 0.189
NP_442998.1_10 Forward -223 -216 15.5754 0.0102
NP_442998.1_10 Reverse -218 -225 15.5754 0.0102
NP_440899.1_1 Forward -99 -80 8.01708 0.243
NP_440299.1_1 Forward -229 -216 11.4251 0.0489
NP_440299.1_1 Reverse -212 -225 4.44361 0.207
NP_441799.1_1 Reverse -212 -226 12.5853 0.0421
NP_441799.1_1 Reverse -161 -175 9.73373 0.0857
NP_441007.1_10 Forward -230 -217 3.16588 0.182
NP_441007.1_10 Reverse -211 -224 0.510939 0.226
NP_442334.1_2 Forward -235 -218 -12.8425 0.297
NP_442201.1_10 Forward -236 -217 -4.13045 0.152
NP_440256.1_1 Reverse -213 -232 12.3892 0.0121
NP_440256.1_1 Reverse -135 -154 2.0644 0.0683
NP_440256.1_1 Forward -228 -209 -10.227 0.297
NP_440087.1_1 Reverse -341 -360 -2.0655 0.197
NP_441559.1_8 Reverse -104 -118 0.392915 0.167
NP_441559.1_8 Forward -230 -216 -6.19526 0.275
NP_441559.1_8 Reverse -221 -235 -7.17857 0.287
NP_440915.1_5 Reverse -357 -376 16.4678 0.233
NP_440915.1_6 Forward -229 -215 15.9292 0.0183
NP_440915.1_6 Forward -178 -164 14.0609 0.0187
NP_442158.1_4 Forward -329 -319 11.9764 0.26
NP_442069.1_7 Reverse -230 -249 10.1267 0.291
NP_440748.1_5 Reverse -314 -333 4.32602 0.201
NP_440748.1_5 Reverse -111 -130 -3.3438 0.296
NP_442993.1_1 Forward -225 -209 -7.80794 0.146
NP_442386.1_9 Forward -226 -217 15.7322 0.0144
NP_442386.1_9 Reverse -215 -224 13.8639 0.0289
NP_442386.1_9 Forward -175 -166 10.029 0.142
NP_442386.1_9 Reverse -78 -87 9.34074 0.166
NP_441340.1_5 Forward -224 -217 15.6737 0.0124
NP_441340.1_5 Reverse -217 -224 15.6737 0.0124
NP_441254.1_1 Reverse -182 -195 11.2284 0.295
NP_440211.1_7 Forward -321 -303 14.8671 0.0905
NP_440586.1_8 Forward -224 -217 13.2151 0.026
NP_440586.1_8 Reverse -217 -224 13.2151 0.026
NP_441861.1_2 Reverse -336 -355 14.5459 0.223
NP_442251.1_6 Forward -224 -217 15.2804 0.0124
NP_442251.1_6 Reverse -217 -224 15.2804 0.0124
NP_440684.1_9 Reverse -210 -224 9.04604 0.221
NP_441262.1_3 Reverse -216 -223 14.7888 0.0223
NP_441262.1_3 Forward -225 -218 14.7888 0.0223
NP_440027.1_3 Reverse -69 -87 4.93494 0.249
NP_443051.1_1 Reverse -215 -224 10.4228 0.00754
NP_443051.1_1 Forward -226 -217 10.4228 0.00754
NP_443051.1_1 Reverse -164 -173 -0.000272808 0.245
NP_440451.1_10 Forward -134 -115 8.25844 0.267
NP_439996.1_1 Forward -159 -140 8.65258 0.263
NP_441232.1_10 Reverse -154 -173 8.55425 0.142
NP_439937.1_8 Reverse -214 -233 -2.75381 0.261
NP_439937.1_8 Reverse -339 -358 -4.13045 0.278
NP_439937.1_9 Reverse -215 -232 -8.41828 0.176
NP_439937.1_9 Forward -65 -48 -10.0899 0.221
NP_440439.1_1 Forward -228 -215 2.47756 0.133
NP_440439.1_1 Forward -82 -69 0.707601 0.179
NP_440439.1_1 Reverse -347 -360 0.510939 0.188
NP_440439.1_1 Reverse -213 -226 0.117615 0.202
NP_440372.1_2 Forward -224 -217 16.3621 0.0124
NP_440372.1_2 Reverse -217 -224 16.3621 0.0124
NP_441138.1_5 Reverse -47 -60 3.02202 0.297
NP_440316.1_10 Forward -181 -171 5.87989 0.277
NP_441803.1_2 Reverse -211 -230 6.39097 0.154
NP_439977.1_5 Forward -231 -212 4.32602 0.153
NP_440139.1_1 Reverse -210 -229 0.293673 0.293
NP_440267.1_2 Reverse -211 -225 9.43874 0.156
NP_440267.1_2 Reverse -79 -93 7.27547 0.202
NP_440267.1_2 Reverse -312 -326 6.0955 0.243
NP_442384.1_10 Forward -174 -161 12.8023 0.0249
NP_442384.1_10 Reverse -109 -122 4.24752 0.163
NP_442384.1_10 Reverse -216 -229 2.2809 0.23
NP_442384.1_10 Forward -54 -41 1.59258 0.253
NP_442384.1_10 Forward -225 -212 1.10092 0.268
NP_442114.1_4 Reverse -216 -227 12.1534 0.107
NP_441018.1_7 Reverse -346 -365 8.16093 0.255
NP_441018.1_7 Forward -211 -192 8.06259 0.256
NP_442790.1_4 Forward -234 -215 -0.590531 0.0952
NP_442262.1_10 Forward -224 -217 14.1988 0.0123
NP_442262.1_10 Reverse -217 -224 14.1988 0.0123
NP_441689.1_5 Reverse -214 -224 15.3192 0.0403
NP_440163.1_10 Reverse -213 -223 11.3864 0.169
NP_440163.1_10 Forward -231 -221 9.81313 0.222
NP_440344.1_10 Forward -232 -215 27.0799 0.000536
NP_440344.1_10 Reverse -209 -226 -9.10594 0.139
NP_441060.1_4 Reverse -199 -217 2.87075 0.252
NP_441335.1_8 Forward -195 -176 9.53756 0.228
NP_440562.1_5 Forward -248 -229 8.25926 0.261
NP_441965.1_10 Forward -177 -161 4.68009 0.234
NP_440297.1_9 Forward -224 -214 9.32148 0.0917
NP_440297.1_9 Reverse -217 -227 -0.216628 0.282
NP_440894.1_7 Forward -126 -107 8.35677 0.277
NP_440894.1_10 Forward -35 -16 3.44104 0.272
NP_440999.1_9 Forward -229 -215 23.6974 0.0055
NP_440999.1_9 Forward -360 -346 -2.36035 0.268
NP_440888.1_2 Reverse -216 -230 18.2885 0.00261
NP_440888.1_2 Forward -225 -211 15.4369 0.0107
NP_440888.1_2 Reverse -165 -179 11.1104 0.0757
NP_440600.1_4 Forward -233 -215 -7.35568 0.291
NP_440491.1_1 Reverse -213 -232 12.4721 0.151
NP_441543.1_2 Reverse -217 -226 18.486 0.00236
NP_441543.1_2 Forward -224 -215 16.9127 0.00359
NP_441543.1_2 Reverse -172 -181 4.42462 0.246
NP_442845.1_2 Forward -180 -166 8.06273 0.195
NP_442845.1_2 Forward -94 -80 6.78443 0.202
NP_442845.1_2 Reverse -159 -173 5.89945 0.22
NP_442845.1_2 Reverse -344 -358 4.91614 0.249
NP_442845.1_2 Reverse -210 -224 3.34284 0.294
NP_441469.1_8 Forward -226 -217 16.126 0.00797
NP_441469.1_8 Reverse -215 -224 6.48957 0.227
NP_443064.1_6 Forward -225 -215 12.5669 0.0796
NP_442578.1_7 Forward -224 -217 14.5921 0.026
NP_442578.1_7 Reverse -217 -224 14.5921 0.026
NP_441462.1_2 Forward -225 -215 11.5831 0.00406
NP_441462.1_2 Reverse -216 -226 11.5831 0.00406
NP_441621.1_7 Forward -227 -213 -3.34366 0.188
NP_441621.1_7 Reverse -214 -228 -3.34366 0.188
NP_441621.1_7 Forward -66 -52 -5.80194 0.263
NP_443062.1_1 Reverse -216 -234 17.3216 0.0254
NP_443062.1_1 Forward -350 -332 9.6185 0.131
NP_443062.1_1 Forward -225 -207 6.20575 0.206
NP_443062.1_6 Reverse -208 -227 12.5858 0.0975
NP_441601.1_4 Forward -173 -154 3.04771 0.206
NP_440519.1_8 Reverse -345 -361 4.28677 0.228
NP_442204.1_5 Forward -235 -216 12.1925 0.0682
NP_442204.1_5 Forward -369 -350 0.0977854 0.272
NP_441560.1_3 Forward -168 -150 14.4738 0.159
NP_442872.1_1 Reverse -58 -77 -13.2752 0.26
NP_440516.1_8 Forward -225 -216 16.9127 0.00442
NP_440516.1_8 Reverse -216 -225 16.9127 0.00442
NP_440516.1_8 Reverse -350 -359 -0.590259 0.283
NP_441785.1_1 Reverse -216 -230 16.0349 0.113
NP_441785.1_1 Forward -225 -211 14.9684 0.148
NP_441033.1_2 Forward -235 -216 -6.78538 0.293
NP_442428.1_5 Forward -224 -217 15.8704 0.0124
NP_442428.1_5 Reverse -217 -224 15.8704 0.0124
NP_442428.1_5 Forward -173 -166 10.6589 0.0727
NP_442779.1_10 Forward -334 -316 19.4878 0.141
NP_440673.1_2 Forward -235 -216 9.02386 0.259
NP_440673.1_3 Forward -223 -216 12.4288 0.0426
NP_440673.1_3 Reverse -218 -225 12.4288 0.0426
NP_440673.1_7 Forward -236 -217 4.03102 0.189
NP_441714.1_3 Forward -232 -214 15.653 0.138
NP_440865.1_9 Reverse -210 -229 -8.45701 0.264
NP_441052.1_2 Forward -225 -215 19.9412 0.00106
NP_441052.1_2 Reverse -216 -226 10.5014 0.0285
NP_442219.1_9 Forward -224 -215 17.7976 0.00718
NP_442219.1_9 Reverse -217 -226 8.35786 0.0681
NP_440592.1_5 Forward -165 -146 19.7631 0.0931
NP_440436.1_4 Reverse -217 -226 18.1905 0.00233
NP_440436.1_4 Forward -224 -215 17.2072 0.00233
NP_441884.1_9 Reverse -213 -232 -14.0619 0.138
NP_441884.1_9 Forward -228 -209 -14.6519 0.138
NP_440314.1_9 Forward -61 -42 -8.45701 0.248
NP_440314.1_9 Forward -358 -339 -9.047 0.258
NP_441719.1_4 Forward -224 -217 16.3621 0.0124
NP_441719.1_4 Reverse -217 -224 16.3621 0.0124
NP_441733.1_10 Forward -228 -215 10.639 0.106
NP_441733.1_10 Reverse -213 -226 9.95071 0.106
NP_441733.1_10 Reverse -338 -351 4.14919 0.273
NP_441004.1_1 Forward -99 -80 -15.6352 0.276
NP_441004.1_1 Reverse -368 -387 -16.4218 0.284
NP_441004.1_1 Reverse -148 -167 -16.9135 0.287
NP_441004.1_1 Reverse -26 -45 -17.7985 0.294
NP_441004.1_2 Reverse -155 -174 -4.42544 0.291
NP_442813.1_4 Forward -209 -190 -2.75381 0.284
NP_442366.1_3 Forward -226 -208 2.96908 0.118
NP_442366.1_3 Reverse -215 -233 0.314141 0.173
NP_442366.1_5 Reverse -162 -172 12.0743 0.147
NP_440129.1_10 Forward -232 -218 13.8643 0.0534
NP_442206.1_10 Reverse -216 -231 2.33984 0.202
NP_440328.1_4 Reverse -223 -242 -1.27885 0.299
NP_442312.1_1 Forward -332 -313 10.1275 0.282
NP_443054.1_2 Reverse -214 -228 21.7307 0.00482
NP_443054.1_2 Reverse -169 -183 0.687908 0.256
NP_441851.1_9 Forward -330 -311 7.7676 0.279
NP_441851.1_10 Forward -226 -216 16.008 0.00552
NP_441851.1_10 Reverse -215 -225 15.8113 0.00552
NP_442208.1_5 Forward -257 -238 -6.39206 0.266
NP_442011.1_1 Reverse -215 -234 -1.18052 0.268
NP_442515.1_1 Forward -226 -212 0.687908 0.183
NP_442515.1_1 Reverse -215 -229 -2.36035 0.273
NP_440593.1_3 Reverse -121 -140 -6.1954 0.271
NP_441982.1_6 Reverse -190 -199 11.1485 0.288
NP_440463.1_8 Forward -176 -157 7.79033 0.264
NP_440165.1_5 Reverse -215 -234 12.0942 0.0454
NP_440940.1_7 Forward -235 -217 10.7364 0.128
NP_441349.1_10 Forward -235 -216 -5.31042 0.198
NP_441349.1_10 Reverse -265 -284 -9.34199 0.289
NP_441349.1_10 Reverse -206 -225 -9.44032 0.292
NP_440432.1_9 Forward -224 -209 6.07642 0.0481
NP_440432.1_9 Reverse -217 -232 0.569883 0.159
NP_440432.1_9 Forward -349 -334 -5.32998 0.245
NP_442843.1_1 Reverse -342 -361 -3.14714 0.222
NP_442843.1_1 Forward -250 -231 -9.73531 0.269
NP_440474.1_8 Reverse -217 -231 9.43874 0.16
NP_441477.1_10 Forward -125 -107 0.904127 0.268
NP_440431.1_3 Reverse -197 -216 -6.1954 0.188
NP_442450.1_5 Reverse -214 -224 9.32148 0.115
NP_442168.1_5 Forward -173 -154 15.0441 0.114
NP_440023.1_7 Forward -117 -98 6.58763 0.269
NP_442006.1_2 Forward -156 -139 4.07041 0.0741
NP_442006.1_2 Reverse -332 -349 -16.0874 0.238
NP_442006.1_2 Reverse -317 -334 -17.4641 0.276
NP_441570.1_1 Forward -225 -207 0.21581 0.0403
NP_441570.1_1 Reverse -216 -234 -0.964162 0.0525
NP_441570.1_1 Forward -94 -76 -2.93078 0.0686
NP_441078.1_4 Forward -225 -216 19.6659 0.0007
NP_441078.1_4 Reverse -216 -225 19.6659 0.0007
NP_441078.1_4 Forward -174 -165 5.11294 0.118
NP_441078.1_4 Forward -284 -275 -1.08191 0.222
NP_441078.1_4 Reverse -275 -284 -2.06522 0.295
NP_442729.1_8 Forward -229 -216 8.47575 0.125
NP_441663.1_7 Reverse -213 -232 7.37428 0.209
NP_440526.1_3 Reverse -217 -228 11.7595 0.0646
NP_440526.1_3 Forward -224 -213 10.1862 0.0646
NP_441432.1_8 Reverse -215 -224 16.8143 0.00595
NP_441432.1_8 Forward -226 -217 8.25953 0.0755
NP_441432.1_8 Reverse -349 -358 3.04799 0.268
NP_441432.1_8 Forward -242 -233 2.55633 0.298
NP_443024.1_3 Forward -244 -234 16.4996 0.255
NP_442320.1_8 Forward -231 -217 14.4542 0.0132
NP_442320.1_8 Reverse -210 -224 11.701 0.0178
NP_442320.1_8 Forward -186 -172 -3.147 0.11
NP_441732.1_2 Forward -229 -213 -15.3794 0.145
NP_441732.1_2 Reverse -212 -228 -16.2644 0.165
NP_442343.1_1 Reverse -136 -155 16.6174 0.271
NP_442003.1_9 Forward -107 -88 4.32602 0.263
NP_440760.1_1 Reverse -165 -184 -6.88371 0.0653
NP_442797.1_1 Forward -161 -142 -1.57384 0.236
NP_440131.1_4 Forward -181 -162 7.47261 0.243
NP_440199.1_10 Reverse -213 -223 16.7946 0.0381
NP_441057.1_4 Reverse -144 -162 0.510803 0.253
NP_442353.1_4 Forward -389 -370 9.83173 0.128
NP_442400.1_10 Reverse -186 -199 7.9876 0.281
NP_440713.1_4 Reverse -75 -94 6.39097 0.19
NP_442489.1_7 Forward -225 -216 20.1576 0.000695
NP_442489.1_7 Reverse -216 -225 20.1576 0.000695
NP_442489.1_7 Forward -174 -165 -1.6719 0.235
NP_441830.1_2 Forward -87 -68 -6.09707 0.296
NP_440559.1_1 Forward -224 -215 17.4043 0.00658
NP_440559.1_1 Reverse -217 -226 8.75118 0.0586
NP_441659.2_8 Forward -225 -215 18.1713 0.00133
NP_441659.2_8 Reverse -216 -226 11.9764 0.0147
NP_440426.1_7 Forward -355 -336 0.392778 0.262
NP_440860.1_8 Forward -227 -208 15.1424 0.263
NP_442913.1_10 Forward -234 -215 -0.688862 0.162
NP_442913.1_10 Forward -152 -133 -5.80207 0.279
NP_439912.1_10 Reverse -36 -55 19.4681 0.141
NP_441040.1_2 Reverse -137 -156 -15.3402 0.286
NP_441800.1_7 Reverse -61 -79 0.510803 0.212
NP_441800.1_7 Reverse -82 -100 -4.11075 0.284
NP_440779.1_5 Reverse -216 -233 -5.76269 0.152
NP_442346.1_5 Reverse -215 -225 16.6963 0.00248
NP_442346.1_5 Forward -226 -216 9.02648 0.118
NP_442346.1_5 Reverse -164 -174 4.99491 0.267
NP_440545.1_3 Forward -173 -156 -1.92778 0.177
NP_440545.1_3 Reverse -212 -229 -3.30441 0.203
NP_440025.1_1 Reverse -212 -231 15.9291 0.147
NP_441629.1_1 Forward -292 -273 9.24257 0.21
NP_440459.1_2 Forward -156 -139 8.59364 0.254
NP_441653.1_2 Reverse -205 -224 4.78586 0.253
NP_441653.1_2 Forward -236 -217 2.75655 0.288
NP_440010.1_10 Reverse -142 -161 6.68596 0.226
NP_441585.1_6 Forward -350 -331 14.9449 0.232
NP_441888.1_7 Forward -230 -216 12.0943 0.0743
NP_440449.1_6 Forward -367 -349 8.93668 0.191
NP_441948.1_4 Reverse -209 -227 -1.55415 0.146
NP_441948.1_9 Reverse -335 -353 12.4089 0.294
NP_440170.1_5 Forward -235 -216 7.96426 0.142
NP_441502.1_3 Reverse -214 -233 10.0292 0.21
NP_441833.1_4 Forward -224 -217 15.9687 0.0124
NP_441833.1_4 Reverse -217 -224 15.9687 0.0124
NP_442162.1_9 Forward -224 -217 16.2637 0.0124
NP_442162.1_9 Reverse -217 -224 16.2637 0.0124
NP_440671.1_4 Reverse -210 -224 14.7492 0.0565
NP_440671.1_4 Reverse -139 -153 12.586 0.105
NP_440671.1_4 Reverse -32 -46 5.21113 0.289
NP_442073.1_6 Reverse -150 -169 -3.54046 0.291
NP_442199.1_5 Reverse -112 -131 -0.39387 0.177
NP_442140.1_3 Reverse -217 -227 17.4829 0.0159
NP_442140.1_3 Forward -224 -214 4.40493 0.243
NP_440875.1_9 Reverse -218 -228 17.619 0.0104
NP_440875.1_9 Forward -324 -314 7.00932 0.287
NP_442547.1_7 Forward -163 -144 12.461 0.225
NP_441813.1_5 Reverse -214 -224 15.9097 0.01
NP_441813.1_5 Forward -227 -217 10.0098 0.0208
NP_442089.1_1 Reverse -213 -232 -0.688862 0.261
NP_440590.1_4 Reverse -217 -230 14.6706 0.0106
NP_440590.1_4 Reverse -166 -179 -1.45568 0.22
NP_440590.1_4 Forward -224 -211 -4.50394 0.262
NP_440590.1_4 Forward -63 -50 -5.29059 0.277
NP_440567.1_1 Reverse -217 -231 15.5359 0.017
NP_442497.1_10 Forward -224 -215 10.4228 0.0087
NP_442497.1_10 Reverse -217 -226 10.4228 0.0087
NP_440821.1_4 Forward -227 -217 18.7612 0.00422
NP_440821.1_4 Reverse -214 -224 18.2696 0.00448
NP_441239.1_9 Forward -227 -215 16.0669 0.0175
NP_441239.1_9 Reverse -214 -226 6.92215 0.173
NP_441239.1_9 Reverse -163 -175 3.77555 0.276
NP_441951.1_4 Reverse -147 -166 2.16274 0.283
NP_441727.1_3 Forward -232 -213 4.12936 0.272
NP_440400.1_1 Reverse -60 -79 -0.787962 0.285
NP_441892.1_1 Forward -234 -217 9.97027 0.069
NP_441892.1_1 Reverse -156 -173 -5.66436 0.285
NP_440604.1_6 Reverse -216 -235 -3.63879 0.23
NP_442325.1_6 Forward -363 -344 5.40766 0.254
NP_441017.1_6 Reverse -212 -226 11.7987 0.242
NP_440833.1_6 Reverse -182 -196 7.07881 0.289
NP_442216.1_4 Reverse -186 -194 8.1805 0.255
NP_440949.1_7 Forward -233 -214 15.2399 0.162
NP_442138.1_1 Reverse -217 -236 4.42355 0.24
NP_442138.1_10 Reverse -216 -235 0.491109 0.14
NP_442138.1_10 Forward -225 -206 -7.96535 0.296
NP_440546.1_4 Reverse -216 -226 11.8882 0.0679
NP_440546.1_4 Forward -225 -215 10.046 0.109
NP_440546.1_4 Reverse -350 -360 7.52511 0.235
NP_440546.1_4 Reverse -165 -175 6.74945 0.282
NP_440462.1_6 Forward -227 -217 17.9746 0.00578
NP_440462.1_6 Reverse -214 -224 7.74818 0.0699
NP_441184.1_5 Reverse -154 -173 8.25926 0.24
NP_440868.1_4 Reverse -212 -224 5.93884 0.0879
NP_440868.1_4 Forward -229 -217 2.98891 0.142
NP_441204.1_1 Forward -234 -215 7.07928 0.255
NP_441848.1_7 Forward -375 -356 1.17865 0.228
NP_441084.1_6 Reverse -315 -329 10.6046 0.234
NP_442039.1_4 Forward -224 -217 15.1821 0.0124
NP_442039.1_4 Reverse -217 -224 15.1821 0.0124
NP_442039.1_7 Reverse -101 -111 10.6981 0.257
NP_441811.1_8 Forward -180 -166 5.80112 0.289
NP_441926.1_3 Forward -225 -209 6.84337 0.17
NP_442837.1_3 Forward -224 -217 15.7721 0.0124
NP_442837.1_3 Reverse -217 -224 15.7721 0.0124
NP_442053.1_1 Forward -225 -216 18.3876 0.0007
NP_442053.1_1 Reverse -216 -225 18.3876 0.0007
NP_440505.1_3 Reverse -214 -224 16.303 0.00696
NP_440505.1_3 Forward -227 -217 14.1397 0.0235
NP_441701.1_3 Forward -82 -65 9.18362 0.245
NP_441252.1_6 Forward -196 -189 11.6422 0.288
NP_442532.1_7 Reverse -216 -230 6.88276 0.171
NP_441408.2_7 Reverse -163 -182 -0.590531 0.234
NP_441408.2_7 Reverse -315 -334 -3.44213 0.272
NP_440914.1_1 Forward -225 -215 17.5935 0.000537
NP_440914.1_1 Forward -174 -164 13.2995 0.0325
NP_440914.1_1 Reverse -109 -119 11.0549 0.11
NP_440914.1_1 Reverse -216 -226 8.6151 0.186
NP_440914.1_1 Reverse -318 -328 8.41992 0.191
NP_441011.1_8 Reverse -217 -226 16.9127 0.00602
NP_441011.1_8 Forward -173 -164 9.53783 0.123
NP_441011.1_8 Forward -224 -215 8.25953 0.144
NP_441011.1_8 Reverse -88 -97 5.60459 0.247
NP_442533.1_1 Reverse -347 -366 -8.35868 0.204
NP_442533.1_1 Forward -97 -78 -15.7335 0.257
NP_442533.1_1 Reverse -339 -358 -16.7168 0.275
NP_442533.1_1 Reverse -368 -387 -17.6018 0.291
NP_442533.1_6 Forward -225 -216 17.2076 0.00137
NP_442533.1_6 Reverse -216 -225 17.2076 0.00137
NP_442533.1_6 Forward -174 -165 5.80125 0.128
NP_442533.1_6 Reverse -165 -174 5.70292 0.132
NP_442533.1_6 Reverse -120 -129 1.37636 0.3
NP_442541.1_10 Forward -396 -382 5.01387 0.248
NP_442322.1_4 Reverse -63 -80 -8.51661 0.286
NP_441219.1_6 Reverse -331 -349 16.2438 0.102
NP_441482.1_7 Reverse -210 -224 -1.37704 0.0683
NP_441482.1_7 Forward -231 -217 -10.2268 0.209
NP_439944.1_9 Forward -224 -214 19.0562 0.00329
NP_439944.1_9 Reverse -217 -227 10.4031 0.0887
NP_440816.1_8 Forward -133 -119 17.3052 0.28
NP_442202.1_1 Forward -55 -39 17.6677 0.137
NP_441527.1_4 Reverse -197 -216 -11.9847 0.285
NP_440007.1_9 Reverse -314 -328 1.08123 0.29
NP_441680.1_4 Reverse -65 -84 0.392778 0.246
NP_440608.1_6 Reverse -319 -338 4.62021 0.258
NP_441602.1_3 Forward -179 -160 -5.11376 0.278
NP_441972.1_5 Forward -236 -217 -5.80207 0.225
NP_441972.1_5 Reverse -217 -236 -6.58872 0.233
NP_441106.1_1 Forward -226 -217 18.191 0.0028
NP_441106.1_1 Reverse -215 -224 9.63616 0.0311
NP_440646.1_1 Reverse -16 -35 4.12936 0.152
NP_442588.1_6 Forward -86 -67 -2.75381 0.296
NP_441286.1_1 Reverse -215 -227 14.7886 0.00418
NP_441286.1_1 Forward -226 -214 11.8387 0.0114
NP_442674.1_3 Forward -233 -214 10.3234 0.174
NP_440092.1_4 Forward -97 -78 15.2408 0.173
NP_440670.1_8 Forward -225 -216 18.3876 0.000699
NP_440670.1_8 Reverse -216 -225 18.3876 0.000699
NP_442908.1_1 Forward -212 -193 21.7306 0.00824
NP_442908.1_3 Forward -257 -238 26.1555 0.00589
NP_442908.1_4 Forward -125 -106 25.3688 0.00968
NP_442908.1_6 Forward -92 -73 20.7473 0.14
NP_442908.1_8 Forward -28 -9 13.1758 0.266
NP_440886.1_7 Forward -226 -216 17.7774 0.0011
NP_440886.1_7 Reverse -215 -225 7.94438 0.0805
NP_440886.1_7 Forward -285 -275 4.60114 0.227
NP_440886.1_7 Forward -360 -350 4.10949 0.253
NP_442382.1_7 Reverse -203 -222 4.916 0.252
NP_442072.1_9 Forward -226 -208 -12.8622 0.0926
NP_442072.1_9 Reverse -215 -233 -13.3539 0.11
NP_440907.2_8 Reverse -217 -227 17.4824 0.00685
NP_440907.2_8 Forward -358 -348 6.66608 0.157
NP_440907.2_8 Forward -173 -163 5.19112 0.215
NP_441021.1_1 Forward -224 -205 3.34271 0.083
NP_441021.1_1 Reverse -166 -185 -9.63698 0.218
NP_441021.1_8 Reverse -211 -229 5.82068 0.215
NP_441021.1_8 Forward -230 -212 3.46073 0.226
NP_441463.1_2 Forward -212 -194 4.40727 0.187
NP_441463.1_3 Forward -235 -216 7.17762 0.0545
NP_441463.1_3 Reverse -206 -225 0.0977854 0.132
NP_441463.1_6 Reverse -214 -228 8.92841 0.25
NP_442842.1_10 Forward -344 -325 1.33913 0.254
NP_441626.1_2 Forward -224 -217 15.7721 0.0124
NP_441626.1_2 Reverse -217 -224 15.7721 0.0124
NP_441901.1_1 Reverse -117 -136 10.5209 0.11
NP_442365.1_5 Reverse -217 -236 22.5172 0.0159
NP_442238.1_3 Forward -153 -134 13.9625 0.084
NP_442794.1_1 Reverse -314 -326 2.89058 0.286
NP_442615.1_1 Forward -234 -216 -0.275845 0.114
NP_442615.1_1 Reverse -266 -284 -7.35568 0.287
NP_441962.1_4 Reverse -211 -230 -0.0988766 0.117
NP_441962.1_4 Forward -230 -211 -9.93197 0.222
NP_440387.1_1 Reverse -216 -232 8.41667 0.0282
NP_440387.1_1 Forward -225 -209 4.58176 0.0407
NP_440387.1_1 Forward -359 -343 -5.84132 0.254
NP_440855.1_5 Forward -170 -151 13.9616 0.141
NP_441431.1_2 Forward -228 -214 8.75042 0.207
NP_441431.1_2 Reverse -243 -257 6.78381 0.261
NP_441836.1_1 Forward -236 -217 13.9343 0.209
NP_441836.1_2 Reverse -159 -178 5.211 0.127
NP_441993.1_1 Forward -99 -80 2.33652 0.26
NP_440114.1_10 Forward -225 -211 10.1277 0.153
NP_440114.1_10 Reverse -216 -230 6.58777 0.263
NP_440114.1_10 Forward -174 -160 6.19444 0.282
NP_442090.1_10 Forward -87 -74 10.639 0.281
NP_441510.2_7 Reverse -210 -224 11.7987 0.28
NP_440287.1_5 Forward -392 -373 6.68515 0.292
NP_440293.1_1 Forward -249 -230 16.2241 0.162
NP_440766.1_4 Forward -229 -215 8.45605 0.0871
NP_440766.1_4 Reverse -212 -226 8.06273 0.0871
NP_439988.1_7 Forward -160 -146 18.2885 0.292
NP_439988.1_7 Forward -172 -158 12.192 0.292
NP_440422.1_10 Forward -216 -197 13.9864 0.147
NP_442743.1_5 Forward -93 -74 3.14605 0.277
NP_439910.1_2 Reverse -208 -225 5.34871 0.0283
NP_442867.1_8 Reverse -139 -158 6.68596 0.257
NP_440457.1_1 Forward -229 -217 5.34885 0.141
NP_440457.1_1 Reverse -212 -224 0.0389777 0.25
NP_440942.1_9 Reverse -199 -218 11.7 0.146
NP_440054.1_7 Forward -141 -122 11.4058 0.297
NP_441332.1_6 Forward -351 -341 11.0659 0.277
NP_441436.1_2 Reverse -326 -345 -5.01543 0.294
NP_441436.1_6 Reverse -216 -235 14.1591 0.156
NP_440473.1_9 Forward -236 -217 10.7175 0.0422
NP_442509.1_9 Reverse -216 -226 16.2041 0.00739
NP_442509.1_9 Forward -225 -215 8.14104 0.192
NP_442514.1_5 Forward -47 -28 -7.47443 0.276
NP_441440.1_10 Reverse -226 -245 20.1573 0.228
NP_440554.1_4 Reverse -217 -227 13.943 0.0218
NP_440554.1_4 Forward -224 -214 7.05986 0.106
NP_442737.1_5 Forward -220 -201 16.2725 0.159
NP_442737.1_9 Forward -224 -205 17.2173 0.199
NP_441885.1_5 Forward -225 -215 20.9245 0.000538
NP_441885.1_5 Reverse -216 -226 11.4848 0.00668
NP_441885.1_5 Reverse -165 -175 0.668351 0.133
NP_441885.1_5 Forward -284 -274 0.57002 0.137
NP_442703.1_9 Reverse -196 -214 10.4422 0.244
NP_442341.1_7 Reverse -215 -229 22.0257 0.00401
NP_442341.1_7 Forward -226 -212 8.35772 0.0881
NP_442341.1_9 Forward -227 -213 8.45543 0.17
NP_441756.1_5 Forward -165 -146 -5.21209 0.299
NP_441173.1_9 Reverse -238 -246 11.0321 0.228
NP_443000.1_7 Reverse -214 -224 17.0896 0.00865
NP_443000.1_7 Forward -227 -217 2.04498 0.226
NP_443000.1_8 Reverse -81 -100 14.4541 0.296
NP_440076.1_5 Reverse -78 -97 13.5683 0.252
NP_440507.2_3 Forward -234 -215 10.1267 0.208
NP_441561.1_7 Forward -362 -343 7.37347 0.274
NP_441842.1_10 Forward -232 -218 19.7641 0.0142
NP_440275.1_3 Forward -227 -217 17.9746 0.0082
NP_440275.1_3 Reverse -214 -224 8.1415 0.0602
NP_440091.1_1 Reverse -212 -224 16.4603 0.0153
NP_440091.1_1 Forward -229 -217 12.6253 0.0353
NP_440679.1_10 Reverse -141 -160 -20.65 0.286
NP_443010.1_10 Forward -228 -211 16.6861 0.0508
NP_442451.1_2 Reverse -176 -195 -11.6036 0.297
NP_440149.1_8 Forward -225 -206 -1.47551 0.16
NP_440149.1_8 Reverse -210 -229 -2.36049 0.168
NP_441105.1_3 Forward -236 -217 -3.73712 0.185
NP_440216.1_1 Reverse -216 -230 -1.5737 0.034
NP_440216.1_1 Forward -225 -211 -1.8687 0.0412
NP_440216.1_6 Forward -232 -216 4.68009 0.189
NP_440172.1_1 Forward -225 -215 15.0247 0.00945
NP_440172.1_1 Reverse -216 -226 8.73149 0.0586
NP_440172.1_6 Forward -237 -218 5.30933 0.282
NP_442015.1_10 Forward -229 -216 3.95252 0.178
NP_442015.1_10 Reverse -212 -225 0.60927 0.221
NP_441226.1_7 Forward -224 -217 14.4934 0.0123
NP_441226.1_7 Reverse -217 -224 14.4934 0.0123
NP_440198.1_3 Forward -172 -153 15.3382 0.253
NP_441111.1_7 Forward -224 -216 18.7023 0.00294
NP_441111.1_7 Reverse -217 -225 18.7023 0.00294
NP_442379.1_10 Reverse -209 -226 -3.30441 0.256
NP_441766.1_2 Forward -225 -216 17.5026 0.00297
NP_441766.1_2 Reverse -216 -225 17.5026 0.00297
NP_440416.1_9 Forward -334 -315 -20.8467 0.289
NP_440416.1_9 Forward -232 -213 -20.945 0.289
NP_443052.1_8 Forward -235 -216 8.35759 0.0255
NP_443052.1_8 Reverse -206 -225 -10.9153 0.218
NP_443052.1_9 Forward -164 -145 -3.54046 0.25
NP_440072.1_5 Forward -88 -70 -3.71743 0.281
NP_441135.1_4 Reverse -219 -238 9.0459 0.246
NP_441940.1_4 Reverse -131 -150 7.17762 0.286
NP_442154.1_1 Reverse -342 -360 -8.53565 0.168
NP_440261.1_5 Reverse -217 -230 -10.5021 0.201
NP_440988.1_10 Reverse -316 -330 6.06058 0.234
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCTGCCCATGTTCACCCTCAATGACCAAAATCTGCCCTACCCCGATACCCTCCATCCCATCATTGTCCACTTTGTCATTGGCATGGTTTTCTTTGCCTACATTAGTGAACTGGTGGGCTACCTCCAAAAAAAGCCTCGGTTCTTTGAAGTCGCTTGGTGGAATTGGCTCACAGCGGCGATCGCCATTTTTTTTGCAGTGATTTTTGGGGAATTTGAAGCGGCTCTAGCGATGCCCTACCCGGCGGCCCAACCGGCATTGGATTGGCACACGGTCAACGGCTGGTCATTGTCTGCCATTTTGGCAGGGTTAACGGCTTGGCGGGGAGTGTTGAGGGTGCGAAATCCGCTGAAAACCAGCCTGCCTTTCCTCATGCTAGCCACTGTATTTATGGTGTTAGT

CDS

ATGCATCCAAATCTTCCTTGGCTCCCTAGTGGATTGGGTTTATGGTCTGCACACCCTACCCGTAGTCCAAGCAACCAAAGACGGCATTATTCCCTAGTCTTAACAAGTTTTCAAAATAGAAGTTTTACCCCCCATCTCATTTTCACTGAGGAAATTGACCGCACCATGAACCCTTCCCTGATTGACCAACTCAAAGAAATTGGCCTCCAGCTAGGCACCAATGGTCTGCCCTACCGATTTCCCATCCATCCCAATTTGGTTCATTTCAGTCTGGGGTTATTCATCATTGCCCTAATTTTTGATTTTGCGGGCGTATTTTTCCCCTTGGAGCGGCCAATTCTCAAAGGGTTTGCCATTCCCGCCCAGCGCCAAAACTTCTTTGATGTGGGTTGGTACAATGCCGTGGCCGGTGCCTTCATTAGTTTTTTCACGGTGGCGGCGGGCTTTTTTGAAATTCTTTTGGCCCAACCTCCCACAAATCAAGTCAGTGATTGGGGCATTGGCGCTGGTACTACCATGTTGCTCCATGGCGTGGGGGGCATCCTGCTACTGGCGATGATGGTGGGCACAACTATTTGGCGGGGCTATCAACGGTTTGTTTGGCGCACCAATTGCCGCAATGAAGTTAGCTGGGCCTATCTCGGTTTTGCCCTATTTCTCATGGCCTATATGGCCATCCATGGCACCCTGGGGGCCCAACTGGGGGCAGAATTTGGCGTACACAATACGGCGGCCCATATCCTCCGCATGGGGGAAAATCCCAATGTGGTGCTCAGTGAGGGAGGTATGGATCTTTGA

Protein

MHPNLPWLPSGLGLWSAHPTRSPSNQRRHYSLVLTSFQNRSFTPHLIFTEEIDRTMNPSLIDQLKEIGLQLGTNGLPYRFPIHPNLVHFSLGLFIIALIFDFAGVFFPLERPILKGFAIPAQRQNFFDVGWYNAVAGAFISFFTVAAGFFEILLAQPPTNQVSDWGIGAGTTMLLHGVGGILLLAMMVGTTIWRGYQRFVWRTNCRNEVSWAYLGFALFLMAYMAIHGTLGAQLGAEFGVHNTAAHILRMGENPNVVLSEGGMDL