Your browser is old and dusty. Try Google Chrome!

Details for sll1485

ORF sll1485
Accession NP_442909.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -282 -296 14.3559 0.141
NP_441061.1_2 Forward -261 -247 10.0294 0.0651
NP_441061.1_2 Reverse -254 -268 7.9644 0.0955
NP_441061.1_2 Forward -339 -325 -2.45868 0.293
NP_440557.1_1 Forward -128 -109 -1.27885 0.271
NP_440557.1_1 Reverse -186 -205 -2.45882 0.289
NP_440795.1_7 Forward -261 -254 14.6904 0.0123
NP_440795.1_7 Reverse -254 -261 14.6904 0.0123
NP_441418.1_6 Reverse -253 -272 -11.9969 0.0586
NP_441418.1_6 Forward -262 -243 -20.7484 0.125
NP_441418.1_6 Reverse -339 -358 -30.2865 0.267
NP_442291.1_5 Forward -263 -247 6.15506 0.0727
NP_442291.1_7 Forward -301 -287 11.996 0.216
NP_442272.1_2 Reverse -104 -123 10.9334 0.237
NP_441453.1_4 Reverse -253 -261 16.539 0.00633
NP_441453.1_4 Forward -262 -254 16.539 0.00633
NP_442151.1_6 Forward -304 -290 10.1277 0.13
NP_442151.1_6 Reverse -54 -68 9.43936 0.148
NP_442151.1_6 Forward -262 -248 6.78443 0.221
NP_442151.1_6 Reverse -253 -267 5.50613 0.274
NP_442151.1_6 Reverse -281 -295 5.40779 0.278
NP_441818.1_1 Forward -261 -250 18.446 0.0046
NP_441818.1_9 Reverse -17 -36 10.1275 0.106
NP_441818.1_9 Reverse -287 -306 -2.65548 0.208
NP_441818.1_9 Reverse -322 -341 -8.85033 0.283
NP_441818.1_9 Reverse -273 -292 -9.44032 0.291
NP_440226.1_1 Reverse -253 -272 17.7974 0.0175
NP_440226.1_1 Forward -262 -243 5.89931 0.142
NP_441098.1_3 Forward -104 -85 -5.83193 0.28
NP_440150.1_2 Reverse -341 -360 9.34008 0.217
NP_440150.1_6 Reverse -250 -269 1.0811 0.295
NP_442655.1_2 Reverse -13 -32 7.27595 0.159
NP_442173.1_1 Forward -261 -253 15.4574 0.00633
NP_442173.1_1 Reverse -254 -262 15.4574 0.00633
NP_442752.1_4 Forward -262 -255 13.8055 0.0199
NP_442752.1_4 Reverse -253 -260 13.8055 0.0199
NP_443027.1_4 Forward -264 -254 16.2046 0.0437
NP_443027.1_4 Reverse -251 -261 14.0414 0.0452
NP_441812.1_3 Reverse -252 -266 19.1741 0.0453
NP_442975.1_10 Forward -266 -252 4.22722 0.245
NP_442975.1_10 Reverse -249 -263 3.93223 0.249
NP_440784.1_7 Forward -261 -254 15.9687 0.0123
NP_440784.1_7 Reverse -254 -261 15.9687 0.0123
NP_442909.1_3 Forward -331 -312 20.2556 0.0697
NP_442909.1_4 Forward -210 -191 18.3873 0.281
NP_442909.1_7 Forward -261 -247 21.9267 0.0154
NP_440061.1_9 Forward -264 -250 11.4053 0.111
NP_441476.1_5 Forward -309 -290 -8.26035 0.3
NP_439979.1_9 Reverse -334 -352 12.6055 0.227
NP_442062.1_8 Forward -262 -252 17.3846 0.00193
NP_442062.1_8 Reverse -253 -263 10.3048 0.0493
NP_442972.1_1 Reverse -72 -90 24.8776 0.00307
NP_442972.1_1 Reverse -89 -107 7.67408 0.291
NP_440304.1_4 Forward -264 -254 19.9412 0.00364
NP_440304.1_4 Reverse -251 -261 10.8948 0.051
NP_442242.1_4 Forward -261 -254 14.3954 0.0124
NP_442242.1_4 Reverse -254 -261 14.3954 0.0124
NP_440044.1_8 Forward -261 -242 8.35759 0.0768
NP_442762.1_10 Reverse -156 -175 -11.8003 0.275
NP_439918.1_2 Reverse -17 -36 -2.36049 0.242
NP_439918.1_3 Reverse -250 -269 6.58763 0.264
NP_441200.1_4 Forward -324 -305 12.6841 0.172
NP_441208.1_9 Reverse -250 -264 7.07942 0.227
NP_440370.1_10 Reverse -244 -263 16.7157 0.0713
NP_442276.1_2 Reverse -283 -302 6.09597 0.291
NP_440132.1_1 Reverse -251 -269 14.5721 0.123
NP_442110.1_7 Reverse -253 -267 2.75286 0.222
NP_442110.1_7 Forward -262 -248 -0.000409212 0.27
NP_441082.1_10 Reverse -18 -31 11.1307 0.236
NP_441082.1_10 Reverse -283 -296 8.37742 0.275
NP_441925.1_4 Forward -339 -320 -0.984623 0.155
NP_441925.1_4 Forward -341 -322 -4.72118 0.177
NP_441925.1_4 Forward -347 -328 -6.88445 0.185
NP_441925.1_4 Forward -344 -325 -12.096 0.253
NP_441925.1_4 Forward -338 -319 -13.6693 0.258
NP_441925.1_4 Forward -303 -284 -15.5375 0.266
NP_441925.1_4 Forward -65 -46 -17.4058 0.294
NP_440014.1_3 Forward -298 -284 16.4498 0.261
NP_440330.1_4 Reverse -254 -273 19.7604 0.181
NP_441083.1_5 Forward -262 -252 20.3345 0.00053
NP_441083.1_5 Reverse -253 -263 11.2881 0.0159
NP_442827.1_8 Reverse -245 -264 5.70185 0.115
NP_441434.1_1 Reverse -84 -98 19.492 0.0588
NP_441434.1_1 Forward -99 -85 9.36983 0.24
NP_441738.1_2 Forward -260 -253 15.28 0.0102
NP_441738.1_2 Reverse -255 -262 15.28 0.0102
NP_441558.1_5 Reverse -293 -312 5.70265 0.242
NP_440209.1_1 Reverse -253 -261 18.1123 0.00295
NP_440209.1_1 Forward -262 -254 18.1123 0.00295
NP_442889.1_8 Forward -265 -251 8.3571 0.123
NP_441713.1_1 Forward -268 -249 -12.7836 0.248
NP_440178.1_7 Forward -263 -244 -3.54046 0.0481
NP_442570.1_3 Reverse -279 -298 -7.67036 0.273
NP_441716.1_1 Forward -262 -248 13.8643 0.0689
NP_441716.1_1 Reverse -295 -309 6.6861 0.191
NP_443013.1_8 Forward -273 -255 9.26226 0.258
NP_442111.1_4 Reverse -252 -266 11.0127 0.0518
NP_441163.1_1 Forward -346 -329 11.8378 0.183
NP_441163.1_4 Forward -301 -282 12.9205 0.278
NP_441533.1_7 Forward -175 -157 14.768 0.265
NP_440343.1_3 Forward -338 -320 8.86816 0.195
NP_440343.1_9 Reverse -263 -282 6.78429 0.293
NP_440906.1_5 Forward -261 -254 15.8704 0.0124
NP_440906.1_5 Reverse -254 -261 15.8704 0.0124
NP_440747.1_10 Forward -265 -253 7.80712 0.00223
NP_440747.1_10 Reverse -250 -262 7.51213 0.00286
NP_440747.1_10 Reverse -279 -291 -12.2524 0.254
NP_441486.1_1 Reverse -250 -264 12.4876 0.0116
NP_441486.1_1 Forward -265 -251 3.24451 0.0638
NP_441486.1_1 Reverse -124 -138 -5.50694 0.242
NP_442145.1_4 Reverse -85 -104 2.33913 0.299
NP_442850.1_1 Forward -258 -239 15.8678 0.254
NP_442634.1_4 Reverse -251 -265 7.86607 0.0479
NP_442634.1_4 Forward -264 -250 -2.26202 0.149
NP_440470.1_5 Forward -118 -99 5.68135 0.294
NP_440403.1_4 Reverse -244 -263 -9.44032 0.275
NP_440057.1_4 Forward -297 -278 17.7009 0.113
NP_441695.1_4 Forward -338 -320 12.3105 0.225
NP_441014.1_5 Reverse -284 -302 10.0489 0.269
NP_441014.1_8 Forward -338 -319 9.24257 0.131
NP_441014.1_8 Forward -387 -368 -8.55534 0.284
NP_441014.1_10 Reverse -189 -208 10.3234 0.119
NP_441014.1_10 Forward -263 -244 -0.689632 0.252
NP_442848.1_1 Reverse -247 -261 17.3058 0.0143
NP_443018.1_3 Forward -261 -254 14.8871 0.0123
NP_443018.1_3 Reverse -254 -261 14.8871 0.0123
NP_441316.1_7 Reverse -251 -266 7.74804 0.107
NP_441634.1_8 Reverse -293 -307 -4.22864 0.295
NP_440376.1_1 Forward -262 -253 19.4693 0.000692
NP_440376.1_1 Reverse -253 -262 19.4693 0.000692
NP_440376.1_1 Forward -143 -134 3.44131 0.203
NP_440376.1_1 Reverse -282 -291 0.786375 0.26
NP_441588.1_4 Forward -134 -124 7.35486 0.178
NP_442687.1_7 Forward -263 -253 9.02648 0.0994
NP_442687.1_7 Reverse -252 -262 8.92815 0.0994
NP_442191.1_4 Reverse -283 -297 11.284 0.263
NP_441077.1_6 Reverse -107 -123 10.9965 0.156
NP_440066.1_5 Reverse -288 -307 6.88182 0.272
NP_442485.1_3 Forward -309 -290 -3.83545 0.277
NP_441846.1_10 Reverse -315 -334 -15.2418 0.246
NP_441846.1_10 Reverse -321 -340 -18.8801 0.256
NP_441846.1_10 Reverse -319 -338 -20.2567 0.256
NP_441846.1_10 Reverse -320 -339 -21.4367 0.256
NP_441846.1_10 Reverse -322 -341 -22.9117 0.271
NP_442958.1_3 Reverse -242 -261 -0.787193 0.268
NP_441422.1_7 Forward -33 -16 -3.10775 0.227
NP_441422.1_7 Forward -355 -338 -4.97604 0.247
NP_440533.1_9 Reverse -253 -272 3.14605 0.257
NP_441950.1_7 Reverse -318 -337 -1.37718 0.194
NP_441950.1_7 Forward -148 -129 -6.98204 0.278
NP_441950.1_7 Reverse -17 -36 -9.047 0.292
NP_442296.1_5 Forward -294 -275 -0.39387 0.299
NP_440887.1_8 Reverse -267 -281 17.9942 0.124
NP_440360.1_10 Forward -346 -332 5.50613 0.227
NP_442658.1_1 Forward -264 -254 13.0576 0.04
NP_442658.1_1 Reverse -251 -261 6.76441 0.214
NP_442205.1_9 Reverse -247 -263 4.87675 0.145
NP_440656.1_8 Reverse -242 -261 1.76941 0.124
NP_440656.1_8 Forward -273 -254 -3.83545 0.198
NP_442544.1_6 Forward -269 -250 -7.17871 0.298
NP_441414.1_9 Forward -262 -243 6.68596 0.0378
NP_441487.1_6 Forward -203 -184 4.32602 0.254
NP_441487.1_6 Forward -270 -251 -1.37718 0.285
NP_441256.1_1 Reverse -250 -269 -9.63698 0.29
NP_439959.1_6 Reverse -163 -182 6.98095 0.27
NP_442937.1_5 Reverse -122 -141 7.07928 0.263
NP_442937.1_5 Reverse -290 -309 6.98095 0.265
NP_441958.1_5 Forward -263 -253 21.2195 0.000805
NP_441958.1_5 Reverse -252 -262 12.2714 0.00183
NP_440450.1_7 Forward -33 -19 18.9768 0.0859
NP_442057.1_5 Reverse -18 -36 18.0802 0.0926
NP_442486.1_6 Forward -268 -249 -6.39206 0.293
NP_442836.1_5 Reverse -247 -266 2.16274 0.269
NP_440203.1_5 Reverse -256 -266 12.5659 0.146
NP_440203.1_5 Forward -259 -249 12.4676 0.147
NP_442816.1_7 Forward -113 -94 8.54611 0.238
NP_442816.1_7 Forward -112 -93 7.59119 0.238
NP_439905.1_1 Forward -339 -326 12.999 0.178
NP_439905.1_1 Forward -347 -334 7.39411 0.262
NP_441162.1_3 Forward -337 -318 9.43923 0.242
NP_442690.1_1 Forward -91 -72 -11.9969 0.237
NP_442690.1_1 Forward -119 -100 -16.6185 0.29
NP_442911.1_2 Reverse -243 -262 11.8975 0.0131
NP_442911.1_2 Forward -272 -253 4.81767 0.0367
NP_440153.1_5 Forward -261 -247 7.47274 0.161
NP_442064.1_4 Reverse -277 -296 4.32522 0.29
NP_443055.1_3 Reverse -244 -263 13.2234 0.184
NP_440496.1_1 Reverse -298 -317 2.65439 0.266
NP_440138.1_6 Forward -261 -242 1.57197 0.283
NP_439975.1_2 Reverse -325 -343 5.82068 0.26
NP_440106.1_2 Reverse -244 -262 14.7688 0.26
NP_441646.1_1 Reverse -288 -307 -1.96717 0.298
NP_442438.1_10 Reverse -248 -262 1.47456 0.194
NP_442431.1_10 Reverse -322 -340 9.16393 0.137
NP_442771.1_1 Reverse -251 -269 -5.38906 0.166
NP_441110.1_7 Reverse -238 -257 18.0924 0.238
NP_440147.1_4 Forward -264 -251 3.65753 0.183
NP_440147.1_4 Reverse -251 -264 1.49425 0.226
NP_441550.1_8 Forward -264 -254 13.0576 0.0273
NP_441550.1_8 Reverse -251 -261 12.3692 0.0336
NP_441916.1_7 Reverse -253 -263 18.9579 0.00144
NP_441916.1_7 Forward -262 -252 10.3048 0.0261
NP_441916.1_7 Forward -357 -347 3.02829 0.232
NP_441916.1_7 Reverse -352 -362 1.06167 0.294
NP_441916.1_10 Reverse -337 -356 4.81767 0.221
NP_441916.1_10 Forward -270 -251 4.32602 0.223
NP_440345.1_5 Forward -95 -81 14.4295 0.276
NP_441041.1_4 Reverse -247 -266 -7.76869 0.192
NP_441041.1_7 Forward -265 -253 6.34865 0.211
NP_442396.1_5 Reverse -249 -262 9.16406 0.13
NP_442996.1_7 Reverse -105 -124 16.85 0.216
NP_442004.1_6 Forward -262 -248 10.1277 0.14
NP_442004.1_6 Reverse -253 -267 5.21113 0.195
NP_440703.1_9 Forward -297 -284 5.0336 0.293
NP_441725.1_4 Forward -267 -253 3.14559 0.279
NP_441725.1_5 Forward -261 -251 11.2881 0.0247
NP_441725.1_5 Reverse -254 -264 11.1898 0.0247
NP_439966.1_7 Reverse -251 -261 15.8108 0.0124
NP_439966.1_7 Forward -264 -254 14.8275 0.0177
NP_439966.1_7 Forward -333 -323 4.10949 0.289
NP_442941.1_3 Forward -261 -251 19.9412 0.00262
NP_442941.1_3 Reverse -254 -264 19.9412 0.00262
NP_440289.1_2 Forward -265 -252 3.85419 0.0735
NP_440289.1_2 Reverse -250 -263 -2.93064 0.262
NP_440983.1_5 Forward -63 -44 -6.39206 0.276
NP_440983.1_5 Forward -337 -318 -9.24366 0.3
NP_440260.1_8 Forward -145 -127 3.65739 0.163
NP_442281.1_1 Forward -267 -253 17.0102 0.00693
NP_442281.1_1 Reverse -248 -262 8.3571 0.0823
NP_441334.1_7 Forward -350 -331 -14.8485 0.275
NP_441334.1_7 Reverse -251 -270 -21.0434 0.287
NP_442256.1_2 Reverse -251 -269 -9.12563 0.249
NP_440437.1_1 Forward -268 -249 6.68596 0.0724
NP_440498.1_1 Forward -271 -253 16.3421 0.0223
NP_440498.1_1 Reverse -244 -262 7.00065 0.0845
NP_442982.1_5 Forward -272 -253 15.0441 0.0748
NP_441644.1_6 Reverse -253 -263 19.0557 0.000803
NP_441644.1_6 Forward -262 -252 17.3841 0.00127
NP_441644.1_6 Forward -304 -294 6.37109 0.161
NP_441644.1_6 Forward -136 -126 3.61784 0.272
NP_442215.1_2 Reverse -251 -267 -6.13632 0.264
NP_442215.1_2 Forward -333 -317 -6.62797 0.277
NP_442177.1_5 Reverse -20 -34 13.3726 0.22
NP_442029.1_1 Reverse -160 -179 -18.4868 0.272
NP_440253.1_2 Reverse -253 -271 -2.24246 0.262
NP_440253.1_2 Forward -262 -244 -3.52077 0.294
NP_440929.1_8 Forward -262 -253 19.2726 0.000701
NP_440929.1_8 Reverse -253 -262 19.2726 0.000701
NP_440929.1_8 Reverse -365 -374 3.63797 0.214
NP_440929.1_8 Forward -340 -331 0.786375 0.299
NP_440566.1_6 Reverse -363 -382 10.4225 0.258
NP_442933.1_1 Forward -114 -95 16.8539 0.167
NP_442933.1_1 Forward -113 -94 12.4613 0.242
NP_442933.1_1 Forward -120 -101 7.78217 0.253
NP_442933.1_2 Reverse -102 -120 6.78191 0.269
NP_442933.1_2 Reverse -67 -85 6.49544 0.269
NP_442933.1_10 Forward -262 -253 17.601 0.00325
NP_442933.1_10 Reverse -253 -262 17.601 0.00325
NP_442933.1_10 Reverse -352 -361 8.1612 0.0885
NP_442671.1_2 Reverse -100 -119 4.22167 0.182
NP_441751.2_8 Reverse -254 -268 15.1426 0.0119
NP_441751.2_8 Forward -261 -247 5.50613 0.0423
NP_442554.1_8 Reverse -254 -264 16.9913 0.0065
NP_442554.1_8 Forward -261 -251 15.9097 0.00747
NP_442554.1_8 Forward -303 -293 5.09324 0.161
NP_442970.1_3 Forward -90 -72 12.8662 0.224
NP_441762.1_7 Reverse -321 -333 -5.86088 0.246
NP_441762.1_7 Reverse -294 -306 -6.35254 0.284
NP_441762.1_7 Forward -263 -251 -6.74586 0.284
NP_441762.1_7 Reverse -252 -264 -6.94252 0.284
NP_442142.1_4 Forward -265 -252 14.8666 0.0302
NP_442142.1_4 Reverse -250 -263 6.90188 0.153
NP_442292.1_1 Forward -261 -252 18.486 0.00229
NP_442292.1_1 Reverse -254 -263 17.5026 0.00435
NP_442476.1_6 Forward -261 -247 9.63603 0.082
NP_440895.1_6 Reverse -276 -289 8.37742 0.276
NP_441523.1_6 Forward -295 -276 5.89931 0.227
NP_443009.1_5 Reverse -252 -263 14.5128 0.02
NP_443009.1_5 Forward -263 -252 10.1862 0.0792
NP_442408.2_1 Reverse -253 -272 4.81767 0.143
NP_442408.2_1 Forward -262 -243 -1.7705 0.241
NP_441715.1_4 Forward -261 -251 14.828 0.0268
NP_441715.1_4 Reverse -254 -264 14.238 0.0295
NP_440357.1_3 Reverse -328 -347 0.491109 0.28
NP_441448.1_1 Reverse -328 -347 4.22769 0.279
NP_441198.1_4 Reverse -159 -178 12.7825 0.241
NP_441198.1_8 Forward -264 -254 13.2713 0.108
NP_440379.1_5 Reverse -278 -297 -6.98204 0.24
NP_440379.1_5 Reverse -286 -305 -8.752 0.254
NP_440379.1_6 Reverse -371 -390 3.93269 0.274
NP_441468.1_1 Forward -261 -254 15.8704 0.0124
NP_441468.1_1 Reverse -254 -261 15.8704 0.0124
NP_441020.2_6 Reverse -251 -268 17.2468 0.0206
NP_441020.2_6 Reverse -320 -337 8.98696 0.182
NP_441015.1_10 Reverse -323 -342 0.392778 0.165
NP_441015.1_10 Reverse -290 -309 -0.983855 0.169
NP_441015.1_10 Reverse -320 -339 -6.98204 0.26
NP_441015.1_10 Reverse -317 -336 -11.7019 0.3
NP_441673.1_1 Forward -262 -253 20.8459 0.000698
NP_441673.1_1 Reverse -253 -262 20.8459 0.000698
NP_441826.1_2 Reverse -247 -261 9.04604 0.065
NP_442868.1_6 Reverse -251 -261 9.91146 0.038
NP_442868.1_6 Forward -264 -254 1.06167 0.205
NP_440051.1_5 Forward -113 -99 15.4196 0.219
NP_441612.1_2 Forward -262 -252 8.54929 0.21
NP_442227.1_2 Forward -343 -324 6.98095 0.198
NP_442227.1_2 Forward -338 -319 5.01433 0.202
NP_442227.1_2 Forward -352 -333 2.26107 0.235
NP_443058.1_7 Reverse -252 -271 6.09597 0.233
NP_442361.1_3 Forward -380 -367 15.2606 0.0949
NP_442427.1_3 Reverse -180 -198 3.75572 0.171
NP_442427.1_8 Reverse -111 -130 7.37428 0.215
NP_442808.1_1 Forward -33 -23 11.4843 0.0481
NP_442808.1_1 Forward -263 -253 8.73102 0.0481
NP_442808.1_1 Reverse -252 -262 8.63269 0.0481
NP_442808.1_1 Forward -332 -322 7.84605 0.0668
NP_441101.1_10 Forward -338 -319 0.392778 0.175
NP_442692.1_4 Forward -101 -82 22.6156 0.0604
NP_440145.1_3 Forward -272 -253 -4.72043 0.245
NP_442820.1_3 Reverse -298 -308 13.5492 0.277
NP_442050.1_1 Reverse -326 -345 10.4225 0.243
NP_442050.1_5 Forward -264 -254 18.0724 0.00365
NP_442050.1_5 Reverse -251 -261 16.4991 0.00812
NP_442903.1_2 Reverse -101 -120 8.83258 0.165
NP_442342.1_9 Forward -333 -317 8.71166 0.187
NP_442342.1_9 Forward -306 -290 4.48343 0.249
NP_440558.1_2 Forward -271 -252 -0.688862 0.204
NP_440558.1_2 Forward -307 -288 -3.93378 0.239
NP_440558.1_2 Reverse -181 -200 -7.4737 0.294
NP_440558.1_2 Forward -256 -237 -7.57203 0.296
NP_440162.1_2 Reverse -277 -296 10.6192 0.276
NP_442789.1_4 Reverse -251 -270 -0.39387 0.203
NP_441518.1_3 Reverse -243 -262 -12.7836 0.263
NP_441878.1_6 Forward -263 -253 10.5014 0.0176
NP_441878.1_6 Reverse -252 -262 10.4031 0.0176
NP_441878.1_6 Reverse -294 -304 0.668351 0.139
NP_441878.1_6 Reverse -321 -331 -7.0998 0.204
NP_441878.1_6 Reverse -338 -348 -7.98478 0.285
NP_441036.1_8 Forward -263 -253 15.713 0.00724
NP_441036.1_8 Reverse -252 -262 8.33817 0.174
NP_441036.1_8 Reverse -347 -357 7.35486 0.201
NP_441557.1_5 Forward -262 -253 19.9609 0.000699
NP_441557.1_5 Reverse -253 -262 19.9609 0.000699
NP_441557.1_8 Forward -168 -158 15.8108 0.18
NP_441590.1_2 Reverse -277 -290 18.9972 0.278
NP_441590.1_4 Forward -338 -319 9.83173 0.249
NP_441590.1_4 Forward -339 -320 4.12856 0.29
NP_441433.1_8 Forward -380 -361 -4.52377 0.294
NP_441308.1_8 Forward -264 -254 13.353 0.218
NP_440101.1_3 Reverse -242 -261 2.16274 0.259
NP_442183.1_1 Reverse -253 -267 19.7641 0.00575
NP_442183.1_1 Forward -262 -248 17.7975 0.00938
NP_442183.1_9 Reverse -46 -56 9.41981 0.296
NP_440440.1_1 Reverse -142 -161 6.39016 0.295
NP_440979.1_3 Reverse -254 -272 11.2289 0.234
NP_441549.1_9 Reverse -249 -267 13.4905 0.0304
NP_442347.1_2 Forward -261 -252 12.4878 0.056
NP_442347.1_2 Reverse -254 -263 3.34298 0.284
NP_442645.1_2 Reverse -245 -264 -14.0619 0.17
NP_442645.1_2 Forward -264 -245 -20.65 0.288
NP_442888.1_6 Forward -391 -372 3.93269 0.238
NP_441037.1_4 Forward -264 -254 7.31769 0.237
NP_442594.1_8 Reverse -336 -355 14.7491 0.146
NP_442594.1_8 Reverse -327 -346 14.5524 0.146
NP_442594.1_8 Reverse -320 -339 10.9142 0.175
NP_442594.1_8 Reverse -286 -305 4.32602 0.266
NP_442594.1_8 Reverse -319 -338 2.55606 0.295
NP_442508.1_8 Reverse -9 -26 9.97027 0.277
NP_442508.1_8 Reverse -280 -297 8.7903 0.297
NP_441633.1_3 Reverse -251 -264 -6.17557 0.238
NP_440136.1_2 Forward -261 -254 15.9687 0.0123
NP_440136.1_2 Reverse -254 -261 15.9687 0.0123
NP_442590.1_10 Reverse -247 -266 8.55425 0.206
NP_442590.1_10 Reverse -282 -301 7.27595 0.23
NP_442998.1_10 Forward -260 -253 15.5754 0.0102
NP_442998.1_10 Reverse -255 -262 15.5754 0.0102
NP_442998.1_10 Forward -134 -127 4.16902 0.259
NP_440899.1_2 Forward -273 -254 18.0915 0.0452
NP_440899.1_2 Reverse -242 -261 12.0933 0.118
NP_440299.1_1 Reverse -249 -262 10.2451 0.058
NP_440299.1_1 Forward -352 -339 5.62358 0.169
NP_440299.1_1 Forward -266 -253 3.46031 0.243
NP_440299.1_1 Forward -302 -289 2.37867 0.291
NP_441799.1_1 Reverse -249 -263 17.0102 0.0123
NP_441799.1_1 Forward -266 -252 15.3386 0.0187
NP_441007.1_10 Forward -267 -254 10.639 0.0656
NP_441007.1_10 Reverse -248 -261 8.67241 0.112
NP_441007.1_10 Reverse -334 -347 0.805932 0.216
NP_442334.1_2 Reverse -285 -302 -7.04099 0.283
NP_442334.1_10 Reverse -289 -308 -16.7168 0.257
NP_440256.1_1 Forward -265 -246 9.83255 0.0195
NP_440256.1_1 Reverse -13 -32 -9.047 0.273
NP_440087.1_1 Reverse -244 -263 -8.65367 0.285
NP_441362.1_5 Forward -101 -83 14.4905 0.144
NP_441512.1_4 Forward -308 -289 8.45592 0.264
NP_441559.1_2 Reverse -9 -28 19.469 0.109
NP_441559.1_8 Forward -257 -243 -5.21195 0.254
NP_440915.1_6 Reverse -283 -297 -1.5737 0.239
NP_442158.1_4 Forward -114 -104 10.8948 0.283
NP_440717.1_3 Forward -301 -287 10.3237 0.231
NP_442785.1_7 Forward -264 -250 11.701 0.228
NP_441704.1_8 Reverse -242 -261 8.4551 0.208
NP_442866.1_1 Reverse -276 -295 5.89931 0.124
NP_442866.1_1 Reverse -11 -30 -3.54046 0.221
NP_442866.1_1 Reverse -248 -267 -5.60541 0.243
NP_440748.1_5 Forward -29 -10 11.0125 0.135
NP_442031.1_5 Reverse -239 -258 8.16093 0.23
NP_441464.1_1 Forward -295 -276 17.7974 0.0915
NP_441464.1_10 Reverse -21 -35 21.7307 0.0227
NP_441464.1_10 Reverse -320 -334 15.0442 0.166
NP_441464.1_10 Reverse -285 -299 7.47274 0.296
NP_440702.1_2 Reverse -14 -33 -3.93378 0.257
NP_442150.1_8 Reverse -84 -103 17.4599 0.215
NP_440306.1_5 Reverse -208 -227 -1.57384 0.298
NP_442993.1_1 Reverse -253 -269 -1.41643 0.0906
NP_442993.1_1 Reverse -352 -368 -11.6429 0.255
NP_440677.1_1 Forward -271 -252 6.4893 0.265
NP_442386.1_9 Reverse -252 -261 13.8639 0.0289
NP_442386.1_9 Forward -263 -254 6.39082 0.219
NP_442386.1_9 Forward -32 -23 5.30919 0.257
NP_442386.1_9 Forward -305 -296 4.62087 0.294
NP_441750.1_7 Reverse -322 -332 15.3197 0.254
NP_441340.1_5 Forward -261 -254 15.6737 0.0124
NP_441340.1_5 Reverse -254 -261 15.6737 0.0124
NP_441340.1_5 Reverse -128 -135 8.8889 0.084
NP_440137.1_10 Forward -59 -41 14.768 0.271
NP_440168.1_9 Reverse -251 -270 2.94938 0.231
NP_440168.1_9 Reverse -242 -261 -1.18052 0.273
NP_442240.1_1 Forward -356 -337 12.1917 0.18
NP_442714.1_7 Forward -261 -242 5.30933 0.174
NP_440586.1_1 Reverse -285 -304 -1.7705 0.241
NP_440586.1_8 Forward -261 -254 13.2151 0.026
NP_440586.1_8 Reverse -254 -261 13.2151 0.026
NP_440586.1_8 Forward -255 -248 7.51192 0.239
NP_442251.1_6 Forward -261 -254 15.2804 0.0124
NP_442251.1_6 Reverse -254 -261 15.2804 0.0124
NP_440192.1_5 Reverse -275 -294 3.73603 0.271
NP_442959.1_6 Reverse -43 -62 0.491109 0.297
NP_440684.1_9 Reverse -247 -261 8.55439 0.226
NP_441262.1_3 Reverse -253 -260 14.7888 0.0223
NP_441262.1_3 Forward -262 -255 14.7888 0.0223
NP_440027.1_3 Forward -339 -321 6.1149 0.23
NP_440027.1_3 Reverse -243 -261 3.8533 0.263
NP_443051.1_1 Forward -263 -254 19.5676 0.00335
NP_443051.1_1 Reverse -252 -261 10.4228 0.00754
NP_439937.1_8 Reverse -290 -309 5.70265 0.192
NP_439937.1_8 Reverse -337 -356 -1.7705 0.249
NP_439937.1_9 Forward -332 -315 -12.8431 0.276
NP_439937.1_9 Forward -254 -237 -13.0398 0.279
NP_439937.1_9 Forward -185 -168 -17.3663 0.298
NP_440408.1_7 Forward -206 -187 13.7658 0.175
NP_440439.1_1 Reverse -250 -263 9.2624 0.0465
NP_440439.1_1 Forward -265 -252 9.06573 0.0475
NP_442239.1_8 Reverse -318 -337 6.98095 0.263
NP_442239.1_8 Reverse -269 -288 5.70265 0.266
NP_440372.1_2 Forward -261 -254 16.3621 0.0124
NP_440372.1_2 Reverse -254 -261 16.3621 0.0124
NP_440372.1_3 Reverse -103 -117 15.1948 0.165
NP_441789.1_7 Forward -339 -320 0.392004 0.245
NP_441789.1_7 Forward -49 -30 -3.93454 0.28
NP_441293.1_3 Reverse -99 -117 12.7024 0.291
NP_440316.1_10 Reverse -321 -331 16.598 0.153
NP_440316.1_10 Reverse -294 -304 7.74818 0.246
NP_440316.1_10 Reverse -329 -339 7.45319 0.251
NP_440267.1_2 Forward -267 -253 9.6354 0.156
NP_442384.1_10 Forward -262 -249 17.1289 0.00642
NP_442384.1_10 Reverse -253 -266 13.589 0.0195
NP_442384.1_10 Reverse -247 -260 3.46087 0.19
NP_441018.1_7 Reverse -277 -296 9.83255 0.218
NP_442262.1_10 Forward -261 -254 14.1988 0.0123
NP_442262.1_10 Reverse -254 -261 14.1988 0.0123
NP_441689.1_5 Forward -264 -254 17.8758 0.0158
NP_441689.1_5 Reverse -251 -261 15.3192 0.0403
NP_440344.1_10 Forward -269 -252 -9.49926 0.147
NP_440344.1_10 Forward -39 -22 -12.2525 0.246
NP_440282.1_10 Reverse -243 -262 -5.99873 0.25
NP_440531.1_6 Reverse -245 -264 -4.22878 0.278
NP_440531.1_8 Reverse -242 -261 4.42435 0.269
NP_442123.1_3 Reverse -352 -371 11.4058 0.245
NP_440562.1_3 Reverse -254 -271 3.67709 0.219
NP_441965.1_3 Reverse -243 -262 5.70265 0.151
NP_441965.1_10 Reverse -250 -266 16.5781 0.0438
NP_441965.1_10 Forward -265 -249 8.22001 0.131
NP_442693.1_6 Forward -175 -156 6.19431 0.278
NP_442693.1_6 Forward -297 -278 5.01433 0.278
NP_442693.1_6 Forward -32 -13 3.93269 0.278
NP_440297.1_9 Forward -261 -251 9.32148 0.0917
NP_440297.1_9 Reverse -254 -264 9.22315 0.0917
NP_440297.1_9 Forward -303 -293 -0.216628 0.282
NP_440350.1_5 Forward -240 -221 -0.787193 0.19
NP_440937.1_5 Reverse -275 -294 10.9142 0.275
NP_440999.1_1 Forward -342 -323 3.83357 0.249
NP_440999.1_9 Forward -266 -252 0.392915 0.187
NP_440999.1_9 Forward -335 -321 -0.885388 0.22
NP_440999.1_9 Reverse -249 -263 -3.24533 0.289
NP_440888.1_2 Forward -262 -248 14.1586 0.02
NP_440888.1_2 Reverse -253 -267 10.3237 0.0974
NP_440888.1_2 Reverse -185 -199 8.75042 0.149
NP_440600.1_4 Reverse -245 -263 -2.93078 0.213
NP_440052.1_8 Reverse -245 -264 9.24257 0.256
NP_442277.1_2 Forward -349 -335 15.2409 0.178
NP_442277.1_7 Reverse -93 -109 0.38877 0.215
NP_442033.1_10 Forward -333 -314 -7.27704 0.186
NP_441123.1_8 Forward -230 -211 10.8159 0.251
NP_441917.1_2 Reverse -368 -386 5.03403 0.288
NP_441543.1_2 Forward -261 -252 16.9127 0.00359
NP_441543.1_2 Reverse -254 -263 15.9293 0.00518
NP_441543.1_3 Forward -34 -20 13.2736 0.163
NP_442845.1_2 Reverse -247 -261 7.37441 0.195
NP_442845.1_2 Forward -268 -254 5.50613 0.231
NP_442845.1_2 Reverse -281 -295 3.44117 0.29
NP_440380.1_5 Reverse -290 -309 3.44104 0.299
NP_441551.1_5 Reverse -249 -265 18.4457 0.0365
NP_441178.1_6 Forward -341 -322 4.22689 0.269
NP_442336.1_10 Forward -380 -361 22.3197 0.0203
NP_441918.1_7 Reverse -294 -313 -0.590531 0.297
NP_442710.1_7 Reverse -99 -118 -2.12892 0.233
NP_441469.1_8 Forward -305 -296 9.73449 0.227
NP_441469.1_8 Forward -263 -254 6.5879 0.227
NP_441469.1_8 Reverse -252 -261 6.48957 0.227
NP_443064.1_6 Forward -262 -252 12.5669 0.0796
NP_443064.1_6 Reverse -253 -263 10.8217 0.13
NP_442578.1_7 Forward -261 -254 14.5921 0.026
NP_442578.1_7 Reverse -254 -261 14.5921 0.026
NP_440710.1_1 Forward -270 -252 -3.6191 0.208
NP_440071.1_6 Reverse -290 -304 14.7744 0.241
NP_441462.1_2 Reverse -253 -263 20.2362 0.000805
NP_441462.1_2 Forward -262 -252 11.5831 0.00406
NP_441621.1_7 Reverse -293 -307 -4.91696 0.248
NP_441621.1_7 Reverse -251 -265 -5.21195 0.248
NP_441621.1_7 Forward -333 -319 -6.19526 0.279
NP_443062.1_1 Reverse -262 -280 10.6911 0.112
NP_443062.1_6 Reverse -245 -264 1.57275 0.272
NP_440519.1_8 Reverse -17 -33 2.91013 0.254
NP_442204.1_1 Forward -266 -255 9.40011 0.0786
NP_442204.1_1 Reverse -318 -329 0.353664 0.281
NP_440516.1_8 Forward -262 -253 16.9127 0.00442
NP_440516.1_8 Reverse -253 -262 16.9127 0.00442
NP_440516.1_8 Reverse -322 -331 -0.196935 0.185
NP_442428.1_5 Forward -261 -254 15.8704 0.0124
NP_442428.1_5 Reverse -254 -261 15.8704 0.0124
NP_440673.1_2 Reverse -243 -262 7.95079 0.286
NP_440673.1_3 Forward -260 -253 12.4288 0.0426
NP_440673.1_3 Reverse -255 -262 12.4288 0.0426
NP_440673.1_3 Forward -251 -244 7.41394 0.263
NP_440865.1_9 Forward -367 -348 -8.65367 0.268
NP_441052.1_2 Forward -262 -252 19.9412 0.00106
NP_441052.1_2 Reverse -253 -263 10.4031 0.0285
NP_441052.1_2 Forward -304 -294 1.74999 0.229
NP_442219.1_9 Forward -261 -252 17.7976 0.00718
NP_442219.1_9 Reverse -254 -263 8.25953 0.0681
NP_440436.1_4 Forward -261 -252 17.2072 0.00233
NP_440436.1_4 Reverse -254 -263 9.24241 0.0871
NP_441884.1_9 Forward -265 -246 -15.4385 0.138
NP_442412.1_4 Forward -161 -142 25.7622 0.00318
NP_442412.1_8 Reverse -144 -162 16.1454 0.293
NP_440314.1_9 Reverse -254 -273 -6.49039 0.23
NP_441719.1_4 Forward -261 -254 16.3621 0.0124
NP_441719.1_4 Reverse -254 -261 16.3621 0.0124
NP_441719.1_6 Forward -341 -322 5.80018 0.288
NP_441004.1_1 Reverse -289 -308 3.24438 0.106
NP_441004.1_1 Reverse -339 -358 -11.4069 0.238
NP_441004.1_4 Reverse -292 -302 9.22315 0.259
NP_441004.1_5 Reverse -291 -305 14.3559 0.22
NP_442813.1_4 Reverse -364 -383 -8.94866 0.299
NP_442206.1_10 Reverse -253 -268 18.2695 0.0799
NP_442206.1_10 Forward -262 -247 5.48643 0.178
NP_442854.1_6 Reverse -11 -30 6.4893 0.234
NP_443054.1_2 Forward -195 -181 1.08123 0.251
NP_442430.1_4 Forward -306 -287 11.7008 0.296
NP_441851.1_10 Reverse -252 -262 15.8113 0.00552
NP_441851.1_10 Forward -263 -253 8.53483 0.114
NP_442622.1_1 Forward -263 -244 -11.4069 0.257
NP_442622.1_8 Forward -262 -244 -18.8604 0.285
NP_442515.1_1 Forward -263 -249 9.14437 0.066
NP_442515.1_1 Reverse -252 -266 4.03116 0.109
NP_442515.1_1 Reverse -225 -239 -4.7203 0.298
NP_441396.1_5 Reverse -323 -332 7.66954 0.241
NP_441396.1_5 Forward -151 -142 7.37455 0.279
NP_440593.1_3 Forward -309 -290 -6.09707 0.27
NP_441046.1_2 Reverse -242 -261 10.7175 0.191
NP_442689.1_8 Forward -87 -70 -5.95935 0.279
NP_441349.1_10 Reverse -243 -262 2.75272 0.0731
NP_441409.1_6 Reverse -247 -266 0.294447 0.0653
NP_441409.1_6 Forward -268 -249 -6.49039 0.128
NP_442843.1_1 Reverse -14 -33 -11.1119 0.286
NP_442843.1_1 Forward -261 -242 -11.7019 0.291
NP_440396.1_10 Forward -261 -245 12.4475 0.159
NP_441124.1_5 Forward -94 -84 11.6713 0.246
NP_440431.1_4 Reverse -103 -122 -6.8281 0.262
NP_442450.1_5 Forward -264 -254 9.41981 0.115
NP_442450.1_5 Reverse -251 -261 9.32148 0.115
NP_442450.1_8 Reverse -99 -118 19.2412 0.191
NP_440588.1_2 Forward -343 -324 -2.85214 0.174
NP_440588.1_2 Reverse -286 -305 -4.32711 0.214
NP_440040.1_8 Reverse -96 -115 12.8432 0.16
NP_442006.1_2 Reverse -330 -347 -6.25434 0.159
NP_440483.1_1 Reverse -282 -301 -2.95047 0.208
NP_441570.1_1 Forward -262 -244 13.2938 0.00522
NP_441570.1_1 Reverse -253 -271 -8.24065 0.107
NP_441570.1_1 Reverse -16 -34 -13.5505 0.223
NP_441078.1_4 Forward -262 -253 19.6659 0.0007
NP_441078.1_4 Reverse -253 -262 19.6659 0.0007
NP_442729.1_5 Reverse -321 -331 13.2547 0.231
NP_442729.1_8 Reverse -249 -262 9.75405 0.125
NP_441663.1_8 Forward -297 -278 3.73603 0.179
NP_441663.1_8 Forward -268 -249 3.34271 0.185
NP_440526.1_3 Forward -261 -250 0.844851 0.267
NP_440526.1_3 Forward -347 -336 0.156538 0.297
NP_441432.1_8 Reverse -252 -261 16.8143 0.00595
NP_441432.1_8 Forward -263 -254 16.8143 0.00595
NP_441432.1_8 Forward -375 -366 3.34298 0.248
NP_441432.1_9 Forward -112 -99 11.1192 0.235
NP_442320.1_8 Reverse -247 -261 -5.31028 0.217
NP_441732.1_2 Forward -266 -250 11.3666 0.0091
NP_441732.1_2 Reverse -249 -265 -17.4444 0.258
NP_440629.1_6 Forward -268 -249 20.0199 0.0283
NP_440760.1_1 Forward -262 -243 -4.52377 0.0447
NP_440760.1_7 Forward -109 -90 3.53858 0.254
NP_442797.1_7 Forward -305 -287 1.29745 0.262
NP_442274.1_8 Forward -355 -337 13.856 0.286
NP_440199.1_10 Reverse -250 -260 15.5163 0.0861
NP_440199.1_10 Forward -377 -367 9.02648 0.215
NP_441057.1_4 Reverse -272 -290 5.42735 0.201
NP_442751.1_2 Forward -355 -336 4.12856 0.261
NP_441072.1_2 Reverse -116 -135 5.60432 0.296
NP_442010.1_9 Reverse -132 -146 11.7987 0.235
NP_442400.1_10 Reverse -100 -113 7.70113 0.282
NP_442489.1_7 Forward -262 -253 20.1576 0.000695
NP_442489.1_7 Reverse -253 -262 20.1576 0.000695
NP_440565.1_2 Forward -358 -344 16.002 0.292
NP_442079.1_7 Forward -261 -242 10.1275 0.111
NP_442079.1_7 Reverse -254 -273 2.75272 0.223
NP_440559.1_1 Forward -261 -252 17.4043 0.00658
NP_440559.1_1 Reverse -254 -263 8.65285 0.0586
NP_442763.1_8 Reverse -353 -372 3.6377 0.185
NP_441659.2_8 Reverse -253 -263 20.9245 0.000805
NP_441659.2_8 Forward -262 -252 18.1713 0.00133
NP_441659.2_8 Forward -331 -321 1.65166 0.233
NP_442913.1_10 Reverse -244 -263 -0.983855 0.165
NP_441040.1_2 Reverse -363 -382 -8.752 0.236
NP_442849.1_1 Reverse -170 -184 7.86607 0.282
NP_439956.1_7 Reverse -276 -295 5.211 0.257
NP_441800.1_7 Forward -36 -18 -4.40575 0.294
NP_442776.1_1 Forward -330 -311 4.12936 0.278
NP_442346.1_5 Reverse -252 -262 16.6963 0.00248
NP_442346.1_5 Forward -263 -253 16.303 0.00248
NP_442346.1_5 Forward -257 -247 6.46988 0.201
NP_442346.1_5 Reverse -351 -361 5.48657 0.243
NP_440545.1_3 Reverse -249 -266 4.95539 0.0658
NP_440545.1_3 Forward -352 -335 0.333834 0.141
NP_440545.1_3 Forward -266 -249 -1.73112 0.173
NP_440545.1_3 Reverse -171 -188 -5.56602 0.253
NP_440545.1_5 Reverse -19 -36 18.5251 0.108
NP_441856.1_3 Reverse -250 -269 7.17762 0.105
NP_440831.1_3 Reverse -322 -341 6.38714 0.275
NP_441629.1_3 Forward -338 -319 10.7167 0.134
NP_440459.1_2 Forward -202 -185 8.29864 0.266
NP_440010.1_4 Reverse -243 -262 3.63691 0.22
NP_440010.1_4 Forward -308 -289 -1.37794 0.267
NP_442027.1_5 Reverse -259 -278 12.2908 0.223
NP_442603.1_7 Forward -262 -248 16.4202 0.0314
NP_442603.1_7 Reverse -253 -267 5.40719 0.296
NP_441050.1_5 Reverse -376 -394 -3.42244 0.293
NP_440449.1_6 Reverse -287 -305 9.61752 0.172
NP_440449.1_6 Reverse -126 -144 8.25583 0.203
NP_442754.1_3 Forward -387 -368 17.3057 0.299
NP_441833.1_4 Forward -261 -254 15.9687 0.0124
NP_441833.1_4 Reverse -254 -261 15.9687 0.0124
NP_443040.1_1 Reverse -107 -121 10.0873 0.291
NP_440751.1_3 Forward -346 -327 16.9115 0.127
NP_441329.1_6 Reverse -96 -115 0.811258 0.245
NP_442436.1_4 Reverse -86 -100 12.1926 0.236
NP_442060.1_6 Reverse -265 -284 14.2574 0.208
NP_442162.1_9 Forward -261 -254 16.2637 0.0124
NP_442162.1_9 Reverse -254 -261 16.2637 0.0124
NP_443015.1_3 Reverse -315 -334 17.9986 0.213
NP_440772.1_6 Reverse -236 -255 11.1109 0.212
NP_442140.1_3 Reverse -296 -306 4.60159 0.242
NP_442140.1_3 Forward -261 -251 4.40493 0.243
NP_441671.1_10 Forward -372 -353 9.53756 0.183
NP_440875.1_9 Reverse -255 -265 8.27469 0.233
NP_442547.1_7 Forward -203 -184 11.585 0.255
NP_441813.1_5 Reverse -251 -261 15.9097 0.01
NP_441813.1_5 Forward -264 -254 15.9097 0.01
NP_442028.1_1 Forward -120 -107 7.60564 0.292
NP_440590.1_4 Forward -261 -248 -4.11062 0.258
NP_440567.1_1 Reverse -254 -268 11.0127 0.0305
NP_440567.1_1 Forward -261 -247 4.91614 0.109
NP_442497.1_10 Reverse -254 -263 17.601 0.00813
NP_442497.1_10 Forward -261 -252 10.4228 0.0087
NP_440821.1_4 Reverse -251 -261 18.2696 0.00448
NP_440821.1_4 Forward -264 -254 11.0914 0.0146
NP_440227.1_6 Reverse -99 -113 15.1948 0.263
NP_441239.1_9 Forward -264 -252 12.1337 0.0494
NP_441239.1_9 Forward -306 -294 9.67541 0.0987
NP_441239.1_9 Forward -333 -321 9.08543 0.115
NP_441239.1_9 Forward -342 -330 5.05386 0.231
NP_441239.1_9 Forward -382 -370 4.95553 0.234
NP_441239.1_9 Reverse -251 -263 4.36554 0.253
NP_441951.1_9 Forward -179 -160 3.44104 0.254
NP_441009.1_7 Forward -263 -244 10.4225 0.246
NP_441892.1_1 Forward -370 -353 2.49712 0.14
NP_441892.1_1 Forward -202 -185 -4.97604 0.271
NP_442044.1_1 Forward -267 -248 -14.0619 0.283
NP_443012.1_6 Forward -333 -314 13.2741 0.224
NP_441541.1_1 Reverse -85 -103 8.50077 0.117
NP_441541.1_1 Forward -114 -96 -0.379982 0.237
NP_441541.1_1 Reverse -84 -102 -2.67179 0.264
NP_440949.1_7 Forward -270 -251 12.585 0.214
NP_440949.1_7 Reverse -245 -264 8.06178 0.298
NP_442138.1_10 Reverse -253 -272 -2.0655 0.191
NP_440546.1_4 Reverse -253 -263 13.5365 0.0459
NP_440546.1_4 Reverse -127 -137 11.6943 0.0748
NP_440546.1_4 Forward -262 -252 10.046 0.109
NP_440546.1_6 Reverse -168 -187 6.58763 0.297
NP_440462.1_6 Forward -264 -254 16.893 0.00853
NP_440462.1_6 Reverse -251 -261 7.74818 0.0699
NP_442611.1_1 Reverse -290 -309 5.89931 0.179
NP_442611.1_1 Reverse -253 -272 -2.65548 0.294
NP_440868.1_4 Reverse -249 -261 17.7386 0.0124
NP_440868.1_4 Forward -266 -254 15.1819 0.0164
NP_440868.1_8 Reverse -249 -268 -4.03212 0.263
NP_442499.1_1 Reverse -248 -267 5.30933 0.225
NP_442499.1_1 Forward -267 -248 2.26107 0.289
NP_442499.1_3 Reverse -252 -270 6.214 0.282
NP_441249.1_8 Reverse -379 -398 12.9791 0.16
NP_441249.1_8 Reverse -17 -36 5.50599 0.247
NP_441474.1_1 Forward -386 -367 -1.67294 0.262
NP_441848.1_4 Reverse -101 -117 9.26952 0.287
NP_441084.1_6 Reverse -233 -247 10.5076 0.238
NP_441084.1_6 Forward -264 -250 10.1198 0.254
NP_442358.1_1 Forward -270 -252 13.1955 0.291
NP_442039.1_4 Forward -261 -254 15.1821 0.0124
NP_442039.1_4 Reverse -254 -261 15.1821 0.0124
NP_441811.1_8 Reverse -289 -303 8.84938 0.228
NP_441811.1_8 Reverse -333 -347 7.66941 0.241
NP_441811.1_8 Reverse -247 -261 6.98109 0.259
NP_442696.1_2 Reverse -252 -270 14.2771 0.128
NP_442837.1_3 Forward -261 -254 15.7721 0.0124
NP_442837.1_3 Reverse -254 -261 15.7721 0.0124
NP_439994.1_1 Reverse -288 -307 13.1758 0.12
NP_442053.1_1 Forward -262 -253 18.3876 0.0007
NP_442053.1_1 Reverse -253 -262 18.3876 0.0007
NP_440505.1_3 Reverse -251 -261 16.303 0.00696
NP_440505.1_3 Forward -264 -254 15.123 0.014
NP_442360.1_5 Forward -18 -8 14.238 0.237
NP_441102.1_1 Reverse -254 -273 12.4875 0.108
NP_441203.1_1 Reverse -254 -273 -13.3736 0.163
NP_440308.1_6 Forward -293 -274 8.06259 0.296
NP_442532.1_1 Reverse -108 -122 9.53054 0.279
NP_442532.1_2 Reverse -81 -100 0.620274 0.267
NP_441408.2_8 Forward -363 -344 17.2074 0.111
NP_440914.1_1 Forward -262 -252 17.5935 0.000537
NP_440914.1_1 Reverse -253 -263 16.3248 0.00196
NP_440914.1_7 Forward -115 -96 6.63627 0.283
NP_440914.1_7 Reverse -92 -111 4.91741 0.29
NP_441011.1_8 Reverse -254 -263 16.6177 0.00602
NP_441011.1_8 Forward -261 -252 8.25953 0.144
NP_442101.1_10 Forward -270 -251 2.45773 0.0714
NP_442533.1_1 Reverse -321 -340 -6.49039 0.174
NP_442533.1_1 Reverse -319 -338 -12.9802 0.236
NP_442533.1_1 Reverse -13 -32 -14.0619 0.239
NP_442533.1_1 Reverse -14 -33 -15.8318 0.257
NP_442533.1_6 Forward -262 -253 17.2076 0.00137
NP_442533.1_6 Reverse -253 -262 17.2076 0.00137
NP_442533.1_6 Forward -304 -295 4.12963 0.191
NP_442232.1_3 Reverse -319 -338 -4.22878 0.163
NP_442232.1_3 Reverse -287 -306 -9.24366 0.246
NP_442322.1_4 Forward -342 -325 -6.94332 0.278
NP_442322.1_4 Forward -177 -160 -8.51661 0.286
NP_442322.1_4 Forward -340 -323 -9.00826 0.286
NP_442322.1_4 Forward -34 -17 -9.99156 0.297
NP_441482.1_7 Forward -268 -254 5.89945 0.0373
NP_441482.1_7 Reverse -247 -261 -1.47537 0.0721
NP_439944.1_9 Forward -261 -251 19.0562 0.00329
NP_439944.1_9 Reverse -254 -264 17.6796 0.00347
NP_441697.1_5 Reverse -70 -89 -7.59203 0.247
NP_442202.1_10 Forward -341 -327 3.44117 0.278
NP_440116.1_5 Reverse -250 -267 5.15205 0.176
NP_441527.1_4 Reverse -98 -117 -10.4568 0.27
NP_441527.1_4 Reverse -107 -126 -11.1252 0.278
NP_441527.1_4 Reverse -97 -116 -11.9847 0.285
NP_441527.1_4 Reverse -100 -119 -12.3666 0.285
NP_441527.1_4 Reverse -99 -118 -12.5576 0.291
NP_441527.1_4 Reverse -108 -127 -12.9396 0.296
NP_440115.1_6 Reverse -250 -260 8.4365 0.13
NP_440115.1_6 Forward -265 -255 7.45319 0.147
NP_440007.1_9 Forward -266 -252 8.75105 0.171
NP_440007.1_9 Reverse -278 -292 0.392915 0.298
NP_442728.1_2 Reverse -14 -33 14.3558 0.248
NP_441680.1_4 Forward -295 -276 5.60432 0.182
NP_440608.1_6 Forward -261 -242 12.7816 0.186
NP_443045.1_9 Forward -339 -321 9.55647 0.239
NP_440317.1_6 Reverse -173 -192 17.5024 0.17
NP_441106.1_1 Forward -263 -254 18.486 0.0028
NP_441106.1_1 Reverse -252 -261 9.63616 0.0311
NP_439903.1_6 Forward -265 -246 20.6481 0.0372
NP_439903.1_6 Reverse -250 -269 0.785326 0.256
NP_440797.1_2 Reverse -242 -261 12.0828 0.283
NP_441286.1_1 Reverse -252 -264 14.3953 0.00424
NP_441286.1_1 Forward -263 -251 11.937 0.0108
NP_441286.1_1 Forward -349 -337 0.727295 0.108
NP_440670.1_8 Forward -262 -253 18.3876 0.000699
NP_440670.1_8 Reverse -253 -262 18.3876 0.000699
NP_441930.1_3 Reverse -108 -127 2.58046 0.295
NP_440103.1_3 Forward -236 -226 17.2211 0.286
NP_440886.1_7 Forward -332 -322 15.2208 0.0327
NP_440886.1_7 Forward -263 -253 8.04271 0.0805
NP_440886.1_7 Reverse -252 -262 7.94438 0.0805
NP_440886.1_7 Forward -305 -295 7.15773 0.103
NP_440828.1_4 Forward -349 -330 2.16195 0.152
NP_442614.1_2 Forward -291 -277 10.6193 0.234
NP_442614.1_2 Reverse -171 -185 8.75105 0.248
NP_442614.1_2 Forward -262 -248 7.9644 0.257
NP_442213.1_5 Reverse -314 -333 0.0977854 0.273
NP_442213.1_5 Reverse -41 -60 -0.39387 0.284
NP_442773.2_1 Reverse -122 -141 16.7157 0.219
NP_441753.1_10 Forward -271 -252 4.03102 0.203
NP_440907.2_8 Reverse -254 -264 9.51767 0.103
NP_442264.1_2 Reverse -249 -266 5.15205 0.284
NP_441021.1_1 Forward -303 -284 -10.817 0.248
NP_441021.1_2 Forward -310 -291 9.24257 0.248
NP_441463.1_6 Forward -264 -250 13.5668 0.185
NP_441463.1_6 Reverse -251 -265 8.44524 0.25
NP_441626.1_2 Forward -261 -254 15.7721 0.0124
NP_441626.1_2 Reverse -254 -261 15.7721 0.0124
NP_439958.1_2 Forward -367 -353 11.111 0.288
NP_442211.1_3 Forward -205 -186 6.98569 0.29
NP_442365.1_7 Reverse -249 -268 9.0459 0.0801
NP_442365.1_7 Forward -266 -247 4.62101 0.144
NP_441962.1_4 Reverse -334 -353 -5.99873 0.175
NP_440387.1_1 Reverse -253 -269 22.3797 0.00192
NP_440387.1_1 Forward -262 -246 11.1699 0.018
NP_440387.1_1 Reverse -127 -143 -4.56302 0.19
NP_441431.1_2 Forward -334 -320 15.1419 0.0537
NP_441431.1_2 Forward -384 -370 8.75042 0.207
NP_441488.1_7 Reverse -289 -308 8.45592 0.121
NP_441836.1_2 Reverse -333 -352 -0.688862 0.214
NP_441836.1_2 Reverse -324 -343 -3.54046 0.239
NP_441836.1_2 Reverse -319 -338 -5.80207 0.288
NP_441993.1_1 Reverse -289 -308 7.11193 0.175
NP_441993.1_1 Reverse -322 -341 3.01872 0.244
NP_441993.1_1 Reverse -316 -335 2.23906 0.261
NP_440143.1_1 Reverse -202 -221 14.5524 0.246
NP_440114.1_10 Reverse -253 -267 9.43936 0.172
NP_440114.1_10 Forward -262 -248 7.66941 0.229
NP_441858.1_2 Reverse -32 -51 9.45297 0.293
NP_442323.1_7 Forward -31 -12 4.62021 0.215
NP_442324.1_3 Reverse -295 -314 13.3725 0.194
NP_441510.2_2 Forward -188 -169 4.32522 0.26
NP_441510.2_5 Forward -338 -319 21.828 0.0939
NP_441510.2_7 Reverse -247 -261 11.1104 0.28
NP_441720.1_2 Forward -266 -247 4.71854 0.231
NP_441272.1_7 Reverse -23 -33 13.353 0.257
NP_440293.1_3 Reverse -323 -342 3.04771 0.192
NP_440293.1_3 Reverse -287 -306 -1.96717 0.239
NP_440293.1_9 Forward -71 -57 10.3779 0.275
NP_441237.1_9 Forward -347 -337 10.2065 0.241
NP_442867.1_8 Reverse -158 -177 7.07928 0.247
NP_440457.1_1 Reverse -318 -330 6.82381 0.11
NP_440457.1_1 Reverse -331 -343 3.18557 0.202
NP_440457.1_1 Reverse -326 -338 2.79224 0.205
NP_440457.1_1 Reverse -249 -261 1.80894 0.223
NP_440457.1_1 Forward -266 -254 1.31728 0.241
NP_440798.1_2 Forward -334 -320 13.7653 0.299
NP_440801.1_10 Forward -275 -256 7.86593 0.272
NP_440142.1_7 Forward -199 -180 13.6675 0.179
NP_441984.1_1 Reverse -289 -307 5.72234 0.288
NP_441984.1_3 Reverse -361 -379 9.36059 0.211
NP_441332.1_6 Forward -332 -322 12.034 0.236
NP_441332.1_6 Forward -33 -23 12.034 0.236
NP_441332.1_6 Forward -338 -328 10.8723 0.282
NP_440473.1_1 Forward -265 -246 11.2574 0.28
NP_440473.1_1 Forward -391 -372 10.679 0.298
NP_442509.1_9 Forward -262 -252 8.14104 0.192
NP_442509.1_9 Reverse -253 -263 8.04271 0.192
NP_442509.1_9 Reverse -134 -144 6.56775 0.263
NP_441253.1_1 Forward -386 -367 6.29264 0.24
NP_441159.1_8 Forward -120 -101 -1.08295 0.24
NP_440554.1_4 Reverse -254 -264 16.1063 0.0189
NP_440554.1_4 Forward -261 -251 7.05986 0.106
NP_441845.1_6 Forward -274 -256 -1.55415 0.289
NP_441885.1_5 Forward -262 -252 20.9245 0.000538
NP_441885.1_5 Reverse -253 -263 11.3864 0.00668
NP_441885.1_5 Forward -374 -364 -1.19994 0.255
NP_442341.1_7 Forward -263 -249 5.50613 0.154
NP_442341.1_7 Reverse -252 -266 4.81781 0.177
NP_442341.1_9 Forward -264 -250 15.1419 0.0546
NP_442341.1_9 Reverse -279 -293 7.17714 0.204
NP_442341.1_9 Reverse -251 -265 6.68548 0.217
NP_442341.1_9 Forward -293 -279 6.19383 0.238
NP_440191.1_6 Reverse -105 -119 16.8182 0.294
NP_440423.1_6 Reverse -323 -342 -20.945 0.276
NP_443000.1_7 Forward -264 -254 17.4829 0.00719
NP_443000.1_7 Reverse -251 -261 17.0896 0.00865
NP_441842.1_10 Reverse -332 -346 7.07942 0.267
NP_440275.1_3 Forward -264 -254 9.12481 0.055
NP_440275.1_3 Reverse -251 -261 8.1415 0.0602
NP_440091.1_1 Reverse -249 -261 6.43049 0.095
NP_440679.1_10 Forward -260 -241 -4.91709 0.161
NP_440679.1_10 Reverse -255 -274 -6.78538 0.169
NP_440679.1_10 Reverse -288 -307 -20.3551 0.284
NP_443010.1_10 Forward -265 -248 8.18228 0.164
NP_442451.1_2 Reverse -245 -264 0.687771 0.149
NP_439962.1_4 Forward -309 -290 -6.49039 0.283
NP_439962.1_4 Forward -298 -279 -7.4737 0.289
NP_439962.1_4 Reverse -287 -306 -8.06369 0.292
NP_440175.1_7 Reverse -277 -295 22.8308 0.0137
NP_440175.1_7 Reverse -156 -174 13.1692 0.193
NP_440175.1_7 Reverse -278 -296 12.8764 0.201
NP_442495.1_4 Reverse -314 -324 13.1564 0.198
NP_440804.1_7 Reverse -84 -101 12.9194 0.175
NP_440149.1_8 Forward -262 -243 21.4356 0.00726
NP_440149.1_8 Reverse -121 -140 -7.67036 0.29
NP_441105.1_3 Reverse -284 -303 -0.197208 0.132
NP_442373.1_2 Reverse -319 -338 5.01433 0.148
NP_442373.1_2 Reverse -286 -305 -3.24547 0.198
NP_442373.1_2 Reverse -376 -395 -9.34199 0.26
NP_441730.1_3 Reverse -84 -102 16.6911 0.224
NP_440216.1_1 Reverse -253 -267 -2.55701 0.0521
NP_440216.1_1 Forward -262 -248 -9.44018 0.145
NP_440172.1_1 Reverse -253 -263 17.5813 0.00421
NP_440172.1_1 Forward -262 -252 15.0247 0.00945
NP_440172.1_1 Forward -129 -119 7.74818 0.0738
NP_442788.1_8 Reverse -341 -360 21.5339 0.0622
NP_442015.1_10 Reverse -249 -262 9.45906 0.0486
NP_442015.1_10 Forward -266 -253 1.39592 0.204
NP_441226.1_7 Forward -261 -254 14.4934 0.0123
NP_441226.1_7 Reverse -254 -261 14.4934 0.0123
NP_441226.1_7 Forward -290 -283 6.52862 0.253
NP_440305.1_1 Reverse -109 -123 13.094 0.283
NP_441757.1_3 Reverse -252 -271 6.58763 0.138
NP_441111.1_7 Forward -261 -253 18.7023 0.00294
NP_441111.1_7 Reverse -254 -262 18.7023 0.00294
NP_442379.1_10 Forward -269 -252 -4.18939 0.288
NP_441766.1_2 Forward -262 -253 17.5026 0.00297
NP_441766.1_2 Reverse -253 -262 17.5026 0.00297
NP_441766.1_9 Reverse -323 -342 -1.7705 0.272
NP_442417.1_5 Reverse -253 -267 9.14437 0.138
NP_440416.1_9 Forward -269 -250 -21.535 0.295
NP_443052.1_9 Forward -341 -322 -4.13045 0.254
NP_440072.1_5 Reverse -324 -342 6.80398 0.236
NP_440072.1_5 Reverse -321 -339 -3.91409 0.286
NP_442309.1_3 Reverse -125 -141 20.5114 0.142
NP_440845.1_1 Forward -145 -126 -3.83545 0.206
NP_442403.1_8 Reverse -249 -268 0.196116 0.241
NP_440591.1_9 Reverse -288 -306 8.18062 0.187
NP_440591.1_9 Reverse -321 -339 3.85406 0.295
NP_442154.1_1 Reverse -320 -338 -15.5171 0.22
NP_442154.1_1 Reverse -328 -346 -16.5988 0.243
NP_440261.1_5 Reverse -254 -267 -1.16069 0.0662
NP_440261.1_5 Forward -261 -248 -2.63565 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCATAACTTCAAATCCACCACCCAATGGCTAGCGGAAGAAACCATCGACCGTTTCCATCGTCCCCACGCCCCCACCGCCCAGGAACTAAAATGGGCCGCCATGACCCCAGCCCAACGGCAGGAACACCAAGGCATCAAGGCGATCGCCATCATTGCGCCCCTGATTTTTATCGTCCTGTTGTACCTTGGCTTCAAAACACCGGAAAGGGAAAGGGCTCCTTTCGTCCCCCAACCTAGCCCCGGTATGAATCGGTAGGGGGGTTAACCTATGGCCAATTACTTTTAATTTTTTATTAGTTTTTAAATTAGCTAAATTTGTATTTAAATCTGTTCTTGACCTGACCACACCGGCAACTATTAACTTCAGCCCCCAAACCCAACCACTTTGCGGAACCTGCCC

CDS

ATGTTCACCCTCAATGACCAAAATCTGCCCTACCCCGATACCCTCCATCCCATCATTGTCCACTTTGTCATTGGCATGGTTTTCTTTGCCTACATTAGTGAACTGGTGGGCTACCTCCAAAAAAAGCCTCGGTTCTTTGAAGTCGCTTGGTGGAATTGGCTCACAGCGGCGATCGCCATTTTTTTTGCAGTGATTTTTGGGGAATTTGAAGCGGCTCTAGCGATGCCCTACCCGGCGGCCCAACCGGCATTGGATTGGCACACGGTCAACGGCTGGTCATTGTCTGCCATTTTGGCAGGGTTAACGGCTTGGCGGGGAGTGTTGAGGGTGCGAAATCCGCTGAAAACCAGCCTGCCTTTCCTCATGCTAGCCACTGTATTTATGGTGTTAGTATGCATCCAAATCTTCCTTGGCTCCCTAGTGGATTGGGTTTATGGTCTGCACACCCTACCCGTAGTCCAAGCAACCAAAGACGGCATTATTCCCTAG

Protein

MFTLNDQNLPYPDTLHPIIVHFVIGMVFFAYISELVGYLQKKPRFFEVAWWNWLTAAIAIFFAVIFGEFEAALAMPYPAAQPALDWHTVNGWSLSAILAGLTAWRGVLRVRNPLKTSLPFLMLATVFMVLVCIQIFLGSLVDWVYGLHTLPVVQATKDGIIP