Your browser is old and dusty. Try Google Chrome!

Details for sll1483

ORF sll1483
Accession NP_442911.1
Symbol
Category periplasmic protein, similar to transforming growth factor induced protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -352 -366 9.34103 0.0754
NP_441061.1_2 Forward -165 -151 8.84938 0.083
NP_441061.1_2 Reverse -212 -226 8.35772 0.0913
NP_441061.1_2 Reverse -83 -97 -1.8687 0.274
NP_441061.1_2 Reverse -236 -250 -2.16369 0.285
NP_441061.1_2 Reverse -364 -378 -2.45868 0.293
NP_440557.1_1 Forward -165 -146 13.1758 0.0759
NP_440795.1_7 Forward -165 -158 14.6904 0.0123
NP_440795.1_7 Reverse -158 -165 14.6904 0.0123
NP_440795.1_10 Forward -300 -281 25.8596 0.00701
NP_442100.1_1 Forward -68 -49 5.77684 0.296
NP_441418.1_6 Forward -166 -147 -2.36049 0.0184
NP_441418.1_6 Reverse -157 -176 -12.0953 0.0601
NP_442291.1_5 Forward -36 -20 9.7933 0.0487
NP_442291.1_5 Forward -361 -345 6.74504 0.0689
NP_441453.1_4 Reverse -157 -165 16.539 0.00633
NP_441453.1_4 Forward -166 -158 16.539 0.00633
NP_441453.1_4 Reverse -351 -359 7.29591 0.0589
NP_441453.1_4 Forward -360 -352 6.70593 0.121
NP_441453.1_4 Reverse -26 -34 4.14932 0.264
NP_442151.1_6 Reverse -157 -171 17.6008 0.00997
NP_442151.1_6 Reverse -357 -371 12.0943 0.0818
NP_442151.1_6 Forward -166 -152 10.4227 0.123
NP_440561.1_5 Forward -294 -275 10.7175 0.278
NP_441818.1_1 Reverse -27 -38 10.0879 0.232
NP_441818.1_9 Reverse -245 -264 -5.60541 0.254
NP_441818.1_9 Forward -360 -341 -10.7186 0.298
NP_440226.1_1 Forward -360 -341 14.6508 0.0293
NP_440226.1_1 Forward -166 -147 10.1275 0.0654
NP_441630.1_3 Reverse -343 -362 -1.27885 0.296
NP_442623.1_3 Reverse -158 -177 -18.2901 0.263
NP_440150.1_2 Reverse -353 -372 13.8633 0.157
NP_440150.1_6 Reverse -126 -145 5.50599 0.229
NP_440150.1_6 Forward -169 -150 5.01433 0.231
NP_442744.1_8 Forward -166 -147 -6.1954 0.297
NP_442655.1_10 Forward -169 -150 -19.0768 0.282
NP_443002.1_5 Forward -390 -372 8.27817 0.297
NP_442173.1_1 Forward -165 -157 15.4574 0.00633
NP_442173.1_1 Reverse -158 -166 15.4574 0.00633
NP_442173.1_1 Forward -359 -351 7.59091 0.163
NP_442173.1_1 Reverse -352 -360 5.82095 0.2
NP_442752.1_4 Forward -360 -353 13.8055 0.0199
NP_442752.1_4 Forward -166 -159 13.8055 0.0199
NP_442752.1_4 Reverse -157 -164 13.8055 0.0199
NP_443027.1_4 Reverse -155 -165 14.828 0.0437
NP_443027.1_4 Forward -362 -352 10.9931 0.109
NP_443027.1_4 Forward -37 -27 7.94484 0.223
NP_443027.1_4 Forward -168 -158 6.46988 0.275
NP_443027.1_4 Reverse -349 -359 5.78156 0.298
NP_442975.1_10 Reverse -153 -167 5.50552 0.219
NP_442975.1_10 Forward -364 -350 2.16228 0.283
NP_442975.1_10 Reverse -347 -361 1.96562 0.288
NP_440784.1_7 Forward -165 -158 15.9687 0.0123
NP_440784.1_7 Reverse -158 -165 15.9687 0.0123
NP_440784.1_7 Reverse -352 -359 6.23397 0.241
NP_440784.1_7 Forward -359 -352 6.13563 0.241
NP_440061.1_9 Reverse -155 -169 19.1735 0.00631
NP_440110.1_8 Forward -168 -149 21.6323 0.0149
NP_439979.1_2 Forward -169 -150 6.09597 0.292
NP_442062.1_8 Forward -166 -156 19.4496 0.000558
NP_442062.1_8 Reverse -157 -167 17.6796 0.00193
NP_442062.1_8 Forward -360 -350 7.55152 0.0946
NP_442062.1_8 Reverse -351 -361 7.25653 0.104
NP_442062.1_8 Forward -152 -142 6.17489 0.136
NP_442062.1_8 Reverse -26 -36 3.91327 0.243
NP_442062.1_8 Forward -35 -25 3.22496 0.279
NP_440761.1_4 Forward -171 -152 -3.83545 0.132
NP_441859.1_3 Reverse -156 -175 23.2047 0.0135
NP_441859.1_3 Forward -373 -354 6.78348 0.171
NP_441859.1_3 Reverse -300 -319 4.12856 0.228
NP_440304.1_4 Forward -168 -158 17.9746 0.00654
NP_440304.1_4 Reverse -155 -165 10.8948 0.051
NP_440304.1_4 Forward -154 -144 6.66654 0.149
NP_442242.1_4 Forward -165 -158 14.3954 0.0124
NP_442242.1_4 Reverse -158 -165 14.3954 0.0124
NP_442242.1_4 Forward -359 -352 12.4288 0.0393
NP_440044.1_1 Reverse -278 -297 11.7992 0.251
NP_440044.1_8 Forward -34 -15 -3.73712 0.29
NP_441781.1_7 Reverse -357 -376 -1.57384 0.275
NP_441352.1_4 Forward -141 -122 11.7008 0.238
NP_441200.1_4 Forward -255 -236 6.88262 0.272
NP_441208.1_9 Forward -169 -155 15.0442 0.0896
NP_440370.1_10 Reverse -342 -361 7.96426 0.244
NP_440370.1_10 Forward -175 -156 7.66927 0.251
NP_442742.1_9 Forward -340 -321 -13.9635 0.289
NP_442110.1_7 Forward -166 -152 12.3893 0.0586
NP_442110.1_7 Reverse -157 -171 1.96621 0.222
NP_441491.1_6 Forward -294 -280 16.1487 0.204
NP_441925.1_4 Reverse -144 -163 -15.9309 0.275
NP_440014.1_6 Reverse -148 -167 6.39097 0.288
NP_440856.1_4 Forward -173 -154 1.0811 0.161
NP_440856.1_7 Forward -169 -150 -0.000545616 0.167
NP_441083.1_5 Reverse -157 -167 19.3512 0.000718
NP_441083.1_5 Forward -166 -156 11.3864 0.0159
NP_441083.1_5 Forward -360 -350 0.865012 0.218
NP_441083.1_5 Forward -138 -128 0.668351 0.22
NP_441083.1_5 Reverse -143 -153 -1.10161 0.295
NP_442827.1_8 Reverse -149 -168 11.995 0.05
NP_441434.1_7 Forward -33 -19 1.57289 0.299
NP_441738.1_2 Reverse -353 -360 15.28 0.0102
NP_441738.1_2 Forward -164 -157 15.28 0.0102
NP_441738.1_2 Reverse -159 -166 15.28 0.0102
NP_441558.1_5 Forward -168 -149 4.916 0.267
NP_440209.1_1 Reverse -157 -165 18.1123 0.00295
NP_440209.1_1 Forward -166 -158 18.1123 0.00295
NP_440209.1_1 Forward -360 -352 14.8674 0.012
NP_440209.1_1 Reverse -26 -34 5.0343 0.194
NP_442889.1_8 Forward -363 -349 7.86545 0.14
NP_440447.1_1 Reverse -152 -170 4.73903 0.223
NP_440447.1_6 Forward -174 -156 16.1454 0.0445
NP_441713.1_1 Forward -172 -153 6.29264 0.0568
NP_442675.1_4 Forward -237 -219 -6.56903 0.287
NP_440178.1_7 Forward -361 -342 1.57275 0.0202
NP_440178.1_7 Forward -167 -148 -22.9117 0.282
NP_442570.1_3 Forward -294 -275 -1.7705 0.212
NP_442570.1_3 Forward -253 -234 -4.13045 0.227
NP_442570.1_3 Forward -185 -166 -4.32711 0.23
NP_441025.1_6 Reverse -39 -58 10.342 0.15
NP_441716.1_1 Reverse -157 -171 17.5025 0.0264
NP_441716.1_1 Forward -166 -152 3.73617 0.259
NP_442111.1_4 Forward -167 -153 17.2075 0.0109
NP_442111.1_4 Reverse -156 -170 12.9793 0.0407
NP_442111.1_4 Reverse -350 -364 8.25939 0.0773
NP_441624.1_7 Reverse -211 -225 9.14437 0.223
NP_441163.1_1 Forward -338 -321 8.78956 0.226
NP_441163.1_1 Reverse -135 -152 4.85634 0.284
NP_441163.1_1 Reverse -356 -373 4.0697 0.294
NP_440906.1_5 Forward -165 -158 15.8704 0.0124
NP_440906.1_5 Reverse -158 -165 15.8704 0.0124
NP_440906.1_5 Forward -359 -352 12.0355 0.0724
NP_440906.1_5 Reverse -352 -359 12.0355 0.0724
NP_440747.1_10 Forward -169 -157 7.80712 0.00223
NP_440747.1_10 Reverse -154 -166 7.70879 0.00236
NP_440747.1_10 Reverse -348 -360 -11.9574 0.178
NP_440747.1_10 Reverse -181 -193 -12.0557 0.199
NP_440747.1_10 Reverse -214 -226 -12.2524 0.254
NP_441130.1_10 Reverse -155 -169 12.0943 0.1
NP_442973.1_5 Reverse -355 -374 9.93088 0.287
NP_441486.1_1 Reverse -348 -362 8.65272 0.0305
NP_441486.1_1 Reverse -154 -168 4.71948 0.0415
NP_441486.1_1 Forward -363 -349 2.35953 0.0844
NP_441486.1_1 Reverse -23 -37 1.17956 0.117
NP_441486.1_1 Forward -169 -155 -6.29359 0.288
NP_442634.1_4 Forward -168 -154 14.0609 0.0209
NP_442634.1_4 Reverse -155 -169 -2.95034 0.157
NP_442634.1_4 Reverse -362 -376 -3.54032 0.161
NP_442634.1_4 Forward -252 -238 -4.91696 0.223
NP_441265.1_3 Forward -172 -158 22.714 0.0117
NP_441265.1_3 Reverse -151 -165 2.94952 0.181
NP_440842.1_4 Forward -75 -56 18.6807 0.0205
NP_440842.1_4 Forward -65 -46 6.91914 0.133
NP_443017.1_1 Forward -64 -45 17.8767 0.147
NP_441014.1_5 Reverse -85 -103 10.4422 0.263
NP_441014.1_8 Reverse -126 -145 -4.13045 0.247
NP_441014.1_8 Forward -225 -206 -7.37537 0.278
NP_441014.1_8 Reverse -144 -163 -7.57203 0.28
NP_441014.1_10 Reverse -25 -44 8.25844 0.136
NP_441014.1_10 Forward -194 -175 0.392004 0.243
NP_442848.1_1 Reverse -345 -359 -4.13031 0.282
NP_442848.1_1 Reverse -351 -365 -4.52363 0.294
NP_441012.1_4 Reverse -213 -226 8.86907 0.272
NP_441012.1_4 Forward -224 -211 7.29578 0.272
NP_441012.1_4 Reverse -153 -166 7.19745 0.272
NP_443018.1_3 Forward -165 -158 14.8871 0.0123
NP_443018.1_3 Reverse -158 -165 14.8871 0.0123
NP_443018.1_3 Forward -34 -27 11.5438 0.0752
NP_443018.1_3 Forward -359 -352 5.34899 0.212
NP_443018.1_3 Reverse -352 -359 5.34899 0.212
NP_441316.1_7 Reverse -155 -170 6.46974 0.107
NP_440376.1_1 Forward -166 -157 19.4693 0.000692
NP_440376.1_1 Reverse -157 -166 19.4693 0.000692
NP_440376.1_1 Forward -152 -143 4.42462 0.159
NP_440376.1_1 Forward -245 -236 1.76968 0.242
NP_440376.1_1 Forward -104 -95 1.08137 0.258
NP_440376.1_1 Reverse -351 -360 -0.000272808 0.285
NP_440376.1_1 Forward -360 -351 -0.0986038 0.285
NP_441857.1_5 Forward -173 -155 8.96727 0.185
NP_442730.1_8 Reverse -149 -168 4.22689 0.273
NP_442687.1_7 Forward -167 -157 18.5646 0.0028
NP_442687.1_7 Reverse -156 -166 15.8113 0.0125
NP_442687.1_7 Forward -361 -351 13.2547 0.0562
NP_442687.1_7 Reverse -142 -152 10.5998 0.0994
NP_442191.1_4 Forward -165 -151 17.5862 0.0182
NP_442191.1_4 Reverse -364 -378 11.3809 0.262
NP_441077.1_6 Reverse -294 -310 2.22343 0.288
NP_441846.1_10 Forward -167 -148 -23.5016 0.289
NP_442958.1_3 Forward -102 -83 -1.47551 0.277
NP_441013.1_2 Forward -225 -207 -1.45582 0.282
NP_441013.1_2 Reverse -152 -170 -2.93078 0.287
NP_440042.1_2 Forward -176 -157 -5.01543 0.296
NP_441080.1_6 Forward -303 -287 19.9785 0.124
NP_441422.1_7 Reverse -155 -172 -9.00761 0.289
NP_440533.1_9 Reverse -157 -176 14.5524 0.0753
NP_440533.1_9 Forward -166 -147 8.65258 0.162
NP_440360.1_9 Reverse -46 -65 14.9458 0.201
NP_442658.1_1 Forward -168 -158 17.6791 0.00565
NP_442658.1_1 Reverse -155 -165 15.9091 0.00966
NP_442658.1_1 Reverse -141 -151 10.206 0.128
NP_442658.1_1 Reverse -234 -244 8.73102 0.181
NP_442658.1_1 Forward -362 -352 6.0761 0.238
NP_440141.1_4 Forward -229 -210 -6.98204 0.298
NP_440141.1_4 Forward -163 -144 -11.1119 0.298
NP_440617.1_3 Forward -174 -155 3.6377 0.261
NP_442782.1_2 Reverse -236 -250 10.226 0.179
NP_442782.1_2 Forward -166 -152 7.57108 0.202
NP_442782.1_2 Reverse -364 -378 6.48943 0.223
NP_442782.1_2 Forward -250 -236 4.32615 0.256
NP_442544.1_6 Forward -367 -348 -4.6221 0.25
NP_441414.1_9 Reverse -157 -176 -7.08038 0.211
NP_440184.1_10 Forward -69 -50 15.5349 0.171
NP_440607.1_9 Reverse -207 -226 16.5067 0.254
NP_441487.1_6 Reverse -149 -168 1.0811 0.254
NP_441487.1_9 Reverse -84 -103 -2.45882 0.293
NP_441256.1_2 Reverse -242 -261 8.65258 0.198
NP_442937.1_5 Reverse -212 -231 10.7175 0.154
NP_442937.1_5 Reverse -218 -237 9.43923 0.192
NP_441958.1_5 Forward -167 -157 20.5312 0.000966
NP_441958.1_5 Reverse -156 -166 12.2714 0.00183
NP_441958.1_5 Forward -361 -351 1.455 0.0956
NP_440203.1_5 Reverse -160 -170 13.6475 0.112
NP_440269.1_2 Reverse -59 -73 14.1593 0.281
NP_442816.1_5 Reverse -236 -255 13.0775 0.2
NP_439990.1_5 Forward -171 -158 13.1956 0.102
NP_442376.1_2 Reverse -152 -171 -5.40875 0.286
NP_442376.1_2 Forward -171 -152 -11.7019 0.286
NP_442690.1_1 Reverse -49 -68 -2.45882 0.137
NP_442911.1_1 Forward -75 -62 18.2052 0.159
NP_442911.1_2 Forward -176 -157 24.6805 0.00397
NP_442911.1_2 Reverse -147 -166 5.89931 0.0311
NP_442911.1_2 Forward -370 -351 -6.39206 0.182
NP_442911.1_3 Forward -309 -291 21.357 0.157
NP_440153.1_5 Forward -151 -137 1.96621 0.241
NP_440153.1_5 Forward -165 -151 1.76955 0.245
NP_440153.1_8 Forward -256 -243 -2.73398 0.256
NP_442064.1_4 Forward -230 -211 7.27514 0.242
NP_442064.1_4 Forward -203 -184 4.91521 0.283
NP_443055.1_3 Forward -381 -362 11.8865 0.24
NP_443055.1_3 Reverse -175 -194 10.4542 0.289
NP_443055.1_6 Reverse -143 -161 1.98502 0.222
NP_440993.1_2 Reverse -152 -168 12.1532 0.0735
NP_440993.1_3 Forward -176 -157 13.3716 0.0664
NP_440169.1_3 Reverse -84 -103 20.2556 0.0843
NP_440062.1_6 Forward -146 -127 2.65439 0.258
NP_440602.1_8 Forward -360 -346 10.521 0.269
NP_440138.1_6 Reverse -185 -204 6.29183 0.227
NP_441099.1_3 Forward -290 -271 2.26107 0.279
NP_441099.1_5 Forward -176 -157 10.3242 0.0295
NP_441099.1_5 Forward -263 -244 -11.8986 0.291
NP_442002.1_9 Forward -167 -160 14.1004 0.074
NP_442002.1_9 Reverse -235 -242 12.2322 0.185
NP_442002.1_9 Forward -361 -354 10.7572 0.185
NP_442002.1_9 Reverse -156 -163 10.7572 0.185
NP_440809.1_9 Forward -175 -157 -7.84733 0.225
NP_441294.1_7 Reverse -139 -153 11.3624 0.147
NP_442438.1_10 Reverse -152 -166 19.0758 0.0137
NP_442438.1_10 Forward -171 -157 2.75286 0.168
NP_442438.1_10 Forward -365 -351 1.37622 0.197
NP_441000.1_6 Reverse -102 -116 0.294584 0.196
NP_441000.1_6 Forward -167 -153 -3.04867 0.221
NP_441000.1_6 Forward -153 -139 -3.83532 0.225
NP_442771.1_1 Forward -168 -150 22.0453 0.00283
NP_442771.1_1 Reverse -349 -367 -4.70074 0.166
NP_442771.1_1 Reverse -155 -173 -6.86402 0.169
NP_441674.1_6 Forward -269 -250 3.6377 0.264
NP_440147.1_4 Reverse -155 -168 13.0973 0.0326
NP_440147.1_4 Forward -168 -155 2.67422 0.203
NP_441175.1_2 Forward -295 -276 5.80098 0.276
NP_441550.1_8 Forward -168 -158 19.8424 0.00352
NP_441550.1_8 Reverse -155 -165 6.0761 0.214
NP_441550.1_8 Forward -154 -144 5.28945 0.255
NP_441916.1_7 Forward -166 -156 18.4663 0.00144
NP_441916.1_7 Reverse -157 -167 16.893 0.00407
NP_441916.1_7 Reverse -351 -361 9.61647 0.0333
NP_440206.1_4 Reverse -207 -226 0.588665 0.289
NP_441041.1_4 Reverse -358 -377 -1.47551 0.1
NP_441041.1_4 Forward -166 -147 -6.98204 0.179
NP_441041.1_4 Reverse -157 -176 -7.76869 0.192
NP_441041.1_4 Forward -145 -126 -9.63698 0.219
NP_441041.1_7 Forward -169 -157 18.593 0.00508
NP_441041.1_7 Reverse -154 -166 7.61196 0.162
NP_441041.1_7 Reverse -233 -245 6.44582 0.21
NP_440569.1_7 Forward -232 -213 9.63589 0.286
NP_442996.1_7 Reverse -37 -56 16.368 0.216
NP_442004.1_6 Reverse -157 -171 6.3911 0.174
NP_441725.1_5 Reverse -158 -168 18.7612 0.0119
NP_441725.1_5 Forward -165 -155 11.2881 0.0247
NP_441725.1_5 Reverse -352 -362 1.55333 0.133
NP_441725.1_5 Reverse -144 -154 -0.216628 0.241
NP_439966.1_7 Reverse -155 -165 18.4657 0.00473
NP_439966.1_7 Reverse -24 -34 9.41933 0.113
NP_439966.1_7 Forward -362 -352 8.63269 0.132
NP_439966.1_7 Forward -168 -158 8.14104 0.14
NP_439966.1_7 Reverse -141 -151 5.48612 0.22
NP_439966.1_9 Forward -362 -353 0.983037 0.253
NP_439966.1_9 Forward -168 -159 0.983037 0.253
NP_439966.1_9 Reverse -155 -164 0.983037 0.253
NP_442941.1_3 Forward -165 -155 11.4848 0.0116
NP_442941.1_3 Forward -359 -349 7.55152 0.0711
NP_442941.1_3 Reverse -158 -168 2.43831 0.14
NP_442941.1_3 Reverse -352 -362 1.74999 0.147
NP_442941.1_3 Forward -34 -24 -0.216628 0.252
NP_440289.1_1 Reverse -286 -303 17.3814 0.229
NP_440289.1_2 Reverse -154 -167 14.6706 0.0107
NP_440289.1_2 Forward -169 -156 4.73917 0.0649
NP_440983.1_5 Forward -232 -213 1.17943 0.214
NP_440983.1_9 Forward -254 -235 1.37609 0.292
NP_441678.1_9 Reverse -235 -254 0.884433 0.223
NP_442281.1_1 Reverse -152 -166 19.7634 0.00247
NP_442281.1_1 Forward -40 -26 10.422 0.0589
NP_442281.1_1 Forward -171 -157 10.3237 0.0595
NP_442281.1_1 Reverse -346 -360 8.45543 0.0808
NP_442281.1_1 Reverse -179 -193 1.76896 0.29
NP_441334.1_7 Forward -168 -149 -2.26216 0.0707
NP_442256.1_2 Forward -168 -150 -5.97904 0.214
NP_440437.1_1 Reverse -151 -170 9.73422 0.049
NP_442012.1_1 Reverse -151 -170 13.3725 0.058
NP_442012.1_1 Forward -172 -153 7.47261 0.111
NP_441087.1_6 Reverse -125 -143 -1.35821 0.264
NP_441556.1_10 Forward -171 -157 9.54046 0.298
NP_440498.1_1 Reverse -148 -166 1.69077 0.204
NP_442982.1_5 Reverse -147 -166 8.84924 0.12
NP_443030.1_1 Reverse -55 -72 8.29864 0.261
NP_441644.1_6 Reverse -157 -167 15.7125 0.0048
NP_441644.1_6 Forward -166 -156 10.1076 0.0628
NP_441644.1_6 Reverse -241 -251 6.96107 0.141
NP_441644.1_6 Reverse -217 -227 6.96107 0.141
NP_441644.1_6 Forward -35 -25 3.71617 0.267
NP_441644.1_6 Forward -360 -350 3.61784 0.272
NP_442501.1_10 Forward -153 -134 10.1275 0.283
NP_442215.1_2 Forward -168 -152 4.97508 0.0812
NP_442215.1_2 Forward -229 -213 -0.0397962 0.159
NP_442215.1_2 Reverse -155 -171 -0.236458 0.164
NP_442215.1_2 Forward -195 -179 -6.62797 0.277
NP_442177.1_5 Forward -289 -275 9.63603 0.239
NP_442029.1_6 Forward -171 -152 2.94938 0.286
NP_442247.1_5 Forward -59 -45 15.0597 0.234
NP_440253.1_2 Forward -91 -73 -0.669169 0.218
NP_440253.1_2 Reverse -26 -44 -1.94747 0.254
NP_440253.1_2 Forward -214 -196 -3.32411 0.291
NP_440929.1_8 Forward -166 -157 19.2726 0.000701
NP_440929.1_8 Reverse -157 -166 19.2726 0.000701
NP_442933.1_10 Forward -166 -157 17.601 0.00325
NP_442933.1_10 Reverse -157 -166 17.601 0.00325
NP_442933.1_10 Forward -360 -351 13.9627 0.0192
NP_442933.1_10 Reverse -351 -360 8.1612 0.0885
NP_442933.1_10 Reverse -26 -35 5.3096 0.203
NP_442933.1_10 Forward -35 -26 4.62128 0.227
NP_441751.2_8 Reverse -158 -172 4.22782 0.0521
NP_441751.2_8 Forward -34 -20 -5.80194 0.239
NP_442554.1_4 Reverse -285 -304 10.5209 0.277
NP_442554.1_8 Reverse -158 -168 16.9913 0.0065
NP_442554.1_8 Forward -165 -155 13.8447 0.0145
NP_442554.1_8 Forward -34 -24 5.68323 0.141
NP_442554.1_8 Reverse -352 -362 4.10993 0.198
NP_442554.1_8 Forward -372 -362 3.71661 0.215
NP_442554.1_8 Reverse -212 -222 2.14332 0.281
NP_441762.1_7 Reverse -156 -168 11.7404 0.0142
NP_441762.1_7 Forward -167 -155 11.4454 0.0142
NP_441762.1_7 Reverse -350 -362 -5.07423 0.187
NP_441762.1_7 Forward -153 -141 -5.76255 0.238
NP_442142.1_4 Forward -169 -156 15.7516 0.0264
NP_442142.1_4 Forward -223 -210 11.8184 0.0518
NP_442142.1_4 Reverse -154 -167 10.4418 0.0724
NP_442142.1_4 Reverse -348 -361 10.1468 0.079
NP_442142.1_4 Forward -196 -183 2.772 0.278
NP_442142.1_4 Reverse -244 -257 2.28034 0.295
NP_442292.1_1 Forward -165 -156 9.63616 0.0183
NP_442292.1_1 Reverse -158 -167 9.53783 0.0183
NP_442292.1_1 Reverse -352 -361 -0.0986038 0.239
NP_442292.1_1 Forward -359 -350 -0.295266 0.24
NP_442476.1_6 Reverse -158 -172 3.14618 0.161
NP_442381.1_8 Forward -169 -150 -14.0619 0.28
NP_441523.1_6 Reverse -153 -172 3.93269 0.261
NP_443009.1_5 Forward -167 -156 20.6093 0.001
NP_443009.1_5 Reverse -350 -361 11.3662 0.066
NP_443009.1_5 Reverse -156 -167 9.10461 0.0965
NP_442408.2_1 Forward -166 -147 -5.11376 0.267
NP_441715.1_4 Forward -165 -155 16.303 0.0117
NP_441715.1_4 Reverse -352 -362 6.56821 0.138
NP_440357.1_6 Forward -268 -249 4.81767 0.279
NP_440881.1_1 Forward -237 -218 9.43923 0.151
NP_440279.1_2 Forward -204 -185 4.52268 0.298
NP_441613.1_1 Reverse -236 -255 12.6841 0.289
NP_440158.1_1 Forward -63 -44 21.915 0.0124
NP_441198.1_8 Forward -168 -158 15.2245 0.0427
NP_440379.1_5 Reverse -202 -221 7.86593 0.133
NP_441468.1_1 Forward -165 -158 15.8704 0.0124
NP_441468.1_1 Reverse -158 -165 15.8704 0.0124
NP_441468.1_1 Reverse -352 -359 6.13563 0.209
NP_441468.1_1 Forward -359 -352 6.0373 0.223
NP_441468.1_1 Forward -34 -27 4.07068 0.263
NP_441618.1_6 Reverse -358 -377 12.0942 0.3
NP_441020.2_6 Forward -168 -151 22.36 0.00186
NP_441015.1_10 Forward -171 -152 4.62101 0.125
NP_441015.1_10 Reverse -218 -237 -2.85214 0.183
NP_441673.1_1 Forward -166 -157 20.8459 0.000698
NP_441673.1_1 Reverse -157 -166 20.8459 0.000698
NP_441673.1_1 Reverse -351 -360 1.37636 0.114
NP_441673.1_1 Forward -360 -351 1.1797 0.163
NP_441826.1_2 Reverse -151 -165 13.5693 0.0214
NP_441826.1_2 Forward -172 -158 5.21113 0.0978
NP_441826.1_2 Forward -226 -212 0.982901 0.167
NP_441826.1_2 Reverse -20 -34 0.196253 0.194
NP_441826.1_2 Reverse -351 -365 -2.06536 0.264
NP_441826.1_2 Forward -366 -352 -4.81863 0.3
NP_441330.1_1 Reverse -346 -365 -11.8986 0.183
NP_442490.1_9 Forward -372 -353 5.11266 0.165
NP_442490.1_9 Forward -178 -159 -6.98204 0.275
NP_441764.1_1 Reverse -48 -67 13.6675 0.116
NP_441764.1_1 Reverse -58 -77 8.06259 0.28
NP_441764.1_4 Reverse -56 -73 14.7562 0.131
NP_442868.1_6 Forward -168 -158 16.7946 0.0131
NP_442868.1_6 Reverse -234 -244 2.33998 0.205
NP_442868.1_6 Reverse -155 -165 0.963343 0.205
NP_442868.1_6 Reverse -24 -34 -0.216628 0.273
NP_442227.1_2 Reverse -150 -169 0.786102 0.252
NP_442361.1_3 Reverse -151 -164 18.9972 0.0363
NP_442808.1_1 Reverse -156 -166 18.4657 0.00201
NP_442808.1_1 Forward -167 -157 8.73102 0.0481
NP_442808.1_1 Reverse -142 -152 8.04271 0.0597
NP_442808.1_1 Forward -380 -370 4.40448 0.199
NP_442692.1_1 Forward -176 -157 -4.6221 0.274
NP_442692.1_1 Reverse -119 -138 -5.70374 0.276
NP_440145.1_3 Reverse -174 -193 -3.83545 0.212
NP_442718.1_1 Reverse -364 -383 10.2259 0.146
NP_442542.1_2 Forward -168 -155 13.9823 0.114
NP_442542.1_9 Reverse -150 -164 9.43874 0.135
NP_442050.1_5 Forward -168 -158 14.9258 0.0175
NP_442050.1_5 Reverse -155 -165 9.12434 0.193
NP_442342.1_9 Reverse -155 -171 6.74504 0.217
NP_442342.1_9 Forward -168 -152 5.27008 0.241
NP_441114.1_3 Reverse -185 -194 6.39124 0.277
NP_440558.1_2 Reverse -360 -379 -1.7705 0.218
NP_440558.1_2 Forward -376 -357 -6.78538 0.28
NP_442789.1_4 Forward -168 -149 5.211 0.145
NP_441878.1_6 Forward -167 -157 20.2362 0.0046
NP_441878.1_6 Reverse -156 -166 10.4031 0.0176
NP_441878.1_6 Reverse -210 -220 -0.0199663 0.163
NP_441878.1_6 Forward -153 -143 -6.70647 0.194
NP_441878.1_6 Reverse -183 -193 -7.59145 0.245
NP_441036.1_8 Reverse -156 -166 17.7779 0.000554
NP_441036.1_8 Forward -167 -157 8.4365 0.174
NP_441036.1_8 Reverse -350 -360 6.46988 0.229
NP_441557.1_5 Forward -166 -157 19.9609 0.000699
NP_441557.1_5 Reverse -157 -166 19.9609 0.000699
NP_441557.1_5 Forward -360 -351 8.84951 0.0343
NP_441557.1_5 Reverse -351 -360 0.786375 0.106
NP_441557.1_5 Reverse -26 -35 -0.983583 0.272
NP_441520.1_4 Reverse -351 -370 17.619 0.234
NP_441445.1_1 Forward -175 -156 4.42435 0.195
NP_441445.1_1 Reverse -175 -194 0.0977854 0.283
NP_441445.1_10 Forward -321 -302 13.9625 0.277
NP_441590.1_3 Forward -147 -128 8.94757 0.238
NP_442066.2_4 Reverse -76 -95 -8.06369 0.293
NP_441433.1_8 Reverse -212 -231 -3.54046 0.283
NP_440084.1_8 Reverse -44 -58 10.0383 0.271
NP_440084.1_8 Reverse -45 -59 9.17885 0.29
NP_440738.1_5 Reverse -66 -85 5.30933 0.246
NP_441308.1_8 Reverse -155 -165 10.1081 0.22
NP_440101.1_3 Forward -171 -152 5.60432 0.192
NP_440101.1_3 Reverse -251 -270 5.11266 0.202
NP_440101.1_5 Reverse -150 -169 13.4708 0.125
NP_441458.1_10 Forward -369 -350 2.3594 0.269
NP_442183.1_1 Forward -166 -152 9.93102 0.0903
NP_442183.1_1 Reverse -157 -171 8.25939 0.119
NP_442183.1_1 Reverse -351 -365 8.16106 0.121
NP_442397.1_9 Reverse -205 -224 1.0811 0.295
NP_441819.1_5 Reverse -49 -68 8.35512 0.295
NP_441574.1_1 Forward -372 -353 -6.49039 0.277
NP_441549.1_9 Forward -170 -152 -7.65067 0.209
NP_442347.1_2 Forward -165 -156 11.1111 0.056
NP_442347.1_2 Reverse -158 -167 3.34298 0.284
NP_441037.1_4 Forward -168 -158 18.9151 0.00351
NP_441037.1_4 Reverse -155 -165 7.02532 0.237
NP_441037.1_4 Reverse -234 -244 6.05075 0.283
NP_441037.1_4 Forward -362 -352 5.95329 0.289
NP_441633.1_3 Reverse -155 -168 15.4572 0.0103
NP_441633.1_3 Reverse -141 -154 7.09911 0.0481
NP_441633.1_3 Forward -168 -155 -5.88057 0.236
NP_440136.1_2 Forward -165 -158 15.9687 0.0123
NP_440136.1_2 Reverse -158 -165 15.9687 0.0123
NP_440136.1_2 Reverse -352 -359 6.23397 0.171
NP_440136.1_2 Forward -359 -352 6.13563 0.193
NP_442590.1_10 Reverse -351 -370 7.7676 0.219
NP_442590.1_10 Reverse -151 -170 5.40766 0.26
NP_442590.1_10 Reverse -357 -376 3.14605 0.295
NP_442998.1_5 Reverse -234 -244 8.23984 0.267
NP_442998.1_10 Reverse -353 -360 15.5754 0.0102
NP_442998.1_10 Forward -164 -157 15.5754 0.0102
NP_442998.1_10 Reverse -159 -166 15.5754 0.0102
NP_440899.1_2 Reverse -146 -165 5.50519 0.28
NP_440299.1_1 Reverse -153 -166 20.1765 0.00128
NP_440299.1_1 Forward -170 -157 18.6032 0.00369
NP_440299.1_1 Forward -364 -351 16.8333 0.00835
NP_441799.1_1 Forward -170 -156 9.14375 0.0988
NP_441799.1_1 Reverse -297 -311 3.73557 0.284
NP_441007.1_10 Forward -171 -158 2.18257 0.195
NP_442201.1_10 Reverse -132 -151 0.491109 0.125
NP_442201.1_10 Reverse -146 -165 -14.0619 0.28
NP_442333.2_5 Forward -383 -364 -1.57384 0.214
NP_442333.2_5 Reverse -353 -372 -9.047 0.246
NP_442333.2_5 Reverse -146 -165 -13.2752 0.255
NP_440256.1_1 Forward -376 -357 1.67108 0.0729
NP_440256.1_1 Reverse -348 -367 1.67108 0.0729
NP_440256.1_1 Forward -169 -150 -5.11376 0.174
NP_440256.1_1 Reverse -23 -42 -8.06369 0.251
NP_440256.1_1 Reverse -360 -379 -9.34199 0.278
NP_441362.1_2 Reverse -64 -83 15.7972 0.143
NP_443042.1_5 Forward -35 -16 14.6487 0.219
NP_440709.1_1 Forward -67 -48 13.47 0.045
NP_440709.1_1 Forward -77 -58 3.9319 0.205
NP_440521.1_5 Reverse -362 -380 16.8337 0.27
NP_441559.1_8 Forward -171 -157 2.85119 0.143
NP_441559.1_8 Reverse -152 -166 2.45787 0.143
NP_441559.1_8 Forward -250 -236 -1.5737 0.184
NP_441559.1_8 Forward -249 -235 -4.62196 0.231
NP_440915.1_6 Forward -170 -156 15.2409 0.0183
NP_440915.1_6 Reverse -153 -167 13.4709 0.0187
NP_440915.1_6 Reverse -232 -246 1.47456 0.138
NP_441704.1_8 Forward -177 -158 8.84842 0.202
NP_442866.1_1 Forward -315 -296 5.01433 0.14
NP_442866.1_1 Forward -378 -359 -5.31042 0.24
NP_440657.1_3 Forward -230 -213 8.10198 0.161
NP_441464.1_1 Reverse -143 -162 11.5042 0.24
NP_441113.1_3 Reverse -292 -306 16.0269 0.235
NP_441199.1_6 Reverse -153 -172 17.2074 0.0257
NP_441494.1_6 Forward -171 -158 10.8357 0.225
NP_442993.1_1 Forward -250 -234 -4.36636 0.138
NP_442993.1_1 Forward -166 -150 -6.92296 0.146
NP_442993.1_1 Forward -309 -293 -10.6595 0.224
NP_440677.1_1 Forward -175 -156 10.7175 0.163
NP_442386.1_9 Reverse -156 -165 15.7322 0.0144
NP_442386.1_9 Reverse -142 -151 11.8973 0.0799
NP_442386.1_9 Forward -167 -158 6.39082 0.219
NP_442386.1_9 Forward -361 -352 5.89917 0.233
NP_442386.1_9 Reverse -350 -359 5.21086 0.262
NP_440570.1_5 Reverse -284 -303 -0.4922 0.262
NP_440570.1_5 Forward -254 -235 -2.36049 0.278
NP_440570.1_5 Forward -170 -151 -3.44213 0.289
NP_441750.1_4 Reverse -139 -158 8.06259 0.159
NP_441340.1_5 Forward -165 -158 15.6737 0.0124
NP_441340.1_5 Reverse -158 -165 15.6737 0.0124
NP_441340.1_5 Forward -359 -352 6.13563 0.175
NP_441340.1_5 Reverse -352 -359 5.93897 0.198
NP_441340.1_9 Forward -14 -4 8.15881 0.256
NP_441271.1_1 Forward -172 -154 16.0463 0.202
NP_441271.1_2 Forward -145 -126 18.7807 0.206
NP_442327.1_3 Reverse -38 -57 5.39487 0.279
NP_441676.1_9 Reverse -331 -348 12.4278 0.253
NP_442506.1_1 Forward -138 -119 32.3503 0.0000466
NP_442506.1_2 Forward -384 -365 26.6471 0.00354
NP_442506.1_8 Forward -339 -320 25.417 0.00849
NP_442240.1_2 Forward -165 -146 -4.42544 0.0843
NP_441160.1_10 Forward -225 -207 9.45892 0.279
NP_440586.1_1 Forward -173 -154 -0.000545616 0.237
NP_440586.1_1 Reverse -246 -265 -1.37718 0.237
NP_440586.1_8 Forward -165 -158 13.2151 0.026
NP_440586.1_8 Reverse -158 -165 13.2151 0.026
NP_440586.1_8 Forward -359 -352 11.4451 0.0645
NP_440586.1_8 Forward -34 -27 10.9535 0.119
NP_442251.1_6 Forward -165 -158 15.2804 0.0124
NP_442251.1_6 Reverse -158 -165 15.2804 0.0124
NP_442251.1_6 Reverse -352 -359 12.0355 0.0627
NP_440684.1_9 Forward -366 -352 13.6676 0.155
NP_441262.1_3 Reverse -157 -164 14.7888 0.0223
NP_441262.1_3 Forward -360 -353 14.7888 0.0223
NP_441262.1_3 Forward -166 -159 14.7888 0.0223
NP_440027.1_3 Forward -265 -247 6.1149 0.23
NP_440027.1_3 Reverse -147 -165 5.32826 0.245
NP_443051.1_1 Forward -167 -158 18.0926 0.00402
NP_443051.1_1 Reverse -156 -165 10.4228 0.00754
NP_443051.1_1 Forward -361 -352 0.786375 0.125
NP_439937.1_8 Reverse -155 -174 -4.32711 0.283
NP_439937.1_9 Reverse -156 -173 20.0976 0.00778
NP_442294.1_3 Forward -306 -292 17.0102 0.141
NP_442294.1_3 Forward -87 -73 12.2903 0.29
NP_440408.1_7 Forward -373 -354 8.06259 0.282
NP_440408.1_7 Forward -262 -243 7.7676 0.284
NP_440439.1_1 Reverse -154 -167 17.5222 0.0105
NP_440439.1_1 Forward -169 -156 8.67241 0.0513
NP_440372.1_2 Forward -165 -158 16.3621 0.0124
NP_440372.1_2 Reverse -158 -165 16.3621 0.0124
NP_440372.1_2 Forward -359 -352 6.72562 0.0929
NP_440372.1_2 Reverse -352 -359 6.62729 0.151
NP_440316.1_10 Forward -221 -211 5.38824 0.299
NP_441803.1_2 Reverse -152 -171 17.404 0.0309
NP_441803.1_2 Reverse -352 -371 5.30933 0.17
NP_439977.1_5 Reverse -151 -170 7.57094 0.117
NP_439977.1_5 Forward -172 -153 5.30933 0.15
NP_439977.1_5 Reverse -357 -376 -2.85214 0.29
NP_441616.1_9 Forward -153 -134 18.6823 0.27
NP_440139.1_1 Reverse -151 -170 5.01354 0.168
NP_441572.1_1 Reverse -245 -264 -6.1954 0.278
NP_441572.1_7 Forward -172 -153 7.27595 0.0771
NP_441572.1_7 Reverse -151 -170 0.392778 0.168
NP_442384.1_10 Forward -166 -153 15.7522 0.00946
NP_442384.1_10 Reverse -351 -364 12.114 0.0304
NP_442384.1_10 Reverse -157 -170 11.9173 0.0319
NP_442384.1_10 Reverse -205 -218 3.26421 0.197
NP_442384.1_10 Forward -35 -22 1.49425 0.257
NP_442114.1_4 Reverse -351 -362 7.1385 0.295
NP_441018.1_7 Forward -348 -329 6.39097 0.289
NP_442790.1_4 Forward -319 -300 -12.7836 0.253
NP_442790.1_4 Forward -369 -350 -13.8652 0.268
NP_442262.1_10 Forward -165 -158 14.1988 0.0123
NP_442262.1_10 Reverse -158 -165 14.1988 0.0123
NP_442262.1_10 Forward -34 -27 11.7405 0.0841
NP_441689.1_5 Reverse -155 -165 8.53436 0.132
NP_441689.1_5 Reverse -349 -359 8.3377 0.132
NP_440163.1_10 Reverse -154 -164 16.303 0.0762
NP_440163.1_10 Forward -363 -353 14.238 0.102
NP_440163.1_10 Forward -223 -213 9.51814 0.232
NP_440163.1_10 Forward -38 -28 9.51814 0.232
NP_440344.1_10 Forward -173 -156 16.4601 0.00372
NP_440344.1_10 Reverse -150 -167 -6.746 0.114
NP_440344.1_10 Forward -367 -350 -6.84433 0.115
NP_440282.1_10 Forward -383 -364 11.6025 0.0802
NP_440282.1_10 Forward -266 -247 -4.13045 0.25
NP_440189.1_2 Reverse -356 -375 0.196116 0.279
NP_440487.1_1 Forward -169 -150 14.1591 0.0614
NP_440562.1_3 Reverse -158 -175 5.05372 0.175
NP_441965.1_3 Forward -176 -157 4.03102 0.178
NP_441965.1_10 Reverse -208 -224 3.40179 0.265
NP_440297.1_9 Reverse -158 -168 9.51814 0.0917
NP_440297.1_9 Forward -165 -155 9.32148 0.0917
NP_440297.1_9 Reverse -206 -216 3.81494 0.26
NP_440297.1_9 Reverse -212 -222 -0.216628 0.282
NP_440297.1_9 Reverse -352 -362 -0.41329 0.283
NP_441592.1_4 Forward -35 -16 -3.63879 0.286
NP_441896.1_1 Forward -75 -56 8.35677 0.258
NP_441896.1_5 Forward -286 -279 12.2322 0.273
NP_440894.1_10 Forward -171 -152 18.3873 0.0535
NP_440894.1_10 Reverse -152 -171 6.29264 0.217
NP_442078.1_3 Reverse -284 -303 2.85027 0.201
NP_442078.1_3 Reverse -283 -302 -1.27961 0.277
NP_442067.1_4 Reverse -146 -165 19.5673 0.0245
NP_440999.1_2 Forward -365 -346 10.5209 0.245
NP_440999.1_9 Reverse -153 -167 10.9143 0.0483
NP_440999.1_9 Forward -170 -156 3.93283 0.12
NP_440999.1_9 Forward -314 -300 0.0979218 0.193
NP_440999.1_9 Reverse -139 -153 -2.85201 0.279
NP_440888.1_2 Forward -166 -152 17.6002 0.00354
NP_440888.1_2 Reverse -157 -171 9.14375 0.137
NP_440888.1_2 Reverse -351 -365 7.17714 0.205
NP_440888.1_2 Forward -152 -138 5.01387 0.298
NP_440600.1_1 Forward -74 -55 19.0502 0.0949
NP_440600.1_1 Forward -64 -45 12.4613 0.29
NP_440491.1_1 Forward -169 -150 17.15 0.0567
NP_439969.1_3 Forward -171 -152 -1.08219 0.271
NP_439969.1_3 Reverse -152 -171 -1.57384 0.279
NP_442948.1_2 Reverse -156 -175 3.53937 0.283
NP_442277.1_4 Reverse -134 -153 7.57013 0.144
NP_442033.1_10 Reverse -155 -174 1.57275 0.0882
NP_442033.1_10 Forward -168 -149 -5.99873 0.182
NP_442807.1_10 Reverse -58 -72 13.0776 0.246
NP_441543.1_2 Forward -165 -156 18.486 0.00236
NP_441543.1_2 Reverse -158 -167 9.34117 0.0818
NP_441543.1_2 Reverse -352 -361 8.75118 0.0968
NP_441543.1_2 Forward -34 -25 5.50626 0.197
NP_441543.1_2 Forward -359 -350 4.42462 0.246
NP_442845.1_2 Forward -166 -152 7.47274 0.195
NP_442845.1_2 Reverse -205 -219 3.8345 0.275
NP_441551.1_5 Reverse -153 -169 7.43266 0.247
NP_441319.1_5 Reverse -158 -177 9.93088 0.265
NP_441319.1_8 Reverse -151 -169 7.00065 0.266
NP_442710.1_7 Reverse -41 -60 0.0816015 0.194
NP_442710.1_7 Reverse -51 -70 -5.97332 0.294
NP_442710.1_7 Forward -58 -39 -7.89551 0.299
NP_441469.1_8 Reverse -156 -165 16.126 0.00797
NP_441469.1_8 Forward -167 -158 13.3727 0.073
NP_441469.1_8 Forward -361 -352 6.29291 0.227
NP_443064.1_6 Reverse -157 -167 13.8273 0.0796
NP_442337.1_8 Forward -297 -278 5.80098 0.21
NP_442578.1_7 Forward -165 -158 14.5921 0.026
NP_442578.1_7 Reverse -158 -165 14.5921 0.026
NP_442578.1_7 Forward -359 -352 5.93897 0.183
NP_442578.1_7 Forward -34 -27 5.15232 0.291
NP_440710.1_1 Reverse -149 -167 -0.275845 0.163
NP_440710.1_1 Forward -160 -142 -7.65067 0.241
NP_440710.1_1 Forward -253 -235 -8.24065 0.261
NP_441462.1_2 Reverse -157 -167 20.1379 0.000967
NP_441462.1_2 Forward -166 -156 11.5831 0.00406
NP_441462.1_2 Forward -360 -350 1.16001 0.0976
NP_441621.1_7 Forward -168 -154 14.2576 0.0266
NP_441621.1_7 Reverse -155 -169 6.48943 0.068
NP_443062.1_1 Forward -360 -342 10.9836 0.106
NP_443062.1_1 Reverse -157 -175 7.86337 0.166
NP_443062.1_6 Forward -174 -155 10.4225 0.113
NP_442204.1_1 Reverse -153 -164 9.69511 0.0736
NP_442204.1_1 Forward -170 -159 2.51695 0.266
NP_442204.1_1 Forward -364 -353 0.255333 0.282
NP_442204.1_5 Reverse -147 -166 5.30933 0.159
NP_441560.1_8 Forward -171 -152 12.584 0.25
NP_442487.1_5 Reverse -146 -165 6.1935 0.208
NP_440516.1_6 Reverse -211 -225 11.7987 0.199
NP_440516.1_8 Forward -166 -157 16.9127 0.00442
NP_440516.1_8 Reverse -157 -166 16.9127 0.00442
NP_440516.1_8 Forward -360 -351 8.1612 0.0417
NP_440516.1_8 Forward -152 -143 -0.393597 0.255
NP_442428.1_4 Reverse -156 -175 8.25926 0.18
NP_442428.1_4 Forward -257 -238 2.26107 0.266
NP_442428.1_4 Forward -251 -232 1.86774 0.278
NP_442428.1_5 Forward -165 -158 15.8704 0.0124
NP_442428.1_5 Reverse -158 -165 15.8704 0.0124
NP_442428.1_5 Reverse -352 -359 6.13563 0.209
NP_442428.1_5 Forward -359 -352 6.0373 0.212
NP_442428.1_5 Forward -34 -27 4.46401 0.267
NP_440673.1_2 Forward -102 -83 9.21897 0.254
NP_440673.1_3 Reverse -28 -35 13.2155 0.0426
NP_440673.1_3 Forward -164 -157 12.4288 0.0426
NP_440673.1_3 Reverse -353 -360 12.4288 0.0426
NP_440673.1_3 Reverse -159 -166 12.4288 0.0426
NP_440673.1_3 Forward -191 -184 8.98723 0.203
NP_440865.1_9 Forward -172 -153 -1.27885 0.173
NP_440865.1_9 Reverse -151 -170 -7.96535 0.254
NP_441052.1_2 Forward -166 -156 10.5014 0.0285
NP_441052.1_2 Reverse -157 -167 10.4031 0.0285
NP_441052.1_2 Forward -35 -25 4.99491 0.135
NP_441052.1_2 Forward -360 -350 0.471689 0.257
NP_442219.1_8 Reverse -353 -372 9.51997 0.23
NP_442219.1_9 Forward -359 -350 8.65285 0.0681
NP_442219.1_9 Forward -165 -156 8.35786 0.0681
NP_442219.1_9 Reverse -158 -167 8.25953 0.0681
NP_440436.1_4 Forward -165 -156 18.1905 0.00233
NP_440436.1_4 Reverse -158 -167 15.9289 0.00508
NP_440436.1_4 Reverse -352 -361 14.9456 0.0103
NP_440436.1_4 Forward -359 -350 12.684 0.034
NP_440436.1_4 Forward -192 -183 7.76745 0.124
NP_441884.1_9 Forward -169 -150 -14.1602 0.138
NP_441893.1_10 Reverse -229 -248 11.7992 0.232
NP_442907.1_9 Reverse -83 -102 -6.88371 0.293
NP_441719.1_4 Forward -165 -158 16.3621 0.0124
NP_441719.1_4 Reverse -158 -165 16.3621 0.0124
NP_441719.1_4 Forward -359 -352 6.72562 0.093
NP_441719.1_4 Reverse -352 -359 6.62729 0.151
NP_441719.1_4 Forward -34 -27 3.77569 0.285
NP_441733.1_10 Forward -169 -156 16.9322 0.0382
NP_441733.1_10 Reverse -154 -167 6.01747 0.203
NP_441004.1_1 Forward -172 -153 -7.4737 0.198
NP_441004.1_1 Forward -372 -353 -11.7019 0.241
NP_442366.1_3 Forward -167 -149 11.3272 0.0376
NP_442366.1_3 Reverse -350 -368 -0.374176 0.19
NP_442366.1_3 Forward -361 -343 -0.669169 0.197
NP_440129.1_10 Reverse -150 -164 6.58777 0.177
NP_442873.1_3 Reverse -147 -166 4.42355 0.265
NP_440296.1_10 Forward -169 -150 -12.7836 0.269
NP_441115.1_4 Reverse -156 -174 18.1112 0.0152
NP_441115.1_4 Forward -167 -149 9.26148 0.221
NP_442694.1_3 Forward -170 -152 -3.81576 0.265
NP_442694.1_4 Forward -343 -334 12.2911 0.253
NP_442206.1_10 Forward -166 -151 4.69978 0.178
NP_442206.1_10 Reverse -364 -379 2.14318 0.205
NP_440328.1_4 Reverse -151 -170 7.07928 0.124
NP_443054.1_2 Reverse -155 -169 10.3243 0.0761
NP_443054.1_2 Reverse -299 -313 2.16287 0.245
NP_442430.1_2 Reverse -347 -366 2.26107 0.268
NP_441966.1_8 Forward -172 -154 -1.06249 0.198
NP_441851.1_10 Forward -167 -157 17.4829 0.0027
NP_441851.1_10 Reverse -156 -166 16.008 0.00552
NP_441851.1_10 Forward -361 -351 7.45319 0.14
NP_441542.1_4 Reverse -70 -84 5.50613 0.264
NP_442515.1_1 Reverse -156 -170 -1.47537 0.255
NP_442515.1_1 Reverse -183 -197 -1.5737 0.257
NP_442515.1_1 Forward -167 -153 -4.91696 0.298
NP_440593.1_3 Reverse -78 -97 -0.295539 0.202
NP_440593.1_3 Reverse -346 -365 -6.39206 0.273
NP_440593.1_3 Reverse -152 -171 -7.17871 0.288
NP_441982.1_6 Reverse -291 -300 11.6259 0.288
NP_442689.1_8 Reverse -53 -70 -5.56602 0.272
NP_440940.1_7 Reverse -147 -165 3.36165 0.274
NP_440940.1_7 Forward -176 -158 2.77167 0.295
NP_441349.1_10 Forward -176 -157 -5.99873 0.217
NP_441409.1_6 Forward -172 -153 2.55606 0.0584
NP_442843.1_1 Forward -159 -140 -3.93378 0.23
NP_442843.1_1 Forward -186 -167 -11.9969 0.296
NP_442944.1_9 Forward -175 -156 16.7157 0.228
NP_440431.1_3 Reverse -156 -175 -2.85214 0.175
NP_442450.1_5 Forward -168 -158 10.1081 0.115
NP_442450.1_5 Reverse -155 -165 9.32148 0.115
NP_440588.1_2 Forward -175 -156 3.83436 0.0946
NP_440588.1_2 Reverse -148 -167 -0.688862 0.152
NP_440588.1_2 Reverse -134 -153 -1.57384 0.155
NP_440195.1_4 Forward -372 -353 13.9625 0.127
NP_440954.1_1 Reverse -364 -383 -11.0136 0.289
NP_442006.1_2 Reverse -247 -264 -13.1375 0.197
NP_443047.1_7 Reverse -315 -334 3.44104 0.3
NP_441570.1_1 Forward -360 -342 1.10079 0.0331
NP_441570.1_1 Forward -166 -148 0.21581 0.0403
NP_441570.1_1 Forward -193 -175 -11.8789 0.204
NP_441570.1_1 Reverse -236 -254 -16.4021 0.245
NP_441078.1_4 Forward -166 -157 19.6659 0.0007
NP_441078.1_4 Reverse -157 -166 19.6659 0.0007
NP_441078.1_4 Reverse -351 -360 0.196389 0.205
NP_441078.1_4 Forward -360 -351 -0.000272808 0.205
NP_441078.1_4 Reverse -184 -193 -1.6719 0.266
NP_441078.1_4 Forward -35 -26 -2.06522 0.295
NP_442729.1_5 Forward -161 -151 11.3864 0.235
NP_442729.1_8 Forward -170 -157 8.9674 0.125
NP_442729.1_8 Reverse -153 -166 8.08242 0.125
NP_440539.1_9 Reverse -284 -303 5.60432 0.23
NP_441528.1_2 Forward -101 -82 8.65176 0.275
NP_441663.1_8 Reverse -151 -170 8.55425 0.0906
NP_440707.1_6 Reverse -149 -168 10.6184 0.283
NP_442443.1_1 Forward -144 -125 -0.000545616 0.219
NP_440526.1_3 Reverse -158 -169 18.446 0.0306
NP_440526.1_3 Reverse -144 -155 0.156538 0.297
NP_441432.1_8 Forward -167 -158 8.35786 0.0755
NP_441432.1_8 Reverse -156 -165 8.25953 0.0755
NP_441432.1_8 Reverse -183 -192 5.40793 0.158
NP_441432.1_8 Reverse -363 -372 5.21127 0.185
NP_441432.1_8 Reverse -300 -309 4.91628 0.196
NP_441432.1_8 Reverse -369 -378 4.22796 0.235
NP_441432.1_8 Forward -367 -358 3.24465 0.252
NP_442320.1_8 Forward -366 -352 5.70279 0.0334
NP_442320.1_8 Reverse -151 -165 4.91614 0.0442
NP_442320.1_8 Reverse -345 -359 1.96621 0.0801
NP_442320.1_8 Forward -172 -158 -0.688726 0.0817
NP_441732.1_2 Reverse -153 -169 2.22182 0.0253
NP_441732.1_2 Forward -170 -154 -15.8711 0.163
NP_440497.1_6 Forward -378 -359 -4.52377 0.264
NP_440629.1_1 Reverse -59 -77 1.98577 0.245
NP_440629.1_4 Reverse -283 -302 7.96426 0.284
NP_440760.1_1 Reverse -157 -176 -20.5517 0.223
NP_442797.1_7 Reverse -150 -168 9.65558 0.169
NP_441945.1_10 Reverse -246 -265 20.649 0.0293
NP_441945.1_10 Reverse -363 -382 8.25926 0.273
NP_442353.1_4 Reverse -224 -243 6.78348 0.17
NP_440913.1_1 Reverse -362 -380 8.18062 0.19
NP_442727.1_1 Forward -354 -340 10.816 0.297
NP_442010.1_1 Forward -201 -183 9.35981 0.241
NP_440713.1_4 Forward -224 -205 3.04771 0.251
NP_440713.1_4 Forward -176 -157 2.26107 0.266
NP_442489.1_7 Forward -166 -157 20.1576 0.000695
NP_442489.1_7 Reverse -157 -166 20.1576 0.000695
NP_442489.1_7 Reverse -351 -360 0.884706 0.145
NP_442489.1_7 Forward -360 -351 0.491382 0.178
NP_442489.1_7 Forward -35 -26 -1.57357 0.213
NP_442489.1_7 Forward -152 -143 -1.6719 0.235
NP_442489.1_7 Reverse -184 -193 -1.6719 0.235
NP_442489.1_7 Forward -193 -184 -1.77023 0.247
NP_440757.1_7 Reverse -152 -170 -2.0458 0.276
NP_440757.1_8 Reverse -55 -67 18.7092 0.0961
NP_442079.1_7 Reverse -158 -177 12.2908 0.0873
NP_440559.1_1 Reverse -158 -167 17.306 0.00658
NP_440559.1_1 Forward -165 -156 8.75118 0.0586
NP_440559.1_1 Forward -359 -350 8.06287 0.0656
NP_440559.1_1 Reverse -352 -361 5.50626 0.14
NP_440559.1_1 Reverse -144 -153 4.62128 0.24
NP_440559.1_1 Forward -34 -25 4.62128 0.24
NP_441659.2_8 Reverse -157 -167 19.3512 0.000966
NP_441659.2_8 Forward -166 -156 11.9764 0.0147
NP_441659.2_8 Forward -360 -350 5.19158 0.113
NP_441659.2_8 Reverse -351 -361 0.176696 0.271
NP_441040.1_2 Forward -168 -149 -15.2418 0.286
NP_442008.1_2 Reverse -126 -145 8.65258 0.197
NP_442008.1_2 Forward -169 -150 5.89931 0.223
NP_441800.1_7 Reverse -138 -156 -4.01242 0.284
NP_442776.1_1 Forward -384 -365 9.83255 0.181
NP_442346.1_5 Forward -167 -157 17.9746 0.00128
NP_442346.1_5 Reverse -183 -193 11.7798 0.0567
NP_442346.1_5 Reverse -156 -166 9.02648 0.118
NP_442346.1_5 Forward -361 -351 7.15819 0.178
NP_442346.1_5 Reverse -25 -35 5.19158 0.256
NP_442346.1_5 Reverse -350 -360 4.79825 0.272
NP_442346.1_5 Forward -36 -26 4.60159 0.281
NP_440545.1_3 Forward -170 -153 24.0316 0.00406
NP_440545.1_3 Reverse -153 -170 9.97027 0.0362
NP_440831.1_3 Reverse -148 -167 11.241 0.163
NP_440459.1_2 Reverse -355 -372 11.1502 0.181
NP_440459.1_2 Forward -375 -358 9.87194 0.215
NP_441653.1_2 Forward -261 -242 8.36131 0.186
NP_441653.1_3 Forward -97 -83 16.0275 0.229
NP_440010.1_3 Reverse -244 -263 -6.29373 0.25
NP_440010.1_4 Reverse -347 -366 6.88182 0.197
NP_440847.1_5 Forward -255 -236 11.3075 0.281
NP_442603.1_7 Reverse -157 -171 17.6002 0.0211
NP_442603.1_7 Forward -166 -152 11.602 0.114
NP_441888.1_7 Reverse -152 -166 3.8345 0.225
NP_441888.1_7 Forward -225 -211 0.687908 0.287
NP_441948.1_4 Reverse -150 -168 -3.71743 0.203
NP_441833.1_4 Forward -165 -158 15.9687 0.0124
NP_441833.1_4 Reverse -158 -165 15.9687 0.0124
NP_441833.1_4 Reverse -352 -359 14.1004 0.0258
NP_441833.1_4 Forward -359 -352 6.13563 0.198
NP_441895.1_2 Reverse -277 -296 1.57275 0.0388
NP_442162.1_9 Forward -165 -158 16.2637 0.0124
NP_442162.1_9 Reverse -158 -165 16.2637 0.0124
NP_442162.1_9 Reverse -352 -359 6.62729 0.142
NP_442162.1_9 Forward -359 -352 6.52896 0.178
NP_440671.1_1 Reverse -46 -65 24.6976 0.00956
NP_440671.1_4 Reverse -151 -165 12.4876 0.107
NP_440671.1_4 Forward -172 -158 8.25939 0.202
NP_442404.1_9 Reverse -160 -174 18.1901 0.208
NP_441973.1_1 Forward -241 -226 -0.315096 0.282
NP_442073.1_6 Forward -175 -156 1.0811 0.25
NP_440204.1_4 Forward -297 -278 0.687771 0.27
NP_442546.1_2 Forward -304 -285 2.06362 0.275
NP_442199.1_7 Forward -381 -362 5.99684 0.199
NP_442140.1_3 Reverse -158 -168 14.828 0.0433
NP_442140.1_3 Forward -165 -155 8.33817 0.119
NP_440875.1_9 Reverse -159 -169 9.24806 0.233
NP_440875.1_9 Forward -164 -154 9.05339 0.233
NP_440875.1_9 Reverse -244 -254 8.27469 0.233
NP_441813.1_5 Reverse -155 -165 17.188 0.00979
NP_441813.1_5 Forward -168 -158 8.92815 0.0347
NP_441813.1_5 Forward -362 -352 7.35486 0.0762
NP_441813.1_5 Reverse -349 -359 5.5849 0.118
NP_441813.1_5 Reverse -141 -151 0.275027 0.206
NP_440590.1_4 Reverse -352 -365 8.67241 0.0431
NP_440590.1_4 Reverse -158 -171 6.4108 0.0575
NP_440590.1_4 Forward -165 -152 4.8375 0.0585
NP_440590.1_4 Forward -244 -231 -5.97891 0.296
NP_440567.1_1 Forward -165 -151 14.2576 0.0187
NP_440567.1_1 Reverse -158 -172 10.0294 0.0402
NP_440567.1_1 Reverse -352 -366 3.63784 0.139
NP_440567.1_1 Forward -151 -137 -0.0987402 0.264
NP_442497.1_10 Reverse -158 -167 19.8626 0.00532
NP_442497.1_10 Forward -165 -156 10.4228 0.0087
NP_442497.1_10 Reverse -352 -361 0.688044 0.141
NP_442497.1_10 Reverse -144 -153 0.688044 0.141
NP_440821.1_4 Forward -168 -158 19.5479 0.00399
NP_440821.1_4 Reverse -155 -165 19.0562 0.00399
NP_440821.1_4 Forward -362 -352 9.22315 0.0334
NP_440821.1_4 Forward -154 -144 0.176696 0.198
NP_440821.1_4 Reverse -349 -359 -0.216628 0.244
NP_441239.1_9 Forward -168 -156 17.0502 0.0153
NP_441239.1_9 Reverse -155 -167 16.8536 0.0155
NP_441239.1_9 Reverse -209 -221 13.5103 0.037
NP_441239.1_9 Reverse -141 -153 6.1355 0.2
NP_441239.1_9 Reverse -239 -251 3.97222 0.269
NP_441239.1_9 Reverse -362 -374 3.38223 0.285
NP_441951.1_4 Reverse -243 -262 3.24438 0.275
NP_441009.1_4 Reverse -157 -176 10.7175 0.263
NP_441727.1_3 Forward -173 -154 6.29264 0.244
NP_441892.1_1 Reverse -148 -165 3.18543 0.129
NP_441892.1_1 Forward -175 -158 -0.0594896 0.177
NP_441892.1_1 Reverse -355 -372 -5.07437 0.273
NP_440604.1_6 Reverse -157 -176 -4.03212 0.236
NP_440796.1_3 Reverse -150 -168 12.1131 0.204
NP_442193.1_1 Reverse -364 -382 11.1305 0.228
NP_441017.1_6 Forward -364 -350 13.372 0.195
NP_442772.1_1 Reverse -35 -54 17.2356 0.191
NP_441874.1_1 Forward -370 -356 16.0275 0.165
NP_441541.1_1 Reverse -47 -65 -0.475474 0.237
NP_441541.1_1 Reverse -57 -75 -5.05909 0.291
NP_440354.1_7 Forward -366 -348 9.26226 0.228
NP_442138.1_10 Forward -166 -147 3.24438 0.115
NP_440546.1_4 Reverse -157 -167 12.8578 0.0572
NP_440546.1_4 Forward -166 -156 11.8882 0.0679
NP_440546.1_4 Forward -360 -350 9.65817 0.126
NP_440462.1_6 Reverse -155 -165 15.418 0.0142
NP_440462.1_6 Forward -168 -158 10.4031 0.0396
NP_440462.1_6 Forward -362 -352 5.78156 0.138
NP_442611.1_1 Forward -166 -147 6.58763 0.156
NP_440868.1_4 Reverse -153 -165 8.6921 0.0582
NP_440868.1_4 Reverse -139 -151 2.30059 0.157
NP_440868.1_4 Forward -170 -158 0.727295 0.201
NP_440868.1_8 Forward -170 -151 -4.6221 0.263
NP_441474.1_1 Forward -266 -247 0.981987 0.252
NP_441474.1_1 Forward -383 -364 -0.984623 0.256
NP_440036.1_4 Forward -169 -150 18.584 0.184
NP_440653.1_10 Reverse -358 -377 9.3409 0.174
NP_440653.1_10 Forward -226 -207 2.26107 0.289
NP_440653.1_10 Reverse -158 -177 1.86774 0.293
NP_442460.1_7 Forward -372 -353 7.66927 0.162
NP_440696.1_3 Forward -170 -152 -3.22577 0.284
NP_442039.1_4 Forward -165 -158 15.1821 0.0124
NP_442039.1_4 Reverse -158 -165 15.1821 0.0124
NP_442039.1_7 Reverse -85 -95 6.76487 0.299
NP_442786.1_2 Forward -67 -48 11.9838 0.254
NP_442837.1_3 Forward -165 -158 15.7721 0.0124
NP_442837.1_3 Reverse -158 -165 15.7721 0.0124
NP_442837.1_3 Reverse -352 -359 6.13563 0.25
NP_442837.1_3 Forward -359 -352 5.93897 0.265
NP_441760.1_1 Forward -102 -83 14.2574 0.14
NP_440160.1_2 Reverse -235 -254 8.35759 0.147
NP_440160.1_2 Reverse -234 -253 4.71934 0.217
NP_442053.1_1 Forward -166 -157 18.3876 0.0007
NP_442053.1_1 Reverse -157 -166 18.3876 0.0007
NP_442053.1_1 Forward -152 -143 4.42462 0.249
NP_440505.1_3 Reverse -155 -165 13.8447 0.0247
NP_440505.1_3 Forward -362 -352 12.5664 0.0482
NP_440505.1_3 Forward -168 -158 7.84651 0.147
NP_440505.1_3 Reverse -182 -192 4.3066 0.3
NP_441203.1_1 Forward -165 -146 -0.983855 0.0636
NP_441203.1_1 Reverse -158 -177 -19.0768 0.297
NP_440914.1_1 Reverse -236 -246 9.39583 0.186
NP_440914.1_1 Forward -166 -156 8.6151 0.186
NP_440914.1_1 Reverse -157 -167 8.51751 0.186
NP_441011.1_8 Forward -165 -156 16.9127 0.00602
NP_441011.1_8 Reverse -158 -167 14.356 0.0249
NP_441011.1_8 Reverse -352 -361 7.17789 0.179
NP_441011.1_8 Reverse -206 -215 5.3096 0.271
NP_442101.1_10 Reverse -149 -168 12.3892 0.0306
NP_442101.1_10 Reverse -176 -195 -6.78538 0.201
NP_442533.1_1 Forward -169 -150 -15.4385 0.254
NP_442533.1_6 Forward -166 -157 17.2076 0.00137
NP_442533.1_6 Reverse -157 -166 17.2076 0.00137
NP_442533.1_6 Reverse -26 -35 5.80125 0.128
NP_442533.1_6 Forward -360 -351 5.3096 0.145
NP_442533.1_6 Forward -220 -211 4.52295 0.179
NP_442533.1_6 Reverse -217 -226 4.0313 0.194
NP_442533.1_6 Reverse -364 -373 2.65466 0.246
NP_442533.1_6 Reverse -247 -256 2.458 0.255
NP_442232.1_3 Forward -174 -155 -12.3902 0.282
NP_442232.1_3 Forward -160 -141 -14.5535 0.288
NP_442322.1_4 Reverse -203 -220 -2.81344 0.236
NP_443016.1_10 Forward -175 -156 12.3892 0.202
NP_441482.1_7 Forward -172 -158 0.982901 0.0554
NP_441482.1_7 Reverse -151 -165 0.589577 0.0554
NP_441482.1_7 Forward -366 -352 -1.5737 0.0755
NP_441482.1_7 Forward -220 -206 -9.44018 0.202
NP_441482.1_7 Forward -256 -242 -11.1118 0.237
NP_439944.1_9 Reverse -158 -168 17.4829 0.00423
NP_439944.1_9 Forward -359 -349 15.418 0.0198
NP_439944.1_9 Forward -165 -155 10.3048 0.0887
NP_439944.1_9 Reverse -185 -195 5.09324 0.277
NP_441697.1_5 Forward -60 -41 -9.59736 0.271
NP_441697.1_5 Forward -59 -40 -10.3613 0.278
NP_441697.1_5 Reverse -42 -61 -10.7433 0.284
NP_441028.1_6 Forward -300 -290 4.89613 0.275
NP_439945.1_1 Reverse -44 -63 19.2791 0.153
NP_440116.1_5 Reverse -154 -171 2.89044 0.252
NP_440116.1_8 Reverse -158 -177 8.45592 0.0371
NP_441527.1_4 Reverse -63 -82 -10.4568 0.27
NP_440115.1_6 Forward -169 -159 19.2529 0.0106
NP_442728.1_7 Forward -379 -365 14.7492 0.219
NP_441347.1_9 Forward -75 -62 11.2111 0.215
NP_441602.1_4 Reverse -146 -165 14.9458 0.278
NP_441972.1_5 Reverse -158 -177 4.916 0.0969
NP_441972.1_5 Forward -255 -236 -3.54046 0.2
NP_441972.1_5 Reverse -84 -103 -4.81876 0.211
NP_441106.1_1 Reverse -156 -165 18.191 0.0028
NP_441106.1_1 Forward -167 -158 9.73449 0.0311
NP_441106.1_1 Forward -361 -352 8.35786 0.0585
NP_441106.1_1 Reverse -350 -359 5.40793 0.151
NP_441106.1_1 Forward -221 -212 2.458 0.283
NP_440429.1_4 Reverse -150 -169 10.8159 0.299
NP_439903.1_6 Reverse -348 -367 5.89851 0.176
NP_439903.1_6 Forward -376 -357 5.70185 0.178
NP_442588.1_1 Reverse -244 -263 9.43923 0.225
NP_441186.1_4 Forward -63 -53 17.0891 0.223
NP_441286.1_1 Reverse -156 -168 14.6903 0.00418
NP_441286.1_1 Forward -167 -155 5.05386 0.0259
NP_441286.1_1 Forward -361 -349 0.0389777 0.119
NP_441286.1_1 Reverse -183 -195 -0.649339 0.135
NP_441286.1_1 Reverse -350 -362 -4.38592 0.156
NP_440670.1_8 Forward -166 -157 18.3876 0.000699
NP_440670.1_8 Reverse -157 -166 18.3876 0.000699
NP_440670.1_8 Reverse -351 -360 6.98123 0.0882
NP_440670.1_8 Forward -193 -184 3.44131 0.267
NP_441479.1_1 Forward -144 -125 9.43923 0.216
NP_440886.1_7 Reverse -156 -166 17.7774 0.0011
NP_440886.1_7 Forward -167 -157 8.04271 0.0805
NP_440886.1_7 Reverse -142 -152 6.27276 0.134
NP_440886.1_7 Forward -361 -351 4.50281 0.232
NP_442614.1_2 Reverse -157 -171 9.63603 0.242
NP_442072.1_9 Forward -167 -149 -13.0589 0.098
NP_442072.1_9 Reverse -156 -174 -21.5153 0.209
NP_439899.1_1 Reverse -45 -63 12.753 0.161
NP_441753.1_10 Reverse -148 -167 1.96607 0.25
NP_442022.1_4 Forward -346 -327 9.43923 0.245
NP_440907.2_8 Reverse -158 -168 19.449 0.00351
NP_440907.2_8 Forward -165 -155 7.84605 0.117
NP_440664.1_3 Reverse -352 -371 11.2092 0.134
NP_442264.1_2 Forward -197 -180 11.4452 0.183
NP_442264.1_2 Forward -230 -213 8.00365 0.223
NP_442264.1_2 Forward -45 -28 7.512 0.237
NP_442459.1_5 Forward -262 -243 19.3707 0.0931
NP_441463.1_2 Forward -80 -62 3.15784 0.215
NP_441463.1_2 Reverse -53 -71 0.370656 0.274
NP_441463.1_2 Forward -350 -332 -0.590442 0.29
NP_441463.1_3 Reverse -195 -214 -6.88371 0.251
NP_441463.1_3 Forward -176 -157 -8.55534 0.271
NP_441463.1_6 Reverse -182 -196 15.3062 0.152
NP_441463.1_6 Reverse -155 -169 10.3779 0.242
NP_441463.1_6 Forward -195 -181 9.89475 0.242
NP_441626.1_2 Forward -165 -158 15.7721 0.0124
NP_441626.1_2 Reverse -158 -165 15.7721 0.0124
NP_441626.1_2 Forward -359 -352 6.0373 0.212
NP_441626.1_2 Reverse -352 -359 6.0373 0.212
NP_442365.1_5 Reverse -158 -177 14.0608 0.114
NP_442794.1_1 Reverse -153 -165 10.1671 0.0721
NP_442794.1_1 Forward -170 -158 3.57889 0.286
NP_442615.1_1 Forward -175 -157 5.62401 0.0376
NP_441962.1_4 Forward -171 -152 -4.03212 0.156
NP_441962.1_4 Reverse -212 -231 -11.7019 0.244
NP_441962.1_9 Reverse -152 -171 7.57094 0.258
NP_440387.1_1 Forward -166 -150 14.6115 0.00635
NP_440387.1_1 Reverse -351 -367 -3.18639 0.156
NP_441431.1_2 Forward -169 -155 9.73373 0.18
NP_441431.1_2 Reverse -154 -168 8.94708 0.2
NP_441836.1_2 Forward -232 -213 -5.40875 0.279
NP_441993.1_1 Forward -166 -147 11.3026 0.115
NP_441993.1_1 Reverse -241 -260 2.8238 0.25
NP_441993.1_1 Forward -159 -140 1.84923 0.269
NP_440814.1_4 Forward -175 -156 -11.2103 0.224
NP_440114.1_10 Forward -310 -296 6.09611 0.285
NP_442323.1_7 Reverse -152 -171 11.11 0.144
NP_442323.1_7 Forward -378 -359 1.86696 0.276
NP_441510.2_2 Reverse -153 -172 2.85027 0.272
NP_441510.2_7 Reverse -151 -165 10.1271 0.281
NP_441510.2_9 Reverse -158 -177 7.47261 0.192
NP_440293.1_9 Reverse -212 -226 14.7264 0.184
NP_440293.1_10 Forward -169 -150 -0.590531 0.254
NP_440766.1_4 Forward -170 -156 17.6992 0.0255
NP_440766.1_4 Reverse -153 -167 15.2409 0.0269
NP_439988.1_3 Forward -290 -276 10.0294 0.233
NP_439988.1_3 Forward -164 -150 7.66941 0.273
NP_439988.1_7 Reverse -156 -170 15.5352 0.292
NP_441237.1_9 Reverse -158 -168 17.2863 0.00348
NP_441979.1_5 Reverse -151 -170 -12.6852 0.228
NP_442743.1_4 Forward -151 -132 -6.1954 0.279
NP_442743.1_4 Reverse -224 -243 -7.4737 0.279
NP_442743.1_5 Reverse -352 -371 5.01433 0.209
NP_439910.1_2 Reverse -343 -360 -4.58271 0.0788
NP_439910.1_2 Forward -174 -157 -22.184 0.215
NP_439910.1_2 Reverse -197 -214 -22.5773 0.267
NP_440457.1_1 Forward -170 -158 16.4603 0.0486
NP_440457.1_1 Reverse -153 -165 8.29878 0.101
NP_440457.1_1 Forward -364 -352 -0.0593532 0.25
NP_440457.1_1 Forward -156 -144 -1.23932 0.3
NP_440798.1_6 Forward -165 -152 3.85419 0.147
NP_440798.1_6 Reverse -158 -171 0.805932 0.248
NP_441801.1_4 Reverse -147 -157 2.63497 0.29
NP_441889.1_4 Reverse -148 -167 11.0125 0.0842
NP_441436.1_8 Reverse -216 -235 7.27595 0.293
NP_442509.1_9 Reverse -157 -167 17.3841 0.00128
NP_442509.1_9 Forward -166 -156 16.2041 0.00739
NP_442509.1_9 Reverse -143 -153 10.206 0.191
NP_442509.1_9 Forward -138 -128 6.86274 0.248
NP_442509.1_9 Reverse -351 -361 6.56775 0.263
NP_441496.1_1 Forward -54 -40 13.094 0.295
NP_441253.1_1 Reverse -342 -361 3.73603 0.297
NP_443037.1_8 Forward -294 -275 12.2908 0.242
NP_440554.1_4 Forward -165 -155 14.6313 0.02
NP_440554.1_4 Reverse -158 -168 6.27322 0.123
NP_440554.1_4 Reverse -352 -362 5.09324 0.162
NP_441885.1_5 Forward -166 -156 11.4848 0.00668
NP_441885.1_5 Reverse -157 -167 11.3864 0.00668
NP_441885.1_5 Forward -360 -350 10.1081 0.0145
NP_441885.1_5 Reverse -26 -36 0.57002 0.137
NP_442228.1_10 Forward -224 -205 12.7825 0.231
NP_440478.1_4 Forward -170 -151 14.5524 0.168
NP_442341.1_7 Reverse -156 -170 17.1092 0.0138
NP_442341.1_7 Forward -167 -153 15.5359 0.0218
NP_442341.1_7 Reverse -25 -39 5.89945 0.142
NP_442341.1_7 Reverse -350 -364 2.16287 0.267
NP_442341.1_9 Reverse -155 -169 8.45543 0.17
NP_442341.1_9 Forward -253 -239 8.3571 0.171
NP_441756.1_5 Forward -170 -151 5.70265 0.183
NP_441756.1_5 Forward -253 -234 -5.21209 0.299
NP_441173.1_9 Forward -299 -291 12.9004 0.206
NP_441173.1_9 Forward -298 -290 9.75379 0.284
NP_442395.2_4 Reverse -156 -175 12.29 0.08
NP_442395.2_4 Forward -167 -148 5.2102 0.166
NP_442395.2_4 Reverse -142 -161 2.35861 0.223
NP_443000.1_7 Reverse -155 -165 8.73149 0.0437
NP_443000.1_7 Reverse -349 -359 6.66654 0.119
NP_443000.1_7 Forward -168 -158 2.14332 0.226
NP_440507.2_3 Forward -175 -156 15.2399 0.103
NP_440507.2_3 Reverse -148 -167 8.35677 0.253
NP_440552.1_8 Forward -73 -56 24.5936 0.00303
NP_441842.1_10 Forward -42 -28 9.43936 0.192
NP_441842.1_10 Reverse -150 -164 8.65272 0.213
NP_441842.1_10 Forward -367 -353 8.45605 0.221
NP_440275.1_3 Forward -168 -158 19.5479 0.00756
NP_440275.1_3 Reverse -155 -165 8.4365 0.0602
NP_440091.1_1 Reverse -347 -359 16.8536 0.0153
NP_440091.1_1 Reverse -153 -165 1.41561 0.197
NP_441397.1_3 Forward -71 -52 14.2566 0.293
NP_440679.1_10 Reverse -366 -385 -14.6519 0.242
NP_442451.1_2 Reverse -149 -168 -7.37537 0.234
NP_442451.1_2 Reverse -306 -325 -9.24366 0.259
NP_440258.1_3 Forward -72 -53 -5.40875 0.267
NP_439962.1_4 Reverse -149 -168 -8.26035 0.292
NP_440149.1_8 Forward -166 -147 1.47442 0.124
NP_440149.1_8 Reverse -351 -370 -4.81876 0.213
NP_440149.1_8 Reverse -364 -383 -5.01543 0.218
NP_440149.1_8 Forward -360 -341 -6.58872 0.255
NP_441105.1_3 Forward -371 -352 4.52268 0.0784
NP_441105.1_3 Forward -177 -158 4.22769 0.081
NP_441105.1_3 Forward -231 -212 -4.6221 0.203
NP_441105.1_3 Reverse -146 -165 -6.09707 0.229
NP_442373.1_10 Forward -385 -366 4.916 0.288
NP_440216.1_1 Forward -166 -152 7.57108 0.00935
NP_440216.1_1 Forward -152 -138 -1.5737 0.034
NP_440216.1_1 Reverse -157 -171 -2.16369 0.0482
NP_440216.1_1 Forward -360 -346 -11.7018 0.212
NP_440216.1_1 Reverse -143 -157 -12.5868 0.288
NP_440216.1_9 Reverse -279 -288 6.68623 0.289
NP_440172.1_1 Reverse -157 -167 16.303 0.00854
NP_440172.1_1 Reverse -364 -374 10.8948 0.045
NP_440172.1_1 Forward -166 -156 8.73149 0.0586
NP_440172.1_1 Forward -360 -350 7.45319 0.0789
NP_440172.1_1 Reverse -301 -311 1.94665 0.29
NP_440249.1_2 Forward -61 -51 14.1392 0.29
NP_442015.1_10 Reverse -153 -166 19.1938 0.00444
NP_442015.1_10 Forward -170 -157 13.0973 0.0365
NP_441226.1_7 Forward -165 -158 14.4934 0.0123
NP_441226.1_7 Reverse -158 -165 14.4934 0.0123
NP_441111.1_7 Forward -165 -157 18.7023 0.00294
NP_441111.1_7 Reverse -158 -166 18.7023 0.00294
NP_441111.1_7 Reverse -352 -360 8.96754 0.0463
NP_441111.1_7 Reverse -144 -152 -0.472234 0.131
NP_442379.1_10 Reverse -150 -167 -1.14113 0.223
NP_441766.1_2 Forward -166 -157 17.5026 0.00297
NP_441766.1_2 Reverse -157 -166 17.5026 0.00297
NP_441766.1_2 Forward -360 -351 8.06287 0.0691
NP_442417.1_5 Forward -166 -152 19.4691 0.0165
NP_442417.1_5 Reverse -351 -365 4.42448 0.299
NP_440416.1_1 Forward -310 -291 -6.29373 0.169
NP_440416.1_9 Reverse -150 -169 12.7825 0.0158
NP_440416.1_9 Forward -173 -154 -14.8485 0.18
NP_440416.1_9 Forward -194 -175 -18.0934 0.251
NP_440416.1_9 Forward -145 -126 -19.8634 0.279
NP_443052.1_8 Reverse -147 -166 -11.2103 0.224
NP_443052.1_9 Reverse -126 -145 -5.70374 0.273
NP_440072.1_5 Reverse -247 -265 -1.84914 0.264
NP_442116.1_6 Reverse -52 -69 7.40502 0.258
NP_442116.1_6 Reverse -65 -82 6.06813 0.287
NP_442154.1_1 Forward -159 -141 -16.5988 0.243
NP_440261.1_5 Reverse -158 -171 16.2439 0.0122
NP_440261.1_5 Forward -165 -152 -1.06236 0.0655
NP_440261.1_5 Reverse -144 -157 -10.5021 0.201
NP_440988.1_10 Forward -228 -214 5.96377 0.238
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCATTTACCGGAATATGCCACCCTCAAAGCCATTGGCTACGGCGATCGTTATTTGTTGGGAGTTGTGTTCCAAGAAGCCCTATTGCTAGCAGTGATTGGCTTTTTACCCAGTTTTGGCTTGGGGATTCTACTCTACACCAACACAGCCCGGGCCACGGGTTTGCCCCTGATTATGACCACGGCCAGGGCGTTAACTGTATTAATTATGACCATTGCCATGTGTTGCATTTCCGGGGCGATCGCCGTGGGGCGTTTGCGGGCCGCAGATCCGGCGGATATTTTCTAACCTGTGTTCAGGGGTCAGCTTGTGCCAGTGGCAATTTTGTCTTAACATTTCTTCACAAAAATTTATAATTTGTCATAATAGCGATGGACAGTCTTCTCACTAGGAAACATTGCT

CDS

ATGAAAACCGCTGCTAGAATTGTTGCTTTTACCGCTCTGACTGGATTTGCCCTGGGGATGCCCACCGTTGCCATGGCGGAAATGGAAACCACCGAAAAATCTGCCGTAGTTAGTCAAGCCGCCACGGACAGCGCCATGACTATTGTGGAAGTCGCCGCAGGCAATGAAACTTTCAGTACCCTCGTTGCAGCAGTCAAAGCGGCTGATTTAGTGGAAGCTTTATCCGCTGAAGGCCCCTTTACCGTTTTTGCCCCCACCAATGATGCCTTTGCCGCTCTGCCCGCTGGTACGGTGGAAAGTCTGTTGTTGCCCGAAAACAAAGATAAATTGGTGAAAATTTTGACCTACCACGTCGTTCCTGGCAAAATCACCGCCGCCCAGGTTCAATCCGGTGAAGTGGCATCCCTAGCTGGGGAAGCCCTCACCTTCAAAGTCAAAGATGGCAAAGTGAAAGTTAACAAAGCCACTGTCATTTCCGCCGATGTGGATGCCAGCAACGGTGTAATCCATGTCATTGACCAAGTAATTCTGCCTCCTATGTAA

Protein

MKTAARIVAFTALTGFALGMPTVAMAEMETTEKSAVVSQAATDSAMTIVEVAAGNETFSTLVAAVKAADLVEALSAEGPFTVFAPTNDAFAALPAGTVESLLLPENKDKLVKILTYHVVPGKITAAQVQSGEVASLAGEALTFKVKDGKVKVNKATVISADVDASNGVIHVIDQVILPPM