Your browser is old and dusty. Try Google Chrome!

Details for sll1471

ORF sll1471
Accession NP_442922.1
Symbol cpcG2
Category Phycobilisome
Definition phycobilisome rod-core linker polypeptide
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_3 Forward -36 -17 19.7187 0.0615
NP_441418.1_6 Forward -346 -327 -28.8115 0.211
NP_441623.1_1 Reverse -343 -361 -2.24246 0.241
NP_441623.1_1 Forward -277 -259 -3.81576 0.269
NP_442752.1_4 Forward -346 -339 8.20058 0.127
NP_441812.1_3 Forward -84 -70 7.17775 0.286
NP_442909.1_7 Reverse -271 -285 6.0955 0.258
NP_442861.1_4 Forward -103 -84 0.293673 0.297
NP_441169.1_1 Reverse -379 -398 20.649 0.158
NP_442062.1_3 Forward -37 -18 0.196116 0.239
NP_440044.1_8 Forward -82 -63 4.71934 0.11
NP_441660.1_8 Reverse -275 -294 23.1072 0.0163
NP_441208.1_9 Reverse -365 -379 5.60446 0.267
NP_441558.1_5 Forward -68 -49 3.83436 0.296
NP_440410.1_5 Forward -393 -374 11.0125 0.251
NP_440056.1_1 Reverse -275 -294 14.9458 0.146
NP_441770.1_1 Forward -290 -271 10.6184 0.279
NP_441770.1_4 Forward -236 -217 -7.96535 0.238
NP_441783.1_2 Reverse -327 -336 16.421 0.261
NP_441025.1_6 Forward -170 -151 10.2463 0.15
NP_440538.1_10 Forward -279 -260 14.4541 0.207
NP_441327.1_1 Forward -24 -5 9.49938 0.203
NP_440906.1_5 Forward -82 -75 8.79057 0.149
NP_442634.1_4 Forward -348 -334 -5.40861 0.253
NP_441634.1_8 Reverse -323 -337 6.48943 0.114
NP_441634.1_8 Forward -348 -334 -4.7203 0.295
NP_441077.1_6 Reverse -1 -17 4.92282 0.255
NP_442485.1_3 Forward -282 -263 -6.1954 0.299
NP_441422.1_7 Reverse -330 -347 -3.20608 0.23
NP_440667.1_2 Forward -334 -315 -9.24366 0.299
NP_441414.1_9 Reverse -74 -93 -10.1286 0.277
NP_442937.1_5 Forward -339 -320 8.65258 0.216
NP_442937.1_5 Reverse -263 -282 6.98095 0.265
NP_442685.1_2 Reverse -23 -33 15.0247 0.231
NP_439990.1_5 Forward -351 -338 6.31247 0.244
NP_442376.1_2 Reverse -332 -351 -13.0786 0.286
NP_440153.1_5 Forward -282 -268 0.786239 0.289
NP_443055.1_6 Reverse -260 -278 12.8997 0.105
NP_441424.1_2 Forward -171 -152 21.533 0.0263
NP_441646.1_1 Reverse -342 -361 0.786102 0.243
NP_441916.1_10 Reverse -103 -122 10.0292 0.151
NP_441041.1_4 Forward -334 -315 -13.9635 0.299
NP_439966.1_7 Reverse -335 -345 5.58445 0.216
NP_439966.1_8 Reverse -257 -276 11.8975 0.152
NP_440983.1_9 Forward -350 -331 -0.197208 0.295
NP_441087.1_6 Reverse -177 -195 -3.02983 0.296
NP_443030.1_4 Forward -335 -316 -6.68705 0.289
NP_441751.2_8 Reverse -338 -352 -6.88358 0.289
NP_442554.1_8 Forward -276 -266 2.43831 0.272
NP_440919.1_2 Forward -118 -99 5.99764 0.148
NP_440919.1_7 Forward -136 -118 7.28266 0.228
NP_441525.1_1 Forward -270 -257 13.1956 0.244
NP_441448.1_1 Reverse -269 -288 7.96426 0.21
NP_442076.1_5 Reverse -116 -135 4.916 0.293
NP_440379.1_5 Forward -361 -342 -9.73531 0.264
NP_440379.1_6 Forward -195 -176 5.01433 0.274
NP_441020.2_6 Reverse -254 -271 6.03703 0.28
NP_441876.1_9 Reverse -190 -200 15.3192 0.267
NP_441764.1_1 Forward -181 -162 11.8975 0.162
NP_441764.1_4 Forward -173 -156 9.98168 0.271
NP_440806.1_1 Forward -35 -17 8.08229 0.273
NP_442427.1_8 Reverse -113 -132 6.39097 0.243
NP_442808.1_1 Reverse -274 -284 1.35624 0.287
NP_440385.1_6 Forward -37 -18 12.5568 0.268
NP_440558.1_2 Reverse -316 -335 5.99764 0.137
NP_440558.1_2 Forward -332 -313 -5.31042 0.256
NP_441048.1_4 Reverse -343 -362 14.1591 0.184
NP_440093.1_7 Forward -325 -306 14.2574 0.17
NP_440923.1_1 Reverse -153 -171 16.5379 0.0836
NP_441590.1_4 Reverse -276 -295 5.2102 0.279
NP_442066.2_4 Reverse -261 -280 -8.55534 0.294
NP_441574.1_1 Forward -289 -270 -3.93378 0.246
NP_441574.1_1 Reverse -256 -275 -4.52377 0.252
NP_442347.1_2 Reverse -75 -84 3.53964 0.284
NP_442645.1_2 Reverse -260 -279 -21.535 0.29
NP_440136.1_2 Forward -82 -75 3.97235 0.288
NP_442998.1_10 Reverse -321 -328 7.21728 0.144
NP_440899.1_8 Forward -135 -116 -8.45701 0.254
NP_440299.1_1 Reverse -321 -334 3.06699 0.261
NP_441559.1_9 Reverse -98 -117 13.9625 0.164
NP_440306.1_5 Reverse -86 -105 2.94938 0.184
NP_440695.1_9 Reverse -95 -114 20.7473 0.164
NP_441494.1_6 Reverse -275 -288 5.52582 0.3
NP_442993.1_1 Reverse -325 -341 -10.7579 0.226
NP_440168.1_8 Reverse -313 -332 5.30933 0.216
NP_440146.1_1 Forward -32 -14 19.3868 0.0755
NP_440586.1_1 Reverse -252 -271 1.86774 0.231
NP_440586.1_8 Forward -65 -58 5.64364 0.297
NP_440586.1_9 Reverse -270 -289 5.11266 0.288
NP_440439.1_1 Forward -344 -331 -1.45568 0.269
NP_440171.1_3 Forward -198 -179 10.7175 0.224
NP_442384.1_7 Reverse -250 -264 20.4524 0.0978
NP_441689.1_5 Reverse -120 -130 12.1726 0.132
NP_442529.1_4 Reverse -290 -309 16.8141 0.154
NP_441103.1_9 Reverse -190 -200 13.9544 0.234
NP_440894.1_10 Reverse -181 -200 2.45773 0.29
NP_442454.1_2 Forward -38 -19 8.6416 0.291
NP_440491.1_1 Forward -198 -179 10.6204 0.184
NP_442277.1_4 Reverse -265 -284 12.7816 0.0621
NP_441543.1_2 Reverse -326 -335 4.81794 0.219
NP_441551.1_5 Reverse -333 -349 9.4976 0.21
NP_442578.1_5 Reverse -304 -323 8.65258 0.227
NP_441621.1_7 Reverse -335 -349 -6.19526 0.279
NP_440889.1_5 Reverse -108 -127 8.84924 0.277
NP_442204.1_1 Forward -350 -339 19.4299 0.0123
NP_440544.1_5 Forward -115 -108 14.5681 0.264
NP_440544.1_5 Forward -104 -97 13.8024 0.28
NP_442780.1_1 Forward -169 -150 7.47261 0.279
NP_442120.1_10 Forward -334 -315 -0.590531 0.167
NP_440673.1_4 Forward -199 -180 15.2408 0.143
NP_441052.1_4 Reverse -181 -195 21.5341 0.0579
NP_440436.1_4 Reverse -281 -290 4.81753 0.239
NP_441004.1_1 Forward -346 -327 -7.67036 0.199
NP_441004.1_2 Reverse -339 -358 -3.63879 0.283
NP_442366.1_3 Reverse -336 -354 -1.65248 0.216
NP_440593.1_3 Reverse -275 -294 -0.590531 0.205
NP_440463.1_8 Reverse -327 -346 7.30627 0.264
NP_440338.1_4 Reverse -17 -36 6.58682 0.29
NP_442689.1_8 Forward -107 -90 -4.97604 0.268
NP_442843.1_1 Reverse -123 -142 -10.522 0.278
NP_440474.1_8 Forward -217 -203 4.8172 0.266
NP_440877.1_1 Reverse -166 -185 17.3057 0.128
NP_442168.1_5 Forward -333 -314 -2.36049 0.264
NP_440588.1_2 Reverse -265 -284 -5.99873 0.266
NP_441031.1_1 Reverse -150 -169 8.07601 0.25
NP_441031.1_1 Forward -176 -157 6.05148 0.279
NP_441003.1_9 Reverse -310 -329 5.89931 0.255
NP_442243.1_1 Reverse -268 -286 3.45998 0.204
NP_442443.1_1 Reverse -254 -273 -3.14714 0.264
NP_440526.1_3 Reverse -75 -86 7.23633 0.156
NP_441432.1_9 Forward -37 -24 10.2466 0.254
NP_441732.1_2 Reverse -315 -331 -15.7728 0.16
NP_441057.1_3 Forward -293 -274 -11.1119 0.223
NP_442400.1_10 Reverse -91 -104 7.41465 0.286
NP_441706.1_10 Reverse -322 -341 20.059 0.07
NP_441040.1_2 Reverse -266 -285 -4.6221 0.169
NP_439956.1_10 Forward -25 -6 18.217 0.126
NP_442008.1_2 Forward -344 -325 3.24438 0.26
NP_440352.1_5 Reverse -215 -234 12.7531 0.223
NP_440545.1_3 Forward -332 -315 -4.48438 0.227
NP_440486.1_6 Forward -284 -265 9.24257 0.233
NP_440250.1_4 Forward -110 -91 6.29183 0.253
NP_440459.1_2 Forward -298 -281 9.67528 0.224
NP_440010.1_3 Forward -349 -330 -7.57203 0.278
NP_440010.1_10 Reverse -344 -363 3.14605 0.264
NP_442311.1_8 Forward -350 -331 13.0775 0.199
NP_442828.1_7 Forward -344 -325 1.17943 0.276
NP_441833.1_4 Forward -82 -75 4.56234 0.248
NP_441329.1_6 Reverse -97 -116 3.867 0.212
NP_441895.1_10 Reverse -92 -111 -27.7299 0.29
NP_442140.1_3 Reverse -269 -279 5.38824 0.211
NP_440875.1_9 Forward -344 -334 11.1948 0.179
NP_442547.1_5 Reverse -113 -132 16.9747 0.248
NP_441813.1_3 Reverse -96 -115 12.9769 0.296
NP_440590.1_4 Reverse -320 -333 -5.58558 0.283
NP_442497.1_1 Forward -269 -250 7.27514 0.292
NP_440821.1_4 Forward -85 -75 4.50326 0.13
NP_441239.1_9 Reverse -335 -347 6.33216 0.193
NP_441009.1_4 Forward -328 -309 10.5209 0.265
NP_441727.1_3 Forward -138 -119 5.11266 0.256
NP_441541.1_1 Reverse -9 -27 -5.15458 0.293
NP_440546.1_7 Reverse -268 -278 16.4013 0.234
NP_441509.1_1 Forward -97 -78 6.09597 0.298
NP_441474.1_1 Reverse -327 -346 1.76863 0.247
NP_442402.1_4 Forward -292 -273 5.2102 0.144
NP_441848.1_7 Forward -120 -101 -4.22953 0.288
NP_441084.1_6 Reverse -278 -292 11.0893 0.218
NP_442923.1_2 Reverse -90 -109 22.0256 0.0636
NP_442923.1_5 Reverse -143 -161 22.7336 0.0219
NP_442923.1_6 Reverse -23 -37 19.8739 0.0914
NP_442039.1_7 Reverse -270 -280 15.123 0.211
NP_442679.1_1 Reverse -84 -103 -4.03212 0.269
NP_442679.1_2 Reverse -95 -114 7.07928 0.279
NP_440160.1_2 Forward -359 -340 -9.24366 0.293
NP_442532.1_1 Reverse -82 -96 8.55877 0.297
NP_439944.1_9 Reverse -75 -85 5.19158 0.27
NP_441697.1_5 Reverse -15 -34 -7.01908 0.239
NP_441697.1_5 Forward -32 -13 -8.73794 0.268
NP_441028.1_5 Forward -179 -167 12.6253 0.244
NP_441028.1_6 Forward -227 -217 9.51767 0.216
NP_441028.1_6 Forward -114 -104 5.68278 0.243
NP_442202.1_6 Reverse -111 -130 12.8808 0.161
NP_441527.1_4 Reverse -101 -120 -0.716613 0.146
NP_441527.1_4 Reverse -83 -102 -3.00842 0.164
NP_441527.1_4 Reverse -98 -117 -11.6982 0.284
NP_441527.1_4 Reverse -100 -119 -11.7937 0.284
NP_441527.1_4 Reverse -112 -131 -12.9396 0.296
NP_440608.1_1 Reverse -115 -134 7.86017 0.223
NP_441106.1_1 Forward -347 -338 2.85133 0.255
NP_441106.1_3 Reverse -152 -171 11.6025 0.217
NP_442306.1_10 Forward -351 -332 -20.2567 0.202
NP_441809.1_4 Forward -153 -134 6.39097 0.267
NP_440828.1_4 Reverse -318 -337 -5.21283 0.254
NP_442382.1_9 Reverse -315 -334 11.7 0.266
NP_439995.1_5 Forward -93 -74 11.7008 0.184
NP_442717.1_4 Reverse -380 -399 5.89931 0.186
NP_440767.1_7 Forward -316 -297 8.16093 0.273
NP_442072.1_9 Forward -196 -178 -13.8455 0.123
NP_441021.1_1 Reverse -326 -345 -6.88371 0.181
NP_441463.1_3 Reverse -315 -334 -2.45882 0.154
NP_441463.1_3 Reverse -327 -346 -3.14714 0.17
NP_441463.1_3 Reverse -64 -83 -10.4236 0.294
NP_442842.1_4 Forward -130 -111 2.3594 0.265
NP_442893.1_4 Forward -33 -14 2.06362 0.193
NP_441460.1_2 Reverse -266 -279 16.0466 0.162
NP_441401.1_4 Reverse -91 -104 19.6855 0.0931
NP_441962.1_4 Forward -333 -314 -4.13045 0.156
NP_441962.1_4 Reverse -138 -157 -14.8485 0.294
NP_441962.1_5 Reverse -332 -351 6.88262 0.276
NP_441431.1_6 Forward -292 -273 20.7623 0.214
NP_441174.1_2 Forward -349 -335 12.586 0.248
NP_441174.1_3 Forward -214 -195 13.9625 0.297
NP_441174.1_4 Reverse -104 -114 15.713 0.238
NP_440814.1_8 Reverse -105 -124 0.294447 0.269
NP_441425.1_2 Reverse -16 -35 16.4701 0.184
NP_442698.1_10 Reverse -104 -123 12.4875 0.231
NP_442680.1_5 Reverse -106 -125 2.80756 0.237
NP_442680.1_5 Reverse -103 -122 2.02604 0.237
NP_440478.1_10 Reverse -335 -349 6.09611 0.3
NP_442341.1_7 Forward -329 -315 1.47456 0.288
NP_440423.1_6 Forward -203 -184 -20.65 0.263
NP_440275.1_3 Forward -85 -75 5.19158 0.161
NP_441105.1_3 Reverse -269 -288 2.0644 0.107
NP_441105.1_3 Reverse -362 -381 -8.35868 0.272
NP_442373.1_2 Forward -349 -330 -8.35868 0.249
NP_440172.1_1 Forward -131 -121 2.14332 0.283
NP_440117.1_1 Reverse -14 -33 7.47261 0.104
NP_443052.1_9 Reverse -327 -346 -1.96717 0.231
NP_442154.1_1 Reverse -260 -278 -14.0422 0.217
NP_442154.1_1 Forward -345 -327 -14.6322 0.218
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGCATCACATCCAAAATAACGAGGTCATATTCCAGTCGGGAGGCATAGTCCCAGGCGAGGGAAGCGTCGGTGGCAATATCAACGGTGTAAAGCTGGTCACTCAATGCTTCAGCAAGGGTTTCCGCCAGCGGCAAATCATCCTCCACTAAAAGAATTCTCATAGCCCATTGTGCTTTTCTCTATCAACCTCAGCTTACCTGAAGGGGTGAACAGGTCTGGGTTAATTCATGTTGCGAAATGTAACAGTTTTAGTCGCATCAGCTAACTTTCCGATTTCTTTACGATTTTCTCCCCCTTTTCTTCAATTTTACTTTGTTAGGATCGCATTTTTAATGCCAACACATACCAGTTATTGGCTGGACATTAAACAACTTTTAAGTTTAATTACTAACTTTATCT

CDS

ATGACACTGCCTTTAATTGCTTATGCTCCCGTTAGTCAGAATCAACGGGTTACCAACTACGAAGTCTCTGGAGATGAACACGCTCGTATTTTCACCACGGAGGGCACCCTTTCTCCCTCTGCCATGGATAATCTGATCGCCGCAGCCTATCGTCAGGTGTTCAACGAGCAACAAATGATTCAAAGTAATCGGCAGATTGCCTTAGAATCCCAATTCAAAAATCAGCAAATTACCGTGCGGGATTTTATCCGTGGTCTAGCTCTTTCGGATAGCTTTCGTCGTCGCAATTTTGAAGTAAATAATAATTATCGTTTTGTACAAATGTGTATTCAACGATTACTGGGTCGAGATGTTTATAGTGAAGAAGAAAAAATTGCTTGGTCCATTGTGATCGCCACTAAAGGGTTACCTGGCTTCATCAACGAACTGCTCAATAGTCAAGAATATTTAGAAAACTTTGGCTACGATACTGTGCCCTATCAACGGCGGCGCATTCTGCCCCAACGGATTAGTGGTGAGTTACCCTTTGCCCGGATGCCCCGTTACGGTGCTGATCATCGGGAAAAATTAGAGGCGATCGGCTACTTCCGCAACCAAGCTCCGTTAACTTACCGTTGGGAATGGCAAAAGCAACCCTATCCCGCCGGGGTTTATCTAGCAGGGAAAGTCGTGCTTTACGTCGGAGGGGCGTTAGTCAGTTTAGGGATAATTGCCGTTGCCCTTAGTGCTTGGGGCATTATTGGGTTGTAG

Protein

MTLPLIAYAPVSQNQRVTNYEVSGDEHARIFTTEGTLSPSAMDNLIAAAYRQVFNEQQMIQSNRQIALESQFKNQQITVRDFIRGLALSDSFRRRNFEVNNNYRFVQMCIQRLLGRDVYSEEEKIAWSIVIATKGLPGFINELLNSQEYLENFGYDTVPYQRRRILPQRISGELPFARMPRYGADHREKLEAIGYFRNQAPLTYRWEWQKQPYPAGVYLAGKVVLYVGGALVSLGIIAVALSAWGIIGL