Your browser is old and dusty. Try Google Chrome!

Details for sll1470

ORF sll1470
Accession NP_442926.1
Symbol leuC
Category Branched chain family
Definition 3-isopropylmalate dehydratase large subunit
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -26 -19 14.6904 0.0123
NP_440795.1_7 Reverse -19 -26 14.6904 0.0123
NP_440795.1_7 Reverse -331 -338 10.2655 0.154
NP_441418.1_6 Reverse -42 -61 -0.295539 0.0102
NP_441418.1_6 Reverse -330 -349 -20.945 0.133
NP_441418.1_6 Reverse -18 -37 -28.7132 0.208
NP_441418.1_6 Forward -84 -65 -29.5982 0.23
NP_440897.1_6 Reverse -18 -37 3.24359 0.149
NP_441453.1_4 Reverse -18 -26 16.539 0.00633
NP_441453.1_4 Forward -27 -19 16.539 0.00633
NP_441453.1_4 Forward -339 -331 4.05099 0.268
NP_442151.1_6 Reverse -330 -344 12.8809 0.0659
NP_442151.1_6 Forward -27 -13 11.111 0.108
NP_442151.1_6 Reverse -18 -32 11.111 0.108
NP_441818.1_1 Forward -26 -15 8.51463 0.288
NP_442655.1_1 Reverse -13 -32 1.17943 0.238
NP_442173.1_1 Forward -26 -18 15.4574 0.00633
NP_442173.1_1 Reverse -19 -27 15.4574 0.00633
NP_442752.1_4 Forward -27 -20 13.8055 0.0199
NP_442752.1_4 Reverse -18 -25 13.8055 0.0199
NP_442752.1_4 Reverse -363 -370 7.6106 0.151
NP_443027.1_4 Reverse -16 -26 7.35486 0.24
NP_443027.1_4 Forward -29 -19 5.87989 0.294
NP_441812.1_3 Forward -373 -359 8.94771 0.248
NP_441812.1_3 Forward -28 -14 7.37441 0.277
NP_442975.1_10 Forward -31 -17 3.24392 0.26
NP_440784.1_7 Forward -26 -19 15.9687 0.0123
NP_440784.1_7 Reverse -19 -26 15.9687 0.0123
NP_442909.1_7 Forward -26 -12 11.7987 0.131
NP_441250.1_3 Forward -282 -263 10.5209 0.197
NP_440061.1_9 Forward -29 -15 10.8154 0.122
NP_440061.1_9 Forward -211 -197 5.80051 0.272
NP_441054.1_6 Reverse -334 -353 13.3725 0.257
NP_441476.1_5 Forward -68 -49 -1.27885 0.202
NP_439979.1_9 Reverse -331 -349 10.7372 0.227
NP_440878.1_9 Forward -37 -18 4.81767 0.174
NP_442062.1_8 Reverse -18 -28 19.4496 0.000558
NP_442062.1_8 Forward -27 -17 17.6796 0.00193
NP_442062.1_8 Forward -339 -329 4.79825 0.198
NP_441802.1_1 Reverse -314 -333 5.30933 0.286
NP_440304.1_4 Reverse -16 -26 18.9579 0.00406
NP_440304.1_4 Reverse -328 -338 6.96153 0.137
NP_440304.1_4 Forward -341 -331 6.46988 0.155
NP_440304.1_4 Forward -29 -19 1.84832 0.299
NP_442242.1_4 Forward -26 -19 14.3954 0.0124
NP_442242.1_4 Reverse -19 -26 14.3954 0.0124
NP_440044.1_8 Forward -26 -7 -3.04881 0.277
NP_440011.1_1 Forward -211 -192 12.6841 0.264
NP_440764.1_1 Reverse -320 -334 17.3058 0.244
NP_441594.1_6 Reverse -57 -76 9.14423 0.146
NP_441594.1_6 Reverse -9 -28 3.73603 0.225
NP_440370.1_10 Reverse -9 -28 7.17762 0.265
NP_442276.1_2 Forward -351 -332 4.52268 0.299
NP_442110.1_7 Reverse -18 -32 3.34284 0.21
NP_442110.1_7 Forward -27 -13 2.16287 0.222
NP_441925.1_4 Forward -349 -330 -12.9809 0.257
NP_440856.1_4 Forward -34 -15 -2.26216 0.209
NP_441083.1_5 Forward -27 -17 19.3512 0.000718
NP_441083.1_5 Reverse -18 -28 11.3864 0.0159
NP_441083.1_5 Reverse -330 -340 0.176696 0.241
NP_441083.1_5 Forward -339 -329 -0.0199663 0.251
NP_441738.1_2 Forward -25 -18 15.28 0.0102
NP_441738.1_2 Reverse -20 -27 15.28 0.0102
NP_441558.1_5 Reverse -16 -35 4.42435 0.281
NP_440209.1_1 Reverse -18 -26 18.1123 0.00295
NP_440209.1_1 Forward -27 -19 18.1123 0.00295
NP_440870.1_4 Reverse -357 -375 3.26407 0.163
NP_442765.1_6 Reverse -17 -36 13.3725 0.287
NP_442889.1_8 Reverse -63 -77 6.19383 0.199
NP_441713.1_1 Forward -33 -14 -15.0452 0.26
NP_441770.1_10 Forward -347 -328 9.53756 0.25
NP_440178.1_7 Forward -28 -9 -12.7836 0.124
NP_440178.1_7 Forward -340 -321 -19.9617 0.182
NP_440538.1_10 Forward -68 -49 12.3892 0.235
NP_441716.1_1 Forward -27 -13 8.55439 0.138
NP_442111.1_4 Reverse -17 -31 17.2075 0.0109
NP_442111.1_4 Forward -28 -14 1.67122 0.296
NP_441163.1_1 Forward -35 -18 7.11794 0.249
NP_440343.1_3 Forward -349 -331 2.67334 0.291
NP_440343.1_9 Reverse -332 -351 14.5524 0.139
NP_440906.1_5 Forward -26 -19 15.8704 0.0124
NP_440906.1_5 Reverse -19 -26 15.8704 0.0124
NP_440906.1_5 Forward -74 -67 5.64398 0.292
NP_441209.1_8 Reverse -206 -224 8.65256 0.258
NP_440747.1_10 Forward -30 -18 15.1819 0.00196
NP_440747.1_10 Reverse -15 -27 7.80712 0.00223
NP_440747.1_10 Forward -342 -330 -11.5641 0.125
NP_441486.1_1 Forward -30 -16 11.8976 0.0137
NP_441486.1_1 Reverse -15 -29 4.52282 0.0432
NP_442850.1_8 Forward -31 -12 13.7927 0.273
NP_442634.1_4 Reverse -328 -342 2.94952 0.124
NP_442634.1_4 Forward -29 -15 -1.77037 0.149
NP_442634.1_4 Reverse -16 -30 -2.75368 0.156
NP_441265.1_3 Forward -33 -19 1.57289 0.2
NP_440403.1_10 Forward -75 -56 4.42435 0.256
NP_441014.1_8 Forward -344 -325 7.57094 0.158
NP_441014.1_8 Forward -345 -326 -4.03212 0.247
NP_442848.1_1 Reverse -12 -26 -1.96703 0.263
NP_442848.1_5 Forward -346 -328 -0.374176 0.276
NP_441012.1_4 Forward -343 -330 15.7522 0.163
NP_443018.1_3 Forward -26 -19 14.8871 0.0123
NP_443018.1_3 Reverse -19 -26 14.8871 0.0123
NP_443018.1_3 Reverse -331 -338 4.36568 0.254
NP_443018.1_3 Forward -338 -331 4.07068 0.299
NP_441316.1_7 Reverse -16 -31 4.69978 0.121
NP_440376.1_1 Forward -27 -18 19.4693 0.000692
NP_440376.1_1 Reverse -18 -27 19.4693 0.000692
NP_440376.1_1 Forward -339 -330 7.37455 0.0786
NP_440376.1_1 Reverse -330 -339 7.07956 0.0869
NP_440376.1_1 Forward -289 -280 5.21127 0.144
NP_441857.1_2 Forward -328 -309 18.3095 0.243
NP_441857.1_5 Forward -34 -16 6.41066 0.189
NP_441588.1_4 Reverse -20 -30 7.35486 0.178
NP_442730.1_8 Forward -35 -16 7.96345 0.189
NP_443065.1_6 Forward -31 -12 3.53937 0.221
NP_442687.1_7 Reverse -17 -27 18.5646 0.0028
NP_442687.1_7 Forward -28 -18 15.8113 0.0125
NP_442687.1_7 Forward -340 -330 14.7297 0.0256
NP_442958.1_3 Forward -83 -64 -2.95047 0.299
NP_441013.1_2 Forward -32 -14 -2.3408 0.282
NP_441422.1_7 Forward -29 -12 -1.33779 0.186
NP_440691.1_8 Reverse -83 -100 13.2152 0.272
NP_440533.1_9 Reverse -330 -349 4.03102 0.238
NP_442658.1_1 Forward -29 -19 15.9091 0.00966
NP_442658.1_1 Reverse -16 -26 14.8275 0.0188
NP_442658.1_1 Reverse -328 -338 7.55106 0.214
NP_440141.1_8 Reverse -265 -284 9.14423 0.227
NP_442782.1_2 Forward -27 -13 2.94952 0.269
NP_442205.1_9 Reverse -12 -28 -2.69473 0.272
NP_441414.1_9 Reverse -18 -37 -6.1954 0.19
NP_440607.1_3 Forward -396 -377 17.7965 0.181
NP_441487.1_7 Forward -354 -335 8.16093 0.238
NP_442300.1_3 Reverse -329 -348 12.3892 0.0591
NP_442937.1_5 Reverse -46 -65 11.1109 0.145
NP_442937.1_5 Reverse -325 -344 7.37428 0.254
NP_442937.1_5 Forward -80 -61 6.78429 0.27
NP_442937.1_5 Reverse -49 -68 6.4893 0.278
NP_442321.1_4 Forward -348 -329 -8.45701 0.289
NP_441958.1_5 Reverse -17 -27 20.5312 0.000966
NP_441958.1_5 Forward -28 -18 12.2714 0.00183
NP_441958.1_5 Reverse -329 -339 1.35667 0.0987
NP_441958.1_5 Forward -340 -330 1.16001 0.114
NP_441127.1_1 Reverse -360 -374 10.226 0.255
NP_440950.1_2 Forward -304 -285 12.5858 0.145
NP_440984.1_7 Forward -32 -18 9.63603 0.127
NP_442911.1_2 Forward -37 -18 3.53937 0.0428
NP_442911.1_2 Reverse -8 -27 -3.14714 0.109
NP_442911.1_2 Forward -349 -330 -3.93378 0.122
NP_440153.1_8 Forward -345 -332 -3.52063 0.295
NP_440153.1_8 Forward -339 -326 -3.61896 0.296
NP_441941.1_9 Reverse -343 -362 1.27776 0.268
NP_443055.1_6 Forward -267 -249 -1.55487 0.28
NP_440993.1_3 Forward -37 -18 1.57197 0.226
NP_440138.1_6 Forward -26 -7 7.66846 0.204
NP_442002.1_9 Reverse -17 -24 14.1004 0.074
NP_442002.1_9 Forward -28 -21 10.7572 0.185
NP_441646.1_1 Forward -379 -360 0.786102 0.243
NP_442438.1_10 Forward -32 -18 11.111 0.0463
NP_442438.1_10 Reverse -13 -27 4.12949 0.152
NP_442438.1_10 Reverse -49 -63 0.294584 0.232
NP_442431.1_10 Reverse -45 -63 2.28076 0.241
NP_441000.1_6 Reverse -17 -31 -2.95034 0.221
NP_441000.1_6 Forward -28 -14 -5.40861 0.275
NP_442771.1_1 Reverse -328 -346 4.44404 0.0672
NP_442771.1_1 Reverse -49 -67 -2.73412 0.166
NP_442771.1_1 Reverse -16 -34 -7.35568 0.17
NP_440147.1_4 Forward -29 -16 12.9006 0.0326
NP_440147.1_4 Forward -374 -361 6.4108 0.0939
NP_440147.1_4 Reverse -16 -29 2.77255 0.202
NP_440147.1_4 Forward -341 -328 1.88757 0.216
NP_441125.1_1 Reverse -27 -46 10.5209 0.201
NP_441295.1_4 Forward -344 -325 3.34271 0.29
NP_441550.1_8 Reverse -16 -26 15.4175 0.0132
NP_441550.1_8 Forward -29 -19 8.3377 0.124
NP_441916.1_7 Reverse -18 -28 18.4663 0.00144
NP_441916.1_7 Forward -27 -17 16.893 0.00407
NP_441916.1_7 Forward -339 -329 5.5849 0.128
NP_441916.1_7 Reverse -330 -340 4.69992 0.163
NP_441916.1_10 Reverse -334 -353 0.294447 0.286
NP_440465.1_10 Reverse -360 -379 3.73603 0.247
NP_441041.1_4 Reverse -25 -44 -0.0988766 0.0928
NP_441041.1_4 Reverse -330 -349 -6.29373 0.166
NP_441041.1_7 Forward -30 -18 15.6777 0.0222
NP_441041.1_7 Reverse -15 -27 9.94422 0.104
NP_441547.1_2 Forward -214 -196 7.00065 0.215
NP_442004.1_6 Forward -27 -13 9.93102 0.14
NP_440703.1_9 Forward -345 -332 12.3101 0.192
NP_441725.1_5 Forward -26 -16 21.0229 0.00533
NP_441725.1_5 Forward -338 -328 6.66654 0.112
NP_441725.1_5 Reverse -331 -341 2.33998 0.115
NP_441725.1_5 Reverse -19 -29 2.04498 0.115
NP_439966.1_7 Forward -29 -19 9.91099 0.0968
NP_439966.1_7 Reverse -16 -26 9.12434 0.119
NP_439966.1_9 Forward -29 -20 0.884706 0.253
NP_442941.1_3 Forward -26 -16 11.3864 0.0116
NP_442941.1_3 Reverse -19 -29 2.63497 0.14
NP_440289.1_2 Reverse -15 -28 6.4108 0.0596
NP_440289.1_2 Forward -30 -17 5.91914 0.0605
NP_440289.1_2 Forward -342 -329 -3.4223 0.267
NP_440289.1_2 Reverse -327 -340 -4.50394 0.288
NP_440983.1_5 Forward -351 -332 1.57275 0.209
NP_440983.1_5 Forward -72 -53 -6.29373 0.276
NP_440983.1_5 Forward -60 -41 -8.16202 0.294
NP_440983.1_9 Forward -298 -279 7.47261 0.255
NP_442281.1_1 Forward -32 -18 20.4518 0.00192
NP_442281.1_1 Reverse -13 -27 19.4684 0.00282
NP_442281.1_1 Forward -344 -330 8.16044 0.0845
NP_440177.1_9 Reverse -322 -341 12.6841 0.229
NP_440437.1_1 Forward -345 -326 4.32602 0.106
NP_440437.1_1 Forward -33 -14 -3.73712 0.244
NP_442012.1_1 Forward -33 -14 11.7992 0.0735
NP_442012.1_1 Forward -345 -326 5.40766 0.153
NP_442012.1_1 Reverse -12 -31 1.47442 0.215
NP_441556.1_10 Forward -32 -18 13.0446 0.182
NP_442982.1_5 Forward -349 -330 -1.7705 0.269
NP_440375.1_6 Forward -355 -336 11.3075 0.239
NP_440375.1_9 Forward -116 -97 16.3809 0.208
NP_441644.1_6 Forward -27 -17 15.7125 0.0048
NP_441644.1_6 Reverse -330 -340 11.3859 0.0502
NP_441644.1_6 Reverse -18 -28 10.1076 0.0628
NP_441644.1_6 Forward -339 -329 4.40448 0.239
NP_441644.1_6 Forward -372 -362 4.30615 0.242
NP_442215.1_1 Forward -349 -330 2.75272 0.293
NP_442215.1_2 Forward -29 -13 6.74504 0.0702
NP_442215.1_2 Reverse -16 -32 0.55019 0.15
NP_442215.1_2 Forward -354 -338 -3.67804 0.22
NP_442215.1_2 Reverse -328 -344 -4.1697 0.228
NP_442177.1_5 Reverse -333 -347 11.2093 0.22
NP_441810.1_2 Forward -269 -250 13.1758 0.12
NP_442029.1_6 Reverse -13 -32 3.83436 0.275
NP_440929.1_8 Forward -27 -18 19.2726 0.000701
NP_440929.1_8 Reverse -18 -27 19.2726 0.000701
NP_442933.1_10 Forward -27 -18 17.601 0.00325
NP_442933.1_10 Reverse -18 -27 17.601 0.00325
NP_442933.1_10 Reverse -330 -339 5.11294 0.204
NP_441751.2_8 Forward -26 -12 5.60446 0.0419
NP_442926.1_5 Forward -32 -13 20.9487 0.0294
NP_442554.1_4 Reverse -110 -129 6.19431 0.291
NP_442554.1_8 Forward -26 -16 14.828 0.0108
NP_442554.1_8 Reverse -19 -29 13.2547 0.0187
NP_442554.1_8 Forward -338 -328 6.37155 0.12
NP_442554.1_8 Reverse -331 -341 4.3066 0.189
NP_442970.1_1 Reverse -134 -148 10.9932 0.269
NP_441762.1_7 Reverse -17 -29 18.7219 0.00342
NP_441762.1_7 Forward -28 -16 2.20226 0.0676
NP_442142.1_4 Reverse -15 -28 17.7182 0.0255
NP_442142.1_4 Forward -30 -17 7.19687 0.144
NP_442142.1_4 Forward -348 -335 6.60689 0.16
NP_442292.1_1 Reverse -19 -28 9.63616 0.0183
NP_442292.1_1 Forward -26 -17 9.53783 0.0183
NP_440511.1_1 Reverse -38 -56 5.42735 0.245
NP_442476.1_6 Reverse -19 -33 5.1128 0.139
NP_440895.1_10 Forward -337 -320 -5.46769 0.29
NP_442381.1_8 Forward -30 -11 -14.1602 0.28
NP_443009.1_5 Reverse -17 -28 20.6093 0.001
NP_443009.1_5 Forward -28 -17 9.10461 0.0965
NP_443009.1_5 Forward -340 -329 6.54802 0.157
NP_443009.1_5 Reverse -362 -373 4.97473 0.222
NP_441726.1_7 Forward -191 -172 6.09597 0.248
NP_442301.1_2 Forward -346 -327 7.17681 0.257
NP_442301.1_2 Forward -70 -51 6.39016 0.263
NP_441715.1_4 Reverse -19 -29 9.41981 0.097
NP_441715.1_4 Forward -26 -16 7.25653 0.108
NP_440183.1_9 Reverse -196 -215 -15.4385 0.273
NP_441198.1_8 Reverse -16 -26 13.076 0.108
NP_441468.1_1 Forward -26 -19 15.8704 0.0124
NP_441468.1_1 Reverse -19 -26 15.8704 0.0124
NP_441468.1_1 Reverse -331 -338 4.46401 0.224
NP_441020.2_6 Reverse -328 -345 19.705 0.00725
NP_441020.2_6 Forward -29 -12 17.5418 0.0183
NP_441020.2_6 Reverse -16 -33 9.38028 0.173
NP_441020.2_6 Reverse -40 -57 6.43035 0.262
NP_441015.1_9 Reverse -185 -198 16.5383 0.246
NP_441015.1_10 Reverse -13 -32 4.81767 0.123
NP_441015.1_10 Reverse -331 -350 0.392778 0.165
NP_441015.1_10 Reverse -52 -71 -10.522 0.284
NP_441015.1_10 Reverse -325 -344 -11.0136 0.29
NP_441673.1_1 Forward -27 -18 20.8459 0.000698
NP_441673.1_1 Reverse -18 -27 20.8459 0.000698
NP_441673.1_1 Reverse -330 -339 1.67135 0.0404
NP_441673.1_1 Forward -339 -330 1.47469 0.0936
NP_441826.1_2 Forward -345 -331 5.01447 0.0978
NP_441826.1_2 Forward -33 -19 5.01447 0.0978
NP_441826.1_2 Reverse -12 -26 3.24451 0.113
NP_441330.1_1 Reverse -13 -32 -4.52377 0.0983
NP_442490.1_9 Forward -351 -332 -7.27704 0.278
NP_442868.1_6 Reverse -16 -26 9.22315 0.0527
NP_442868.1_6 Forward -29 -19 0.865012 0.205
NP_442868.1_6 Forward -341 -331 0.176696 0.247
NP_442719.1_2 Reverse -178 -196 -9.51964 0.266
NP_441251.1_7 Reverse -266 -279 14.7689 0.266
NP_441056.1_1 Forward -27 -8 -0.688862 0.166
NP_442227.1_2 Forward -67 -48 -3.93378 0.3
NP_442361.1_3 Forward -33 -20 7.88576 0.285
NP_441911.1_7 Forward -129 -110 -19.0774 0.275
NP_442808.1_1 Forward -28 -18 18.4657 0.00201
NP_442808.1_1 Reverse -17 -27 8.73102 0.0481
NP_442808.1_1 Forward -373 -363 3.8145 0.222
NP_442808.1_1 Reverse -279 -289 3.22451 0.247
NP_441101.1_1 Reverse -361 -379 12.9005 0.231
NP_442542.1_2 Reverse -328 -341 21.4554 0.00555
NP_442542.1_2 Forward -29 -16 11.1307 0.114
NP_442542.1_2 Reverse -64 -77 5.52582 0.262
NP_442505.1_4 Reverse -175 -194 15.7324 0.173
NP_442050.1_5 Reverse -16 -26 15.8108 0.0091
NP_440558.1_2 Reverse -9 -28 -3.83545 0.239
NP_440558.1_2 Forward -348 -329 -5.50708 0.26
NP_441878.1_6 Reverse -17 -27 20.2362 0.0046
NP_441878.1_6 Reverse -329 -339 12.3697 0.00946
NP_441878.1_6 Forward -28 -18 10.4031 0.0176
NP_441878.1_6 Forward -340 -330 9.7148 0.0237
NP_441878.1_6 Reverse -50 -60 -7.29646 0.217
NP_441036.1_8 Forward -28 -18 17.7779 0.000554
NP_441036.1_8 Reverse -17 -27 8.4365 0.174
NP_441557.1_5 Forward -27 -18 19.9609 0.000699
NP_441557.1_5 Reverse -18 -27 19.9609 0.000699
NP_441557.1_5 Reverse -330 -339 0.786375 0.106
NP_441557.1_5 Forward -339 -330 0.589713 0.134
NP_441445.1_1 Reverse -9 -28 12.9791 0.0621
NP_441445.1_1 Forward -84 -65 2.45773 0.233
NP_441445.1_1 Reverse -45 -64 1.86774 0.247
NP_441590.1_1 Forward -67 -48 10.9142 0.256
NP_442066.2_4 Reverse -18 -37 -9.14533 0.296
NP_442419.1_2 Forward -32 -13 9.83255 0.122
NP_440738.1_5 Forward -23 -4 0.58944 0.297
NP_441308.1_8 Reverse -361 -371 14.4347 0.218
NP_440101.1_3 Reverse -13 -32 3.53937 0.227
NP_440101.1_3 Forward -32 -13 2.94938 0.242
NP_441458.1_10 Reverse -9 -28 6.98095 0.196
NP_442183.1_1 Forward -27 -13 14.0609 0.037
NP_442397.1_9 Reverse -330 -349 3.04771 0.264
NP_441459.1_3 Forward -348 -329 14.4312 0.223
NP_441574.1_1 Reverse -51 -70 -1.37718 0.216
NP_441549.1_9 Reverse -326 -344 -10.3056 0.274
NP_440861.1_3 Reverse -7 -25 9.65558 0.296
NP_442347.1_2 Reverse -19 -28 11.1111 0.056
NP_442347.1_2 Reverse -364 -373 6.8829 0.145
NP_442347.1_2 Forward -26 -17 3.34298 0.284
NP_442347.1_8 Forward -341 -322 3.04771 0.261
NP_442645.1_2 Reverse -10 -29 -5.11376 0.0645
NP_441037.1_4 Forward -29 -19 14.7245 0.028
NP_441037.1_4 Reverse -16 -26 9.65667 0.21
NP_441037.1_4 Reverse -328 -338 8.19481 0.237
NP_442594.1_7 Forward -38 -19 4.71854 0.264
NP_442594.1_8 Reverse -42 -61 2.16274 0.295
NP_441633.1_3 Forward -29 -16 12.8023 0.0192
NP_441633.1_3 Reverse -16 -29 -5.78224 0.236
NP_440136.1_2 Forward -26 -19 15.9687 0.0123
NP_440136.1_2 Reverse -19 -26 15.9687 0.0123
NP_442998.1_10 Forward -25 -18 15.5754 0.0102
NP_442998.1_10 Reverse -20 -27 15.5754 0.0102
NP_440299.1_1 Forward -31 -18 20.1765 0.00128
NP_440299.1_1 Forward -343 -330 14.375 0.0259
NP_440299.1_1 Reverse -14 -27 9.45847 0.0709
NP_440299.1_1 Forward -64 -51 3.46031 0.243
NP_441799.1_1 Reverse -14 -28 15.4369 0.0182
NP_441799.1_1 Forward -376 -362 3.63724 0.289
NP_441007.1_10 Reverse -325 -338 7.29578 0.145
NP_441007.1_10 Reverse -13 -26 1.78924 0.203
NP_442201.1_10 Forward -38 -19 -6.88371 0.184
NP_440256.1_1 Reverse -15 -34 -0.000545616 0.0884
NP_440256.1_1 Forward -30 -11 -2.75381 0.122
NP_441559.1_8 Forward -32 -18 2.35953 0.145
NP_441559.1_8 Reverse -358 -372 -0.000409212 0.171
NP_441559.1_8 Forward -294 -280 -5.70361 0.27
NP_440915.1_6 Forward -31 -17 13.3726 0.0187
NP_440915.1_6 Reverse -326 -340 3.04785 0.109
NP_442785.1_7 Forward -348 -334 12.7826 0.228
NP_441704.1_8 Reverse -7 -26 8.75009 0.202
NP_441464.1_8 Forward -339 -325 15.5359 0.102
NP_441464.1_8 Forward -60 -46 4.52282 0.269
NP_441199.1_6 Forward -31 -12 7.86593 0.115
NP_441199.1_6 Forward -376 -357 0.786102 0.233
NP_441494.1_6 Forward -344 -331 5.62415 0.298
NP_442993.1_1 Forward -27 -11 -9.38124 0.185
NP_442386.1_9 Forward -28 -19 15.7322 0.0144
NP_442386.1_9 Reverse -17 -26 6.39082 0.219
NP_440570.1_5 Reverse -320 -339 -0.983855 0.266
NP_441750.1_1 Reverse -45 -64 -13.0786 0.3
NP_441340.1_5 Forward -26 -19 15.6737 0.0124
NP_441340.1_5 Reverse -19 -26 15.6737 0.0124
NP_441340.1_5 Forward -338 -331 3.97235 0.274
NP_442484.1_2 Forward -38 -19 -1.18052 0.287
NP_440168.1_4 Forward -349 -330 -4.13045 0.255
NP_440168.1_10 Reverse -326 -345 16.0274 0.257
NP_441248.1_2 Reverse -253 -267 15.2409 0.187
NP_442240.1_2 Reverse -19 -38 -11.1119 0.137
NP_440586.1_1 Reverse -47 -66 -2.16383 0.25
NP_440586.1_1 Reverse -326 -345 -2.55715 0.254
NP_440586.1_8 Forward -26 -19 13.2151 0.026
NP_440586.1_8 Reverse -19 -26 13.2151 0.026
NP_442251.1_6 Forward -26 -19 15.2804 0.0124
NP_442251.1_6 Reverse -19 -26 15.2804 0.0124
NP_440192.1_4 Forward -198 -179 15.898 0.169
NP_441262.1_3 Reverse -18 -25 14.7888 0.0223
NP_441262.1_3 Forward -27 -20 14.7888 0.0223
NP_440027.1_3 Forward -345 -327 13.9813 0.121
NP_440027.1_8 Forward -354 -335 4.12856 0.292
NP_443051.1_1 Reverse -17 -26 18.0926 0.00402
NP_443051.1_1 Forward -28 -19 10.4228 0.00754
NP_443051.1_1 Reverse -329 -338 -1.08191 0.281
NP_439984.1_8 Forward -123 -105 16.3421 0.265
NP_439937.1_9 Reverse -17 -34 0.92312 0.0951
NP_439937.1_9 Forward -28 -11 -16.678 0.287
NP_442294.1_3 Forward -131 -117 14.1586 0.248
NP_440398.1_6 Forward -278 -259 5.70265 0.275
NP_440408.1_7 Reverse -12 -31 11.8975 0.212
NP_440439.1_1 Forward -30 -17 10.5407 0.0365
NP_440439.1_1 Reverse -15 -28 7.39411 0.0659
NP_440372.1_2 Forward -26 -19 16.3621 0.0124
NP_440372.1_2 Reverse -19 -26 16.3621 0.0124
NP_440316.1_10 Reverse -335 -345 9.32148 0.235
NP_440316.1_10 Reverse -329 -339 6.46988 0.257
NP_441803.1_2 Reverse -13 -32 10.3242 0.0865
NP_439977.1_5 Forward -33 -14 -1.67217 0.257
NP_440139.1_1 Reverse -12 -31 4.81688 0.17
NP_442416.1_1 Forward -137 -118 6.06331 0.276
NP_441572.1_1 Reverse -40 -59 -4.52377 0.235
NP_441572.1_7 Forward -33 -14 7.86593 0.0744
NP_440267.1_2 Reverse -13 -27 7.47213 0.196
NP_442384.1_10 Reverse -18 -31 15.7522 0.00946
NP_442384.1_10 Forward -27 -14 9.06573 0.0574
NP_442384.1_10 Reverse -330 -343 7.78743 0.0743
NP_442384.1_10 Reverse -280 -293 4.8375 0.145
NP_442384.1_10 Reverse -363 -376 4.54251 0.153
NP_441604.1_4 Forward -35 -16 -6.98204 0.293
NP_441018.1_7 Reverse -332 -351 7.86593 0.263
NP_442262.1_10 Forward -26 -19 14.1988 0.0123
NP_442262.1_10 Reverse -19 -26 14.1988 0.0123
NP_441689.1_5 Reverse -16 -26 8.63269 0.132
NP_440344.1_10 Forward -34 -17 2.59545 0.0282
NP_440344.1_10 Reverse -11 -28 -0.747806 0.0454
NP_440344.1_10 Reverse -59 -76 -10.4826 0.182
NP_440282.1_10 Forward -349 -330 0.0977854 0.196
NP_440531.1_6 Reverse -10 -29 -3.04881 0.26
NP_440531.1_6 Reverse -355 -374 -4.03212 0.273
NP_442123.1_3 Forward -27 -8 14.0608 0.153
NP_442910.1_1 Forward -34 -15 -4.13045 0.254
NP_441965.1_10 Reverse -360 -376 4.87675 0.228
NP_441965.1_10 Reverse -15 -31 2.32015 0.288
NP_442556.1_7 Forward -372 -353 11.8975 0.135
NP_442556.1_10 Forward -135 -116 8.35335 0.294
NP_440297.1_1 Forward -378 -359 12.8808 0.134
NP_440297.1_9 Forward -26 -16 19.0562 0.0359
NP_440297.1_9 Reverse -331 -341 9.32148 0.0917
NP_440297.1_9 Forward -338 -328 0.373358 0.282
NP_440297.1_9 Reverse -19 -29 -0.118297 0.282
NP_440894.1_10 Forward -32 -13 4.71934 0.244
NP_442067.1_4 Reverse -7 -26 4.42435 0.256
NP_440999.1_9 Forward -31 -17 10.816 0.049
NP_440999.1_9 Forward -67 -53 -0.590395 0.212
NP_440999.1_9 Forward -343 -329 -0.787057 0.217
NP_440999.1_9 Forward -373 -359 -1.47537 0.239
NP_440888.1_2 Reverse -18 -32 9.83206 0.113
NP_440888.1_2 Forward -27 -13 5.30886 0.284
NP_440491.1_1 Reverse -15 -34 9.06107 0.219
NP_440052.1_5 Forward -38 -19 -1.08219 0.194
NP_440052.1_8 Forward -83 -64 9.43923 0.256
NP_439969.1_3 Forward -32 -13 5.99764 0.178
NP_442277.1_4 Forward -36 -17 3.14526 0.228
NP_441123.1_6 Forward -347 -329 16.2438 0.132
NP_442077.1_9 Forward -224 -205 -0.688862 0.22
NP_441543.1_2 Reverse -19 -28 18.486 0.00236
NP_441543.1_2 Forward -26 -17 9.34117 0.0818
NP_442845.1_2 Reverse -330 -344 13.1759 0.0986
NP_442845.1_2 Forward -33 -19 4.03116 0.271
NP_442845.1_2 Forward -27 -13 3.34284 0.294
NP_441469.1_8 Forward -28 -19 16.126 0.00797
NP_441469.1_8 Reverse -17 -26 13.3727 0.073
NP_441469.1_8 Reverse -329 -338 10.4228 0.216
NP_442637.1_7 Forward -325 -306 9.43923 0.163
NP_443064.1_6 Forward -27 -17 13.8273 0.0796
NP_442337.1_6 Reverse -335 -354 13.7393 0.245
NP_442578.1_7 Forward -26 -19 14.5921 0.026
NP_442578.1_7 Reverse -19 -26 14.5921 0.026
NP_441462.1_2 Forward -27 -17 20.1379 0.000967
NP_441462.1_2 Reverse -18 -28 11.5831 0.00406
NP_441462.1_2 Forward -339 -329 8.82982 0.03
NP_441462.1_2 Reverse -330 -340 0.963343 0.109
NP_441621.1_7 Reverse -16 -30 4.62115 0.0934
NP_441621.1_7 Forward -29 -15 -3.44199 0.188
NP_443062.1_1 Reverse -18 -36 6.49827 0.198
NP_443062.1_6 Forward -35 -16 5.80098 0.193
NP_440519.1_8 Reverse -330 -346 4.18844 0.232
NP_442204.1_1 Forward -31 -20 8.7118 0.0852
NP_442204.1_1 Reverse -14 -25 0.0586712 0.284
NP_442204.1_5 Forward -37 -18 4.42435 0.167
NP_442204.1_5 Reverse -8 -27 0.982764 0.249
NP_441560.1_10 Reverse -10 -29 6.09597 0.292
NP_440544.1_5 Forward -124 -117 14.5681 0.264
NP_442487.1_2 Forward -257 -238 1.86696 0.259
NP_440255.1_7 Reverse -110 -127 9.67528 0.277
NP_440516.1_8 Forward -27 -18 16.9127 0.00442
NP_440516.1_8 Reverse -18 -27 16.9127 0.00442
NP_442080.1_7 Forward -32 -13 -2.95047 0.287
NP_442428.1_4 Reverse -329 -348 18.1907 0.0973
NP_442428.1_5 Forward -26 -19 15.8704 0.0124
NP_442428.1_5 Reverse -19 -26 15.8704 0.0124
NP_442428.1_5 Reverse -364 -371 7.90559 0.0969
NP_442428.1_5 Reverse -331 -338 4.759 0.223
NP_440673.1_3 Forward -25 -18 12.4288 0.0426
NP_440673.1_3 Reverse -20 -27 12.4288 0.0426
NP_440865.1_9 Reverse -12 -31 10.1275 0.0497
NP_441052.1_2 Reverse -18 -28 10.5014 0.0285
NP_441052.1_2 Forward -27 -17 10.4031 0.0285
NP_441052.1_2 Reverse -66 -76 3.91327 0.17
NP_441052.1_2 Reverse -363 -373 3.22496 0.182
NP_441052.1_2 Forward -66 -56 1.55333 0.238
NP_442219.1_8 Reverse -368 -387 8.07047 0.257
NP_442219.1_9 Reverse -19 -28 8.35786 0.0681
NP_442219.1_9 Forward -26 -17 8.25953 0.0681
NP_440436.1_4 Reverse -19 -28 18.1905 0.00233
NP_440436.1_4 Forward -26 -17 15.9289 0.00508
NP_441884.1_8 Reverse -17 -36 -8.35868 0.262
NP_441884.1_8 Forward -28 -9 -9.047 0.268
NP_441884.1_9 Reverse -63 -82 -22.6167 0.281
NP_442864.1_3 Forward -33 -14 15.3391 0.128
NP_440314.1_9 Forward -338 -319 -8.16202 0.245
NP_440314.1_9 Reverse -177 -196 -9.24366 0.262
NP_441719.1_4 Forward -26 -19 16.3621 0.0124
NP_441719.1_4 Reverse -19 -26 16.3621 0.0124
NP_441733.1_10 Reverse -15 -28 7.19745 0.156
NP_441733.1_10 Forward -30 -17 5.91914 0.203
NP_441004.1_1 Reverse -45 -64 -8.26035 0.2
NP_441004.1_1 Reverse -324 -343 -16.3235 0.284
NP_441004.1_1 Reverse -12 -31 -17.2085 0.29
NP_442366.1_3 Reverse -17 -35 15.6538 0.0199
NP_442366.1_3 Forward -28 -10 -4.30741 0.268
NP_442366.1_5 Forward -30 -20 11.9759 0.148
NP_442873.1_9 Forward -70 -51 3.44025 0.289
NP_441115.1_4 Reverse -17 -35 9.16315 0.223
NP_442206.1_10 Reverse -18 -33 0.864876 0.243
NP_442854.1_4 Reverse -195 -214 16.0265 0.171
NP_440328.1_4 Forward -33 -14 6.68596 0.129
NP_440328.1_4 Forward -378 -359 1.86774 0.213
NP_443054.1_2 Reverse -16 -30 12.8809 0.0722
NP_443054.1_2 Forward -77 -63 1.08123 0.251
NP_442308.1_8 Reverse -194 -213 11.2092 0.231
NP_441851.1_10 Reverse -17 -27 17.4829 0.0027
NP_441851.1_10 Forward -28 -18 16.008 0.00552
NP_441851.1_10 Reverse -329 -339 6.56821 0.161
NP_441668.1_4 Reverse -320 -339 2.45773 0.198
NP_442515.1_1 Forward -340 -326 14.3559 0.0277
NP_442515.1_1 Forward -28 -14 3.63784 0.115
NP_442515.1_1 Forward -61 -47 -4.7203 0.298
NP_441683.1_7 Reverse -42 -61 -11.8003 0.284
NP_440593.1_3 Forward -32 -13 -7.67036 0.298
NP_442709.1_3 Reverse -11 -30 3.24438 0.288
NP_441046.1_2 Reverse -43 -62 1.47442 0.256
NP_441349.1_10 Reverse -8 -27 17.8957 0.00795
NP_441349.1_10 Forward -37 -18 1.0811 0.0851
NP_441409.1_6 Forward -33 -14 -6.29373 0.124
NP_440432.1_9 Forward -338 -323 12.9596 0.0222
NP_440432.1_9 Forward -59 -44 -6.31328 0.296
NP_439960.1_4 Reverse -335 -354 17.3048 0.14
NP_440726.1_2 Forward -349 -330 3.73603 0.226
NP_442450.1_5 Reverse -16 -26 19.1546 0.0103
NP_442450.1_5 Forward -29 -19 7.55152 0.13
NP_442450.1_5 Forward -341 -331 7.05986 0.145
NP_442168.1_5 Forward -26 -7 4.916 0.208
NP_440588.1_2 Forward -36 -17 23.3039 0.00766
NP_440588.1_2 Reverse -9 -28 -0.885524 0.154
NP_440588.1_2 Forward -348 -329 -4.13045 0.207
NP_442006.1_2 Reverse -321 -338 -16.0874 0.238
NP_442006.1_2 Reverse -42 -59 -16.1858 0.243
NP_441570.1_1 Forward -27 -9 1.29745 0.0315
NP_440078.1_10 Reverse -54 -73 9.3409 0.196
NP_441078.1_4 Forward -27 -18 19.6659 0.0007
NP_441078.1_4 Reverse -18 -27 19.6659 0.0007
NP_441078.1_4 Reverse -330 -339 7.96454 0.0404
NP_441078.1_4 Reverse -280 -289 5.11294 0.118
NP_441078.1_4 Reverse -363 -372 5.01461 0.122
NP_441078.1_4 Forward -339 -330 0.786375 0.157
NP_441078.1_4 Reverse -66 -75 -1.18024 0.237
NP_441078.1_4 Forward -289 -280 -1.18024 0.237
NP_441663.1_8 Forward -33 -14 1.17943 0.212
NP_442443.1_1 Reverse -355 -374 -4.42544 0.272
NP_440526.1_3 Forward -26 -15 8.61296 0.118
NP_440526.1_3 Forward -338 -327 1.92649 0.267
NP_441432.1_8 Reverse -17 -26 8.35786 0.0755
NP_441432.1_8 Forward -28 -19 8.25953 0.0755
NP_441432.1_8 Forward -290 -281 3.04799 0.268
NP_441432.1_9 Forward -124 -111 14.5127 0.143
NP_442320.1_8 Forward -33 -19 6.48943 0.0272
NP_442320.1_8 Reverse -12 -26 -2.45868 0.0894
NP_441732.1_2 Forward -31 -15 -7.61128 0.0861
NP_441732.1_2 Forward -361 -345 -16.7561 0.195
NP_441732.1_2 Forward -343 -327 -17.0511 0.231
NP_441732.1_2 Reverse -14 -30 -17.0511 0.231
NP_440629.1_6 Reverse -12 -31 12.2126 0.289
NP_440759.1_6 Reverse -200 -219 13.3725 0.0644
NP_440760.1_1 Forward -339 -320 -21.4367 0.237
NP_440760.1_1 Reverse -18 -37 -22.125 0.249
NP_442797.1_7 Forward -346 -328 15.1621 0.11
NP_442353.1_4 Forward -215 -196 0.588665 0.268
NP_442353.1_4 Forward -258 -239 -0.787962 0.291
NP_440913.1_3 Forward -345 -332 15.4572 0.215
NP_440713.1_4 Forward -367 -348 5.211 0.214
NP_442489.1_7 Forward -27 -18 20.1576 0.000695
NP_442489.1_7 Reverse -18 -27 20.1576 0.000695
NP_442489.1_7 Reverse -330 -339 8.45619 0.0206
NP_442489.1_7 Forward -339 -330 0.786375 0.152
NP_442489.1_7 Reverse -363 -372 -1.77023 0.247
NP_442079.1_7 Forward -26 -7 0.196116 0.286
NP_440559.1_1 Forward -26 -17 17.306 0.00658
NP_440559.1_1 Reverse -19 -28 8.75118 0.0586
NP_441659.2_8 Forward -27 -17 19.3512 0.000966
NP_441659.2_8 Forward -339 -329 14.3364 0.0092
NP_441659.2_8 Reverse -18 -28 11.9764 0.0147
NP_441659.2_8 Reverse -330 -340 0.176696 0.271
NP_441022.1_1 Reverse -209 -218 12.3136 0.238
NP_441040.1_2 Forward -36 -17 -14.2585 0.285
NP_441040.1_2 Reverse -328 -347 -15.9302 0.289
NP_441040.1_5 Forward -32 -13 4.81767 0.244
NP_442008.1_2 Reverse -15 -34 6.98095 0.216
NP_441800.1_3 Reverse -331 -349 4.14905 0.289
NP_442346.1_5 Reverse -17 -27 17.9746 0.00128
NP_442346.1_5 Forward -340 -330 12.9597 0.0318
NP_442346.1_5 Forward -28 -18 9.02648 0.118
NP_442346.1_5 Reverse -329 -339 7.74818 0.159
NP_440352.1_5 Reverse -20 -39 14.1158 0.16
NP_440545.1_3 Reverse -14 -31 6.52869 0.0551
NP_440545.1_3 Forward -31 -14 5.05372 0.0646
NP_440545.1_3 Reverse -326 -343 3.97208 0.0764
NP_440545.1_3 Forward -343 -326 -3.79607 0.212
NP_440545.1_3 Reverse -50 -67 -4.97604 0.237
NP_441923.1_6 Reverse -355 -369 8.65272 0.278
NP_440486.1_6 Reverse -17 -36 6.58763 0.283
NP_440459.1_2 Reverse -16 -33 13.0185 0.131
NP_440010.1_10 Reverse -333 -352 7.27595 0.226
NP_441943.1_8 Forward -348 -329 -13.5702 0.28
NP_442551.1_4 Reverse -328 -343 1.65152 0.245
NP_442603.1_7 Forward -354 -340 6.58715 0.236
NP_441888.1_7 Forward -32 -18 3.73617 0.225
NP_440449.1_6 Forward -35 -17 8.25583 0.203
NP_441948.1_4 Reverse -11 -29 5.62401 0.0747
NP_441358.1_2 Reverse -25 -44 6.78429 0.275
NP_441833.1_4 Forward -26 -19 15.9687 0.0124
NP_441833.1_4 Reverse -19 -26 15.9687 0.0124
NP_441329.1_6 Reverse -108 -127 -2.53096 0.294
NP_441895.1_2 Reverse -313 -332 -17.7985 0.234
NP_442162.1_9 Forward -26 -19 16.2637 0.0124
NP_442162.1_9 Reverse -19 -26 16.2637 0.0124
NP_440671.1_4 Reverse -12 -26 16.9125 0.0246
NP_440671.1_4 Forward -33 -19 10.226 0.163
NP_441915.1_4 Forward -204 -185 12.6833 0.229
NP_442199.1_5 Reverse -10 -29 1.27776 0.165
NP_442199.1_5 Forward -380 -361 -7.27704 0.292
NP_442140.1_3 Reverse -19 -29 16.2046 0.0255
NP_442140.1_3 Forward -26 -16 5.68323 0.198
NP_442723.1_1 Forward -38 -19 1.96529 0.292
NP_440875.1_9 Reverse -20 -30 9.15072 0.233
NP_441813.1_5 Reverse -16 -26 16.1063 0.01
NP_441813.1_5 Forward -29 -19 9.91146 0.021
NP_440590.1_4 Reverse -19 -32 11.6223 0.019
NP_440567.1_1 Reverse -19 -33 15.8309 0.0166
NP_440567.1_1 Forward -26 -12 0.294584 0.25
NP_442497.1_10 Forward -26 -17 19.8626 0.00532
NP_442497.1_10 Reverse -19 -28 10.4228 0.0087
NP_442497.1_10 Reverse -331 -340 0.688044 0.141
NP_442497.1_10 Forward -338 -329 0.491382 0.162
NP_440821.1_4 Reverse -16 -26 19.8429 0.00399
NP_440821.1_4 Forward -29 -19 10.2065 0.0163
NP_440821.1_4 Forward -341 -331 0.471689 0.174
NP_440821.1_4 Reverse -328 -338 0.373358 0.18
NP_440227.1_2 Forward -194 -178 7.53169 0.295
NP_441239.1_9 Forward -29 -17 15.8703 0.0178
NP_441239.1_9 Reverse -16 -28 14.297 0.0288
NP_441239.1_9 Reverse -328 -340 8.59377 0.128
NP_441239.1_9 Forward -341 -329 6.33216 0.193
NP_441892.1_1 Reverse -9 -26 10.0686 0.0683
NP_440665.1_1 Forward -369 -350 -12.5869 0.251
NP_440665.1_1 Reverse -348 -367 -12.9802 0.256
NP_442669.1_1 Reverse -174 -193 15.3391 0.00655
NP_440604.1_6 Forward -27 -8 3.83436 0.131
NP_442044.1_1 Forward -377 -358 -14.0619 0.283
NP_442193.1_1 Forward -210 -192 10.4422 0.23
NP_442193.1_1 Reverse -330 -348 10.0489 0.233
NP_442270.1_9 Forward -32 -13 -6.09707 0.207
NP_441017.1_8 Reverse -255 -270 10.0097 0.203
NP_443035.1_4 Forward -334 -315 19.7631 0.107
NP_440264.1_7 Reverse -108 -124 14.3655 0.235
NP_442052.1_8 Forward -352 -342 12.3697 0.271
NP_442809.1_6 Forward -351 -332 2.26107 0.267
NP_440546.1_4 Forward -27 -17 12.8578 0.0572
NP_440546.1_4 Reverse -18 -28 11.8882 0.0679
NP_440546.1_4 Reverse -336 -346 8.6886 0.176
NP_443033.1_3 Forward -338 -319 23.9922 0.0255
NP_440675.1_1 Reverse -327 -346 14.4541 0.177
NP_440462.1_6 Forward -29 -19 9.02648 0.0498
NP_440462.1_6 Reverse -16 -26 7.84651 0.0699
NP_440868.1_4 Forward -31 -19 8.6921 0.0582
NP_440868.1_4 Reverse -14 -26 6.23383 0.0878
NP_442499.1_3 Forward -67 -49 8.27895 0.279
NP_442499.1_3 Forward -262 -244 4.54237 0.289
NP_440905.1_1 Forward -55 -37 11.3272 0.154
NP_442402.1_4 Forward -285 -266 -8.06442 0.278
NP_439942.1_7 Reverse -4 -23 -4.6221 0.248
NP_442039.1_4 Forward -26 -19 15.1821 0.0124
NP_442039.1_4 Reverse -19 -26 15.1821 0.0124
NP_442039.1_7 Reverse -276 -286 10.9931 0.257
NP_441811.1_8 Reverse -357 -371 8.45605 0.238
NP_441811.1_8 Reverse -247 -261 7.66941 0.241
NP_442679.1_1 Reverse -29 -48 8.25926 0.147
NP_442679.1_1 Reverse -105 -124 0.58944 0.196
NP_440008.1_9 Forward -345 -326 8.75091 0.283
NP_440825.1_7 Reverse -19 -29 12.4217 0.155
NP_442837.1_3 Forward -26 -19 15.7721 0.0124
NP_442837.1_3 Reverse -19 -26 15.7721 0.0124
NP_442053.1_1 Forward -27 -18 18.3876 0.0007
NP_442053.1_1 Reverse -18 -27 18.3876 0.0007
NP_440505.1_3 Reverse -16 -26 7.55152 0.151
NP_440505.1_3 Forward -29 -19 6.76487 0.169
NP_440505.1_3 Forward -77 -67 4.40493 0.292
NP_441102.1_1 Reverse -19 -38 2.94938 0.299
NP_441203.1_1 Reverse -331 -350 -10.1286 0.137
NP_441203.1_1 Reverse -19 -38 -18.9784 0.297
NP_441203.1_1 Forward -26 -7 -20.4534 0.297
NP_440914.1_1 Reverse -18 -28 8.6151 0.186
NP_440914.1_1 Forward -27 -17 8.51751 0.186
NP_441011.1_8 Reverse -19 -28 16.9127 0.00602
NP_441011.1_8 Forward -26 -17 14.356 0.0249
NP_441011.1_8 Reverse -364 -373 7.07956 0.179
NP_442101.1_10 Forward -35 -16 2.55606 0.0714
NP_442533.1_1 Reverse -45 -64 -8.26035 0.202
NP_442533.1_1 Reverse -39 -58 -12.1936 0.236
NP_442533.1_1 Reverse -327 -346 -16.0285 0.262
NP_442533.1_6 Forward -27 -18 17.2076 0.00137
NP_442533.1_6 Reverse -18 -27 17.2076 0.00137
NP_442533.1_6 Reverse -330 -339 13.5694 0.021
NP_442533.1_6 Forward -339 -330 8.1612 0.0807
NP_442533.1_6 Reverse -363 -372 5.70292 0.132
NP_442533.1_6 Forward -372 -363 5.21127 0.15
NP_442541.1_3 Forward -349 -330 6.98095 0.222
NP_442541.1_10 Forward -345 -331 1.47397 0.286
NP_440263.1_6 Reverse -7 -26 11.4058 0.272
NP_442232.1_3 Reverse -10 -29 4.81767 0.0823
NP_442322.1_4 Reverse -192 -209 -8.71327 0.286
NP_442229.1_1 Forward -29 -15 8.55376 0.184
NP_441482.1_7 Reverse -12 -26 19.2725 0.0041
NP_441482.1_7 Forward -33 -19 -8.5552 0.193
NP_441482.1_7 Forward -345 -331 -9.34185 0.198
NP_439944.1_9 Forward -26 -16 17.3846 0.00516
NP_439944.1_9 Reverse -331 -341 5.68323 0.231
NP_441028.1_6 Forward -125 -115 14.0409 0.158
NP_441028.1_6 Forward -36 -26 5.38779 0.255
NP_440116.1_5 Forward -30 -13 2.79211 0.255
NP_440116.1_8 Reverse -331 -350 -6.98204 0.22
NP_440116.1_8 Reverse -19 -38 -9.44032 0.278
NP_440115.1_6 Reverse -15 -25 9.7148 0.115
NP_439965.1_1 Forward -36 -17 -0.4922 0.157
NP_439965.1_1 Reverse -9 -28 -5.99873 0.211
NP_441170.1_4 Forward -381 -363 2.18243 0.285
NP_441972.1_5 Reverse -19 -38 -7.57203 0.25
NP_441106.1_1 Forward -28 -19 18.191 0.0028
NP_441106.1_1 Reverse -17 -26 9.73449 0.0311
NP_442588.1_1 Reverse -324 -343 5.89931 0.277
NP_442306.1_10 Reverse -358 -377 -21.6334 0.282
NP_441286.1_1 Forward -28 -16 14.3953 0.00424
NP_441286.1_1 Reverse -17 -29 -3.40261 0.145
NP_441286.1_1 Forward -340 -328 -4.58258 0.165
NP_441286.1_1 Reverse -329 -341 -4.68091 0.168
NP_442674.1_3 Reverse -10 -29 9.43841 0.174
NP_440670.1_8 Forward -27 -18 18.3876 0.000699
NP_440670.1_8 Reverse -18 -27 18.3876 0.000699
NP_441479.1_9 Forward -364 -346 22.2419 0.0189
NP_442908.1_8 Reverse -59 -78 13.6675 0.266
NP_440886.1_7 Forward -28 -18 17.7774 0.0011
NP_440886.1_7 Reverse -17 -27 8.04271 0.0805
NP_440886.1_7 Reverse -65 -75 7.35439 0.0966
NP_440886.1_7 Forward -373 -363 7.15773 0.103
NP_440886.1_7 Forward -340 -330 6.76441 0.114
NP_440886.1_7 Forward -61 -51 6.66608 0.115
NP_440828.1_1 Forward -61 -42 -0.787962 0.274
NP_442614.1_2 Forward -27 -13 9.14437 0.242
NP_442614.1_2 Reverse -330 -344 6.19444 0.291
NP_440767.1_8 Reverse -316 -335 11.9958 0.268
NP_442072.1_9 Reverse -17 -35 -12.8622 0.0926
NP_442401.1_2 Forward -67 -48 8.35677 0.248
NP_440028.1_6 Reverse -37 -55 11.5239 0.259
NP_441808.1_8 Reverse -348 -367 11.6025 0.222
NP_440907.2_8 Reverse -19 -29 14.2375 0.0312
NP_440907.2_8 Forward -26 -16 9.81266 0.103
NP_440664.1_4 Forward -220 -201 13.4708 0.0381
NP_442264.1_2 Reverse -326 -343 14.5918 0.128
NP_441021.1_1 Forward -338 -319 -10.6203 0.242
NP_440841.1_4 Reverse -16 -35 -7.08038 0.22
NP_441463.1_3 Forward -382 -363 -0.885524 0.134
NP_441463.1_3 Reverse -8 -27 -9.73531 0.284
NP_441626.1_2 Forward -26 -19 15.7721 0.0124
NP_441626.1_2 Reverse -19 -26 15.7721 0.0124
NP_441460.1_2 Forward -36 -23 17.6199 0.101
NP_442794.1_1 Forward -31 -19 12.4287 0.0721
NP_442615.1_1 Forward -36 -18 14.8671 0.00922
NP_442615.1_1 Reverse -9 -27 6.11567 0.0364
NP_442615.1_1 Reverse -271 -289 -1.84914 0.134
NP_441962.1_4 Reverse -49 -68 -9.047 0.211
NP_441962.1_4 Forward -344 -325 -9.14533 0.213
NP_441962.1_4 Reverse -58 -77 -12.9802 0.268
NP_441962.1_4 Reverse -13 -32 -13.3736 0.272
NP_441742.1_7 Forward -31 -12 13.5691 0.261
NP_440387.1_1 Reverse -280 -296 -2.30141 0.147
NP_440387.1_1 Reverse -18 -34 -2.30141 0.147
NP_440387.1_1 Forward -27 -11 -4.36636 0.185
NP_440387.1_1 Reverse -330 -346 -4.95634 0.208
NP_441431.1_2 Reverse -15 -29 10.2254 0.166
NP_441431.1_2 Forward -30 -16 8.55376 0.211
NP_441431.1_3 Reverse -336 -355 4.22769 0.263
NP_441488.1_7 Reverse -357 -376 4.42435 0.188
NP_441836.1_2 Forward -78 -59 -0.295539 0.212
NP_441836.1_2 Reverse -51 -70 -6.49039 0.298
NP_441993.1_1 Reverse -330 -349 11.1077 0.117
NP_441993.1_1 Forward -27 -8 7.59921 0.16
NP_441174.1_2 Reverse -360 -374 12.9793 0.23
NP_440114.1_10 Forward -27 -13 10.816 0.134
NP_441425.1_3 Reverse -323 -333 16.7946 0.273
NP_441206.1_2 Reverse -330 -349 14.3558 0.191
NP_440293.1_10 Reverse -327 -346 13.1758 0.0942
NP_440293.1_10 Reverse -48 -67 7.17762 0.183
NP_440766.1_4 Reverse -14 -28 8.06273 0.0871
NP_440766.1_4 Forward -31 -17 6.48943 0.101
NP_439988.1_3 Reverse -332 -346 4.91614 0.292
NP_439988.1_7 Forward -28 -14 11.7003 0.292
NP_439988.1_10 Reverse -106 -125 11.9031 0.213
NP_442743.1_4 Reverse -19 -38 -1.86883 0.203
NP_442743.1_5 Reverse -13 -32 11.4058 0.142
NP_441133.1_1 Reverse -330 -349 13.1758 0.243
NP_440457.1_1 Reverse -14 -26 11.1504 0.092
NP_440457.1_1 Reverse -326 -338 3.38223 0.196
NP_440457.1_1 Forward -31 -19 -0.452677 0.263
NP_440457.1_1 Forward -343 -331 -1.23932 0.3
NP_440798.1_6 Reverse -19 -32 13.0973 0.0445
NP_440798.1_6 Forward -26 -13 1.88757 0.192
NP_442680.1_5 Reverse -28 -47 4.95675 0.227
NP_440801.1_8 Forward -388 -369 5.211 0.192
NP_440801.1_10 Reverse -14 -33 5.50599 0.289
NP_442561.1_9 Reverse -19 -38 15.6332 0.285
NP_441984.1_1 Reverse -330 -348 8.08229 0.262
NP_441984.1_3 Reverse -326 -344 8.57394 0.224
NP_440473.1_1 Forward -349 -330 12.6071 0.219
NP_442509.1_9 Forward -27 -17 17.3841 0.00128
NP_442509.1_9 Reverse -18 -28 16.2041 0.00739
NP_442514.1_5 Reverse -192 -211 -1.08295 0.196
NP_440554.1_4 Reverse -19 -29 7.35486 0.103
NP_440554.1_4 Forward -26 -16 6.96153 0.107
NP_441885.1_5 Reverse -18 -28 11.4848 0.00668
NP_441885.1_5 Forward -27 -17 11.3864 0.00668
NP_441885.1_5 Reverse -66 -76 0.471689 0.145
NP_441885.1_5 Forward -289 -279 0.373358 0.164
NP_440478.1_7 Reverse -331 -350 17.3057 0.25
NP_442341.1_6 Forward -350 -331 19.5664 0.161
NP_442341.1_7 Reverse -17 -31 15.5359 0.0218
NP_442341.1_7 Forward -373 -359 5.89945 0.142
NP_442341.1_7 Forward -28 -14 5.1128 0.167
NP_442341.1_9 Forward -29 -15 18.4851 0.0166
NP_441756.1_5 Reverse -327 -346 1.17943 0.217
NP_441756.1_5 Reverse -326 -345 -4.81876 0.296
NP_441173.1_9 Forward -286 -278 11.4254 0.226
NP_442395.2_4 Reverse -17 -36 2.26028 0.223
NP_442395.2_4 Forward -28 -9 -0.591301 0.298
NP_440423.1_6 Reverse -10 -29 -15.4385 0.229
NP_443000.1_7 Reverse -16 -26 8.82982 0.0437
NP_443000.1_7 Forward -29 -19 1.94665 0.226
NP_440507.2_3 Reverse -9 -28 16.5182 0.0728
NP_441842.1_10 Forward -34 -20 9.63603 0.186
NP_440275.1_3 Reverse -16 -26 10.0098 0.0454
NP_440275.1_3 Forward -29 -19 8.33817 0.0602
NP_440275.1_3 Forward -65 -55 4.50326 0.188
NP_440091.1_1 Reverse -14 -26 -0.354346 0.273
NP_441359.1_5 Reverse -15 -34 9.24257 0.159
NP_439962.1_4 Reverse -345 -364 -6.88371 0.285
NP_440149.1_8 Forward -27 -8 5.30933 0.0746
NP_440149.1_8 Reverse -330 -349 -6.29373 0.246
NP_441105.1_3 Forward -38 -19 8.75091 0.0472
NP_441105.1_3 Reverse -7 -26 1.0811 0.117
NP_442373.1_2 Reverse -327 -346 -8.85033 0.253
NP_440216.1_1 Reverse -18 -32 7.66941 0.00931
NP_440216.1_1 Forward -27 -13 5.60446 0.0191
NP_440216.1_1 Reverse -330 -344 -11.6035 0.203
NP_440172.1_1 Forward -27 -17 16.303 0.00854
NP_440172.1_1 Reverse -18 -28 8.73149 0.0586
NP_440172.1_1 Reverse -330 -340 4.10993 0.205
NP_441008.1_4 Forward -63 -44 14.7658 0.295
NP_442015.1_10 Forward -31 -18 20.1771 0.00366
NP_442015.1_10 Reverse -14 -27 10.049 0.0415
NP_442015.1_10 Forward -343 -330 0.60927 0.221
NP_441226.1_7 Forward -26 -19 14.4934 0.0123
NP_441226.1_7 Reverse -19 -26 14.4934 0.0123
NP_441757.1_3 Forward -276 -257 -2.55715 0.283
NP_441111.1_7 Forward -26 -18 18.7023 0.00294
NP_441111.1_7 Reverse -19 -27 18.7023 0.00294
NP_441111.1_7 Reverse -331 -339 -0.472234 0.131
NP_441111.1_7 Forward -338 -330 -0.668896 0.274
NP_441766.1_2 Forward -27 -18 17.5026 0.00297
NP_441766.1_2 Reverse -18 -27 17.5026 0.00297
NP_441766.1_2 Reverse -330 -339 4.52295 0.179
NP_441766.1_9 Reverse -328 -347 0.0977854 0.254
NP_442417.1_5 Reverse -18 -32 17.5025 0.0331
NP_440416.1_9 Forward -34 -15 11.4058 0.0202
NP_440416.1_9 Reverse -11 -30 -6.09707 0.0854
NP_440416.1_9 Forward -346 -327 -15.4385 0.191
NP_443052.1_8 Reverse -56 -75 -7.86702 0.164
NP_443052.1_8 Forward -382 -363 -8.16202 0.169
NP_442116.1_6 Reverse -262 -279 7.02305 0.266
NP_442154.1_1 Reverse -328 -346 -4.01242 0.125
NP_442154.1_1 Reverse -49 -67 -4.20908 0.125
NP_442154.1_1 Reverse -40 -58 -16.9921 0.247
NP_440261.1_5 Forward -26 -13 -0.865694 0.0655
NP_440261.1_5 Reverse -19 -32 -0.964025 0.0655
NP_440261.1_5 Reverse -331 -344 -2.34066 0.0924
NP_440988.1_10 Forward -347 -333 3.44663 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCATCATCACATCACAGATGATCAAGTCGGGCATCACCTCCAAGGAGTTGAGCAGCCCCAGGGCCACCGCCCCATTTTCTGCTTCTAGAATCTTATAATTTTCCAGACTCAGGGTTTCGCCAATTAACTCCCGAATAATGGCTTCATCCTCGACAACTAAAATAGTACTCATAGGGATTAATCAAATCTTTGTCGCGGGCCAGAGGGAGTTTTCAGACAAGCTCTGAGTGACATCCTAGCCTAATTTCCCAGACTTTAAGACCAAATTGACTGGATTTTTCTCCATTATTGTTCCTAGGTTCAGGTTGTCAGGTCAGGCTAAGATGGTGATAGTCGCTACGACCACCACCCCATTCTCCATTCATTTTCCCTCGGCGATCGCCCTGTCTAGACTTCCACC

CDS

ATGAGCGCAAGAACCTTATTTGACAAAGTTTGGGATCTCCACACCATCAGTGTTTTGCCATCGGGTCAAACCCAACTCTTCATCGGGTTGCACCTGATCCACGAAGTCACCAGTCCCCAGGCCTTTGCCATGCTGAAAGAGCGGGGGTTGCGGGTTATGTATCCAGAAAGAACGGTGGCTACGGTGGACCACATTGTGCCGACGGAAAATCAGCAACGGCCTTTCCAGGATTCCTTAGCTGAAGAAATGATGCAAGCGTTGGAGGTTAATACCAAAGCCCATAATATTCGCTTCCATCCCATTGGCTCCGGCAATCAAGGCATTGTCCATGTCATTGCCCCGGAACAGGGCCTAACCCAACCAGGTATGACCATTGCCTGTGGCGATTCTCACACTTCTACCCACGGGGCCTTCGGGGCGATCGCCTTTGGCATTGGCACTTCCCAAGTGCGGGACGTGTTGGCAGCCCAGAGTTTGAGCTTAAATAAGTTAAAAGTAAGAAAAATTGAGGTTAACGGTGATTTAGCCCCTGGGGTCTACGCCAAGGACGTGATTCTCCACATTATCCGCAAATTGGGCGTTAAGGGCGGGGTGGGCTATGCCTATGAGTATGCCGGATCAACCTTTGTCGCCATGAATATGGAAGAACGCATGACCGTTTGTAATATGTCCATTGAGGGGGGAGCTCGCTGCGGCTATATCAACCCAGATGAAGTAACTTTTGCATACCTCAAAGGGCGGGAGTTTGCTCCCCAAGGGGAAGATTGGGACAAGGCAGTGCAATGGTGGCGCAGTATTGCCAGTGAACCCGATGCGGTGTACGACGATGTGGTTTCCTTCCGGGCAGAGGACATTGAACCCACCGTTACCTGGGGCATTACCCCCGGCCAAGGCATTGGCATCAGTGAGCCGGTTCCTACCCTTGACAGCCTCAACCCCGATGATCAGGCGATCGCCAGCGAAGCCTACAAATATATGCAATTCCAGCCGGGACAACCGCTGAAAGGCACCAAGGTCGATGTTTGTTTCATTGGTAGTTGCACCAATGGTCGTTTGAGCGACCTGGAGGAAGCCGCTAAGGTAGCCAAGGGTCACCAGGTAGCGGCCGGGGTAAAAGCTTTTGTGGTGCCCGGTTCCGAACAAGTCAAGCAACAGGCCGAAGCAGCAGGGCTAGATCAAATTTTCCAAGCGGCGGGTTTTGAATGGCGAGAAGCAGGCTGTTCCATGTGTTTGGCCATGAACCCCGACAAACTCCAGGGTGATCAACTGAGTGCTTCCTCTTCCAACCGTAACTTTAAGGGTCGTCAGGGTTCTGCCTCTGGCCGTACTTTGTTAATGAGTCCAGCGATGGTCGCGGCGGCGGCCATTACGGGGCAAGTAGCTGATGTGCGGGAAGTACTAGGCTAA

Protein

MSARTLFDKVWDLHTISVLPSGQTQLFIGLHLIHEVTSPQAFAMLKERGLRVMYPERTVATVDHIVPTENQQRPFQDSLAEEMMQALEVNTKAHNIRFHPIGSGNQGIVHVIAPEQGLTQPGMTIACGDSHTSTHGAFGAIAFGIGTSQVRDVLAAQSLSLNKLKVRKIEVNGDLAPGVYAKDVILHIIRKLGVKGGVGYAYEYAGSTFVAMNMEERMTVCNMSIEGGARCGYINPDEVTFAYLKGREFAPQGEDWDKAVQWWRSIASEPDAVYDDVVSFRAEDIEPTVTWGITPGQGIGISEPVPTLDSLNPDDQAIASEAYKYMQFQPGQPLKGTKVDVCFIGSCTNGRLSDLEEAAKVAKGHQVAAGVKAFVVPGSEQVKQQAEAAGLDQIFQAAGFEWREAGCSMCLAMNPDKLQGDQLSASSSNRNFKGRQGSASGRTLLMSPAMVAAAAITGQVADVREVLG