Your browser is old and dusty. Try Google Chrome!

Details for sll1468

ORF sll1468
Accession NP_440788.1
Symbol crtR
Category Carotenoid
Definition beta-carotene hydroxylase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -381 -362 -30.2865 0.267
NP_441818.1_9 Forward -392 -373 -9.73531 0.291
NP_440637.1_7 Forward -56 -37 9.3409 0.259
NP_442287.1_1 Reverse -188 -198 14.0409 0.266
NP_441812.1_1 Reverse -207 -221 16.0269 0.193
NP_442975.1_10 Reverse -368 -382 1.67063 0.293
NP_441054.1_2 Forward -273 -254 11.1109 0.271
NP_440761.1_3 Reverse -28 -47 15.4592 0.205
NP_441859.1_3 Reverse -325 -344 5.11187 0.206
NP_441781.1_7 Reverse -85 -104 -2.85214 0.289
NP_441492.1_5 Reverse -289 -308 4.99194 0.237
NP_439923.1_10 Reverse -351 -370 16.3224 0.11
NP_441208.1_9 Reverse -348 -362 6.09611 0.253
NP_442110.1_2 Forward -201 -188 15.483 0.196
NP_440769.1_8 Forward -264 -245 7.86593 0.248
NP_441083.1_5 Reverse -326 -336 5.38824 0.12
NP_441738.1_2 Reverse -88 -95 6.72528 0.236
NP_441942.1_6 Forward -376 -357 14.0859 0.245
NP_441444.1_1 Forward -77 -58 13.9625 0.177
NP_442136.1_1 Reverse -260 -279 7.07928 0.265
NP_441713.1_1 Forward -224 -205 -14.2585 0.257
NP_441025.1_6 Forward -287 -268 1.82439 0.28
NP_440538.1_10 Reverse -179 -198 10.2259 0.279
NP_441327.1_1 Forward -164 -145 6.13556 0.25
NP_442111.1_4 Forward -34 -20 3.14618 0.253
NP_441624.1_7 Reverse -91 -105 7.9644 0.241
NP_441163.1_7 Reverse -179 -198 19.0757 0.135
NP_441854.1_10 Reverse -349 -368 6.78429 0.216
NP_442145.1_4 Reverse -270 -289 12.1748 0.125
NP_442145.1_4 Reverse -260 -279 11.1244 0.136
NP_442145.1_4 Forward -310 -291 2.62561 0.299
NP_442634.1_4 Forward -337 -323 2.06454 0.147
NP_441667.1_5 Reverse -236 -250 16.8237 0.254
NP_440470.1_5 Forward -277 -258 14.0846 0.158
NP_440842.1_4 Reverse -261 -280 10.197 0.0869
NP_440842.1_4 Reverse -271 -290 3.3521 0.207
NP_441014.1_10 Forward -336 -317 1.17865 0.231
NP_443018.1_3 Reverse -390 -397 8.49558 0.141
NP_441634.1_9 Forward -208 -189 10.7167 0.252
NP_441857.1_6 Forward -102 -92 14.1397 0.254
NP_441763.1_10 Forward -371 -352 8.4551 0.216
NP_442496.1_5 Reverse -173 -191 7.59063 0.256
NP_440184.1_1 Reverse -252 -271 13.5949 0.0864
NP_440203.1_5 Reverse -88 -98 9.81266 0.245
NP_441162.1_3 Forward -112 -93 10.5209 0.211
NP_442690.1_1 Forward -277 -258 -2.36049 0.136
NP_442690.1_1 Forward -42 -23 -5.50708 0.158
NP_442690.1_1 Forward -163 -144 -10.7186 0.218
NP_442690.1_1 Forward -164 -145 -13.2752 0.258
NP_442911.1_2 Reverse -341 -360 -5.50708 0.16
NP_443055.1_6 Reverse -181 -199 8.76983 0.141
NP_443055.1_6 Reverse -78 -96 -1.06322 0.271
NP_440993.1_5 Reverse -315 -333 18.7012 0.101
NP_441646.1_1 Reverse -344 -363 -0.197208 0.259
NP_441646.1_1 Forward -101 -82 -0.295539 0.26
NP_442438.1_10 Reverse -346 -360 1.57289 0.191
NP_442771.1_1 Reverse -115 -133 0.707465 0.0909
NP_441041.1_7 Forward -361 -349 7.90349 0.154
NP_441725.1_5 Reverse -390 -400 3.61828 0.115
NP_440983.1_9 Reverse -342 -361 1.76941 0.292
NP_441076.1_3 Forward -168 -149 11.7 0.2
NP_442281.1_1 Reverse -112 -126 5.40719 0.159
NP_001035871.2_7 Forward -104 -94 14.1397 0.218
NP_440375.1_8 Forward -397 -378 6.88262 0.166
NP_440867.1_10 Reverse -96 -115 7.07928 0.251
NP_442215.1_2 Reverse -83 -99 -6.92296 0.281
NP_442933.1_1 Forward -75 -56 9.21455 0.253
NP_441751.2_8 Forward -334 -320 -6.88358 0.289
NP_441751.2_8 Reverse -352 -366 -6.98191 0.294
NP_442142.1_4 Forward -135 -122 5.91857 0.178
NP_442142.1_4 Forward -109 -96 2.47701 0.29
NP_442292.1_2 Forward -160 -146 16.1311 0.269
NP_443009.1_5 Reverse -84 -95 4.77807 0.23
NP_440158.1_1 Reverse -283 -302 15.517 0.0997
NP_441020.2_6 Forward -362 -345 6.82368 0.251
NP_441764.1_1 Forward -288 -269 18.7807 0.0481
NP_441764.1_4 Forward -290 -273 17.3345 0.0666
NP_441764.1_4 Forward -280 -263 13.9923 0.154
NP_441764.1_4 Reverse -146 -163 11.7005 0.21
NP_441764.1_4 Forward -300 -283 9.88619 0.273
NP_442719.1_2 Forward -198 -180 -10.5029 0.276
NP_441612.1_2 Reverse -326 -336 15.1326 0.21
NP_442227.1_2 Reverse -87 -106 1.17943 0.25
NP_440789.1_1 Reverse -271 -290 21.6314 0.0189
NP_440789.1_10 Reverse -185 -203 20.9628 0.0543
NP_441911.1_10 Reverse -62 -81 9.33025 0.233
NP_442808.1_1 Reverse -188 -198 1.25791 0.289
NP_440558.1_2 Reverse -205 -224 -2.95047 0.232
NP_441048.1_6 Reverse -257 -271 15.8633 0.296
NP_442789.1_4 Forward -337 -318 -4.6221 0.261
NP_440923.1_1 Reverse -270 -288 27.7476 0.0000545
NP_440923.1_1 Forward -156 -138 10.7364 0.291
NP_441878.1_6 Forward -95 -85 -7.39479 0.222
NP_441557.1_8 Forward -50 -40 15.5158 0.18
NP_441557.1_8 Reverse -342 -352 10.9926 0.269
NP_441445.1_1 Forward -375 -356 -0.590531 0.297
NP_441739.1_2 Reverse -182 -198 10.5792 0.169
NP_442397.1_9 Reverse -182 -201 3.34271 0.264
NP_441819.1_5 Forward -41 -22 17.8088 0.144
NP_442645.1_2 Forward -103 -84 -17.7001 0.261
NP_442047.1_2 Reverse -99 -113 16.6175 0.161
NP_442317.1_8 Forward -302 -283 18.3873 0.134
NP_440977.1_5 Reverse -35 -48 16.5383 0.18
NP_441007.1_10 Forward -383 -370 0.117615 0.25
NP_440709.1_1 Reverse -259 -278 15.7316 0.0302
NP_440709.1_1 Reverse -269 -288 14.2566 0.0386
NP_440709.1_1 Reverse -279 -298 12.1917 0.0464
NP_440709.1_2 Reverse -274 -288 23.5 0.000895
NP_442158.1_4 Forward -229 -219 12.2714 0.253
NP_442866.1_1 Forward -383 -364 -8.06369 0.275
NP_440702.1_2 Forward -377 -358 -6.39206 0.257
NP_441199.1_6 Reverse -347 -366 0.491109 0.242
NP_441199.1_7 Forward -291 -272 5.50599 0.231
NP_440677.1_1 Forward -103 -84 8.65258 0.204
NP_442386.1_8 Reverse -344 -363 13.6675 0.264
NP_441750.1_4 Forward -118 -99 1.96607 0.272
NP_440622.1_6 Reverse -87 -106 15.8299 0.29
NP_441132.1_2 Forward -250 -231 8.55425 0.163
NP_440586.1_1 Forward -367 -348 -4.03212 0.277
NP_442251.1_6 Forward -125 -118 8.10225 0.245
NP_441912.1_3 Forward -106 -87 7.27595 0.27
NP_440027.1_4 Reverse -262 -281 11.4512 0.0706
NP_439937.1_8 Reverse -358 -377 -5.11376 0.286
NP_439937.1_9 Reverse -348 -365 -13.4331 0.286
NP_441167.1_1 Forward -281 -262 12.2908 0.109
NP_442239.1_5 Forward -299 -280 11.3255 0.259
NP_440819.1_5 Reverse -60 -68 7.68924 0.266
NP_440316.1_10 Reverse -96 -106 13.0581 0.214
NP_440316.1_10 Forward -102 -92 7.35486 0.251
NP_441803.1_2 Forward -365 -346 1.37609 0.232
NP_441877.1_9 Forward -270 -253 1.41547 0.297
NP_442262.1_10 Reverse -390 -397 8.59391 0.22
NP_440350.1_5 Forward -67 -48 0.786102 0.158
NP_441896.1_1 Forward -155 -136 18.8781 0.0528
NP_440999.1_9 Reverse -113 -127 -1.8687 0.252
NP_440999.1_9 Forward -339 -325 -3.34366 0.291
NP_440888.1_2 Reverse -105 -119 9.53707 0.123
NP_442077.1_4 Forward -163 -144 5.80098 0.289
NP_441543.1_2 Forward -32 -23 6.39124 0.153
NP_442710.1_7 Forward -285 -266 -1.45616 0.221
NP_442337.1_8 Forward -209 -190 7.47261 0.191
NP_442337.1_8 Forward -330 -311 0.982764 0.241
NP_440071.1_6 Forward -105 -91 13.8049 0.26
NP_440148.1_6 Forward -266 -252 16.157 0.3
NP_441621.1_7 Forward -362 -348 -4.4253 0.223
NP_441621.1_7 Reverse -349 -363 -4.91696 0.248
NP_441929.1_6 Forward -126 -107 4.42435 0.294
NP_442780.1_1 Forward -286 -267 6.98095 0.291
NP_440454.1_2 Reverse -258 -272 10.2293 0.291
NP_441353.1_1 Reverse -193 -212 19.2565 0.159
NP_441443.1_1 Reverse -42 -61 -5.31042 0.298
NP_440865.1_9 Forward -366 -347 -1.57384 0.178
NP_441052.1_2 Reverse -326 -336 4.10993 0.166
NP_442577.1_9 Reverse -185 -199 11.897 0.253
NP_441004.1_1 Forward -366 -347 -17.6018 0.292
NP_441004.1_1 Forward -375 -356 -17.7985 0.294
NP_440296.1_6 Forward -273 -255 9.83765 0.298
NP_443054.1_2 Forward -97 -83 0.982901 0.251
NP_441851.1_10 Forward -96 -86 6.37155 0.172
NP_440593.1_3 Forward -377 -358 -4.42544 0.248
NP_441982.1_6 Reverse -59 -68 12.1989 0.288
NP_440463.1_8 Reverse -347 -366 5.75726 0.277
NP_440338.1_4 Reverse -258 -277 11.8967 0.15
NP_442689.1_8 Forward -38 -21 15.0835 0.0681
NP_442689.1_8 Forward -160 -143 -4.09106 0.26
NP_442689.1_8 Forward -273 -256 -6.15601 0.28
NP_442689.1_8 Forward -188 -171 -6.84433 0.289
NP_442843.1_1 Reverse -1 -20 -12.0953 0.298
NP_441031.1_1 Reverse -257 -276 11.161 0.193
NP_441031.1_1 Forward -283 -264 6.53351 0.267
NP_440483.1_1 Reverse -92 -111 -7.27704 0.258
NP_441570.1_1 Forward -335 -317 0.609134 0.0379
NP_441570.1_1 Forward -223 -205 -11.2889 0.191
NP_441570.1_6 Reverse -88 -107 8.65258 0.0485
NP_441078.1_4 Reverse -351 -360 -1.18024 0.237
NP_441078.1_4 Forward -360 -351 -1.96689 0.282
NP_442729.1_5 Forward -393 -383 7.74818 0.271
NP_441432.1_3 Forward -125 -106 17.4032 0.244
NP_441432.1_8 Forward -115 -106 2.55633 0.298
NP_443024.1_3 Forward -220 -210 10.5014 0.289
NP_441732.1_2 Reverse -322 -338 -8.39793 0.138
NP_440629.1_1 Reverse -139 -157 10.6389 0.0777
NP_440629.1_1 Forward -287 -269 7.09898 0.152
NP_442157.1_8 Reverse -378 -397 12.7816 0.269
NP_440578.1_8 Forward -378 -359 10.7175 0.284
NP_442298.1_4 Forward -268 -254 18.728 0.271
NP_442400.1_10 Reverse -247 -260 14.672 0.173
NP_442400.1_10 Reverse -145 -158 7.31916 0.29
NP_440713.1_4 Forward -208 -189 3.14605 0.251
NP_441022.1_1 Reverse -255 -264 12.6973 0.232
NP_440363.1_9 Forward -380 -362 12.1139 0.291
NP_439956.1_7 Forward -209 -190 2.26107 0.275
NP_440545.1_3 Forward -364 -347 -3.40274 0.203
NP_440025.1_3 Forward -186 -172 12.063 0.269
NP_440250.1_4 Forward -276 -257 5.89851 0.253
NP_440010.1_3 Reverse -94 -113 -6.09707 0.25
NP_440010.1_4 Reverse -368 -387 4.03023 0.22
NP_442828.1_5 Reverse -291 -310 10.815 0.289
NP_441593.1_2 Forward -253 -234 10.8159 0.183
NP_441329.1_1 Forward -302 -283 12.7478 0.175
NP_441329.1_1 Forward -157 -138 4.72643 0.281
NP_441329.1_3 Reverse -250 -260 14.8103 0.25
NP_440671.1_1 Forward -280 -261 9.76781 0.191
NP_440671.1_6 Reverse -187 -206 13.2733 0.226
NP_442723.1_1 Reverse -82 -101 3.73524 0.278
NP_440594.1_6 Reverse -351 -370 5.80018 0.279
NP_442897.1_3 Forward -336 -317 22.9106 0.0129
NP_440604.1_6 Forward -126 -107 -3.83545 0.235
NP_440604.1_6 Reverse -351 -370 -5.31042 0.271
NP_441508.1_1 Forward -287 -268 19.3036 0.0922
NP_441508.1_1 Forward -277 -258 16.5164 0.101
NP_441508.1_1 Reverse -263 -282 12.3837 0.23
NP_442629.1_5 Forward -228 -214 15.1426 0.279
NP_441541.1_7 Reverse -251 -269 12.7678 0.218
NP_440833.1_6 Reverse -380 -394 7.66879 0.278
NP_442216.1_4 Reverse -87 -95 15.3586 0.255
NP_443035.1_10 Reverse -99 -116 5.74204 0.273
NP_440546.1_6 Reverse -341 -360 8.35759 0.259
NP_440675.1_4 Forward -195 -176 11.2092 0.299
NP_442465.1_2 Forward -62 -43 1.86696 0.259
NP_442499.1_3 Reverse -350 -368 3.65739 0.289
NP_442812.1_10 Reverse -378 -397 16.1257 0.135
NP_441474.1_1 Reverse -219 -238 -2.75457 0.285
NP_442402.1_4 Forward -77 -58 -8.75273 0.284
NP_442402.1_6 Forward -98 -89 15.4377 0.241
NP_442402.1_6 Reverse -39 -48 14.1594 0.241
NP_441848.1_4 Forward -173 -157 8.60108 0.288
NP_441848.1_7 Reverse -379 -398 -0.591301 0.244
NP_441848.1_7 Reverse -154 -173 -2.16459 0.262
NP_440696.1_3 Forward -208 -190 -2.24246 0.274
NP_442679.1_1 Reverse -47 -66 -2.85214 0.244
NP_440160.1_1 Forward -292 -273 11.969 0.205
NP_440160.1_9 Forward -106 -87 9.73422 0.235
NP_440505.1_1 Reverse -101 -118 18.5243 0.273
NP_440505.1_3 Reverse -40 -50 5.09324 0.246
NP_442360.1_5 Forward -100 -90 13.1564 0.289
NP_440548.1_3 Forward -223 -204 18.1907 0.133
NP_440914.1_1 Forward -94 -84 8.41992 0.191
NP_442232.1_3 Forward -368 -349 -15.8318 0.296
NP_441482.1_7 Forward -132 -118 -9.83351 0.209
NP_441697.1_5 Reverse -266 -285 -6.54162 0.232
NP_441697.1_5 Reverse -256 -275 -7.01908 0.239
NP_440816.1_2 Reverse -251 -270 6.82221 0.27
NP_441028.1_6 Forward -68 -58 12.0743 0.192
NP_442202.1_4 Reverse -346 -360 13.611 0.252
NP_442664.1_3 Forward -211 -197 10.226 0.291
NP_441527.1_4 Reverse -63 -82 -8.06949 0.24
NP_441527.1_4 Reverse -288 -307 -9.2154 0.255
NP_441527.1_4 Reverse -55 -74 -9.69285 0.261
NP_441106.1_3 Reverse -269 -288 19.174 0.0559
NP_441106.1_3 Forward -271 -252 16.7157 0.103
NP_441106.1_3 Reverse -259 -278 11.6025 0.217
NP_439903.1_6 Forward -381 -362 2.35861 0.227
NP_439903.1_6 Reverse -114 -133 0.588665 0.259
NP_439903.1_6 Reverse -82 -101 -0.492971 0.282
NP_439903.1_6 Forward -338 -319 -1.27961 0.295
NP_441186.1_4 Reverse -251 -261 15.3192 0.238
NP_440205.1_9 Reverse -165 -183 16.3413 0.2
NP_439899.1_1 Forward -291 -273 9.73552 0.165
NP_439899.1_1 Forward -301 -283 4.28466 0.268
NP_442022.1_4 Forward -378 -359 6.58763 0.27
NP_441463.1_2 Forward -273 -255 8.05944 0.14
NP_442615.1_1 Forward -369 -351 -5.38906 0.212
NP_440358.1_8 Forward -225 -206 5.40766 0.189
NP_440935.1_3 Forward -321 -302 16.7157 0.167
NP_441237.1_9 Reverse -390 -400 11.5831 0.17
NP_442942.1_5 Forward -398 -379 9.83255 0.238
NP_442930.1_1 Reverse -156 -166 15.5158 0.199
NP_442930.1_1 Forward -164 -154 9.22267 0.289
NP_440502.1_3 Forward -49 -39 16.3223 0.1
NP_441981.1_3 Forward -362 -348 15.8666 0.268
NP_440054.1_4 Reverse -309 -328 11.1109 0.22
NP_441489.1_3 Reverse -250 -264 8.89237 0.232
NP_442582.1_3 Reverse -258 -272 14.7174 0.21
NP_442936.1_10 Forward -167 -153 10.8908 0.23
NP_442936.1_10 Reverse -153 -167 7.92401 0.27
NP_441275.1_1 Reverse -270 -288 10.7372 0.0571
NP_440507.2_3 Forward -135 -116 13.47 0.145
NP_440552.1_8 Reverse -283 -300 14.9489 0.141
NP_440552.1_8 Reverse -273 -290 9.79232 0.287
NP_442513.1_5 Forward -392 -373 7.07848 0.282
NP_441397.1_3 Forward -295 -276 12.1917 0.293
NP_441389.1_5 Reverse -48 -67 10.0292 0.286
NP_441207.1_7 Reverse -255 -269 7.90002 0.293
NP_440175.1_7 Forward -208 -190 14.9258 0.13
NP_440175.1_7 Forward -382 -364 11.2174 0.235
NP_442495.1_5 Reverse -352 -371 5.89931 0.291
NP_440216.1_9 Reverse -201 -210 5.70292 0.29
NP_440172.1_1 Forward -126 -116 2.92996 0.258
NP_442116.1_2 Reverse -197 -216 12.4867 0.289
NP_442154.1_1 Forward -392 -374 -18.9587 0.288
NP_442564.1_10 Reverse -122 -136 13.2743 0.244
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTCAATGGCGAAGTTGTTGAGACGGTTGTCTTGGTCGAGGCGAAATCCGCGGCTAGTCATAGTGTTGATCTCCTTGATTGGGTATTTGAGGTTTTTATTTTGTAACCTTATGTAAATAAATGTAACGTATTGTTAAGATTTTTGTCAAGTCTGTTGACCAAAAGAGCTTTTTGTTGGTGGACGAATTGCTTGCCTAGGATGGGTTTGGGCACTTTGCCTAAATTCTGAGAGGGAAAATATTTTTCGTTACATTTGTGTAACATCCGCGCCAGGGAGATTACTCTGGCAAAGACGCCAGGGTCTGGGGAATGACCATTTGATGTCCTGTTCTTTTTCCCTAGTTGTCTTCCTTTCCCCAGCATTTTTGCTATAAACTGACCAGAAGTGCGTCCCATTTC

CDS

GTGTGCCAGGAGTCCGTCATAGTAATGCAGGCGACCCAACCGCTGCAAACCGTTTCCCAAGCTGTCCCAAAAGAGTTTTTACAGGCGGACGGCGGCTTCAATCCCAACGTGGCCATGTTCGGGATAGCTATTCTCTTAATGCTCGCTAACGTTTTTGGCTACTGGCAATGGGGGCTGCCCCACTGGCTTTGTTTTAGTTGTTCGGTGCTGGCGCTGCACCTGTCAGGCACAGTGATCCATGATGCATCCCACAATGCGGCCCATCGGAACACCATTATTAATGCAGTGCTTGGCCACGGTAGTGCCTTAATGTTGGGCTTTGCTTTTCCCGTCTTTACCCGGGTTCATCTCCAACACCACGCCAACGTCAATGACCCTGAAAATGACCCAGACCATTTTGTTTCCACCGGCGGTCCCCTCTTCCTCATTGCCGCCCGGTTCTTCTACCATGAGATCTTTTTCTTTAAACGGCGGTTATGGCGCAAATATGAGCTACTAGAGTGGTTCTTAAGTCGGCTTGTGTTGTTCACGATCGTTTTTCTCGGCATTCATTACGGCTTTATCGGCTTTGTGATGAATTACTGGTTTGTGCCTGCTTTAATTGTTGGCATTGCCCTGGGACTGTTTTTTGATTACCTGCCCCATCGACCTTTCCAAGAACGCAACCGTTGGAAAAATGCCAGGGTTTATCCCAGCCCCATTTTAAATTGGCTCATTTTCGGGCAAAATTACCACCTGATCCACCACCTTTGGCCTTCTATTCCTTGGTATCAGTACCAAAACACCTATCACATCACCAAGCCCATTTTGGATGAGAAGGGTTGTGATCAATCCCTGGGATTACTGGAAGGGAAAAATTTCTGGAGCTTCCTCTATGATGTTTTCCTTGGTATTCGTTTTCACGGCCATAATAATTCTCAATCATCTGACAAGCCCTAG

Protein

MCQESVIVMQATQPLQTVSQAVPKEFLQADGGFNPNVAMFGIAILLMLANVFGYWQWGLPHWLCFSCSVLALHLSGTVIHDASHNAAHRNTIINAVLGHGSALMLGFAFPVFTRVHLQHHANVNDPENDPDHFVSTGGPLFLIAARFFYHEIFFFKRRLWRKYELLEWFLSRLVLFTIVFLGIHYGFIGFVMNYWFVPALIVGIALGLFFDYLPHRPFQERNRWKNARVYPSPILNWLIFGQNYHLIHHLWPSIPWYQYQNTYHITKPILDEKGCDQSLGLLEGKNFWSFLYDVFLGIRFHGHNNSQSSDKP