Your browser is old and dusty. Try Google Chrome!

Details for sll1459

ORF sll1459
Accession NP_440800.1
Symbol
Category Other
Definition stationary-phase survival protein SurE homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -220 -234 10.9143 0.0562
NP_441061.1_2 Forward -255 -241 2.16287 0.178
NP_441061.1_2 Forward -300 -286 -0.492064 0.231
NP_441418.1_6 Forward -144 -125 -29.5982 0.23
NP_441418.1_6 Reverse -225 -244 -30.4831 0.28
NP_441818.1_9 Forward -229 -210 -8.94866 0.285
NP_442287.1_1 Forward -235 -225 12.8609 0.3
NP_443002.1_5 Forward -359 -341 10.1465 0.262
NP_442173.1_1 Forward -255 -247 5.32929 0.215
NP_001035873.1_8 Reverse -371 -390 14.6508 0.224
NP_440061.1_9 Reverse -88 -102 4.91554 0.3
NP_441054.1_2 Forward -175 -156 11.5042 0.267
NP_440878.1_9 Forward -273 -254 -2.26216 0.258
NP_442062.1_3 Reverse -42 -61 -1.96717 0.265
NP_441900.1_1 Reverse -93 -112 9.1044 0.3
NP_442974.1_10 Reverse -249 -268 14.6499 0.267
NP_441594.1_6 Reverse -216 -235 0.786102 0.281
NP_440300.1_1 Forward -318 -299 7.37347 0.278
NP_441083.1_3 Forward -33 -23 15.0242 0.138
NP_441149.1_7 Reverse -61 -80 0.884433 0.276
NP_441738.1_2 Reverse -249 -256 6.52862 0.261
NP_442398.1_1 Reverse -323 -342 9.24257 0.257
NP_442570.1_3 Forward -237 -218 10.0292 0.11
NP_441716.1_1 Reverse -163 -177 11.111 0.0936
NP_441716.1_2 Reverse -325 -344 -1.62095 0.289
NP_442111.1_4 Forward -307 -293 3.8345 0.229
NP_442111.1_4 Reverse -369 -383 2.16287 0.286
NP_441624.1_7 Forward -306 -292 15.2409 0.154
NP_440747.1_10 Forward -322 -310 -12.0557 0.199
NP_441486.1_1 Forward -259 -245 -0.492064 0.156
NP_441486.1_1 Reverse -244 -258 -5.90027 0.266
NP_442634.1_4 Reverse -218 -232 -4.22864 0.19
NP_440403.1_4 Reverse -98 -117 -9.93197 0.288
NP_441014.1_8 Reverse -206 -225 -7.76869 0.281
NP_442485.1_3 Reverse -207 -226 -0.0988766 0.251
NP_442530.1_2 Reverse -155 -165 12.6647 0.276
NP_440360.1_10 Reverse -128 -142 2.85119 0.261
NP_442782.1_2 Reverse -220 -234 11.5043 0.173
NP_442782.1_2 Forward -233 -219 1.57289 0.281
NP_442544.1_2 Forward -242 -228 0.0979218 0.217
NP_440800.1_2 Forward -69 -50 14.4698 0.261
NP_441487.1_9 Reverse -246 -265 0.687771 0.219
NP_442321.1_9 Reverse -220 -239 19.5673 0.265
NP_441127.1_1 Reverse -23 -37 10.1277 0.259
NP_440203.1_5 Reverse -228 -238 14.2375 0.0886
NP_441097.1_2 Reverse -293 -310 8.59364 0.236
NP_442690.1_1 Forward -64 -45 -10.9153 0.22
NP_441580.1_9 Reverse -258 -277 8.35759 0.273
NP_440369.1_5 Reverse -219 -238 8.06259 0.297
NP_442051.1_5 Reverse -20 -39 11.4058 0.29
NP_440993.1_4 Reverse -225 -242 9.38028 0.216
NP_443044.1_1 Reverse -156 -175 9.83255 0.212
NP_441099.1_5 Reverse -210 -229 -11.9969 0.294
NP_442013.1_7 Reverse -355 -374 5.70265 0.299
NP_441294.1_7 Forward -176 -162 9.73057 0.229
NP_440411.1_4 Forward -64 -45 17.5024 0.0789
NP_441424.1_2 Reverse -272 -291 11.8883 0.186
NP_441646.1_7 Reverse -304 -318 15.3392 0.243
NP_442431.1_10 Forward -150 -132 1.39578 0.254
NP_441292.1_2 Forward -390 -371 -3.14714 0.219
NP_441000.1_5 Reverse -48 -67 4.62021 0.284
NP_441000.1_6 Reverse -208 -222 -0.688726 0.208
NP_440206.1_4 Forward -311 -292 5.80018 0.242
NP_440260.1_8 Forward -222 -204 -4.99573 0.273
NP_441514.1_4 Forward -396 -377 13.1825 0.269
NP_440802.1_9 Reverse -334 -353 23.5006 0.0425
NP_442281.1_1 Reverse -215 -229 5.1122 0.169
NP_440479.1_9 Forward -321 -303 12.5072 0.297
NP_442012.1_5 Reverse -302 -321 1.67108 0.275
NP_442982.1_5 Reverse -153 -172 3.04771 0.212
NP_443030.1_4 Reverse -219 -238 -5.9004 0.272
NP_441644.1_10 Forward -71 -61 16.1063 0.286
NP_442215.1_2 Forward -249 -233 0.353528 0.153
NP_442215.1_2 Reverse -283 -299 -4.75968 0.239
NP_442029.1_1 Reverse -229 -248 -12.4886 0.247
NP_442247.1_10 Reverse -333 -352 14.7491 0.274
NP_442933.1_10 Reverse -163 -172 7.86621 0.103
NP_440576.1_5 Forward -130 -111 13.0775 0.175
NP_442554.1_8 Reverse -108 -118 2.83163 0.253
NP_442313.1_5 Forward -233 -214 16.7157 0.0719
NP_442142.1_4 Reverse -123 -136 2.772 0.278
NP_440919.1_7 Forward -61 -43 5.64375 0.285
NP_441715.1_9 Reverse -220 -234 16.8142 0.261
NP_440183.1_9 Forward -30 -11 -16.5201 0.276
NP_440379.1_5 Reverse -306 -325 -8.752 0.254
NP_441020.2_6 Forward -178 -161 6.23369 0.27
NP_441826.1_5 Reverse -286 -305 6.78429 0.222
NP_442719.1_2 Forward -41 -23 -11.0929 0.287
NP_441251.1_8 Reverse -34 -47 11.3298 0.27
NP_441056.1_1 Forward -229 -210 -6.1954 0.268
NP_440806.1_1 Forward -170 -152 11.8189 0.189
NP_443058.1_9 Reverse -369 -387 10.4422 0.276
NP_442361.1_8 Forward -335 -317 12.1139 0.282
NP_442808.1_1 Reverse -137 -147 2.63453 0.26
NP_441101.1_3 Reverse -303 -322 25.7622 0.00459
NP_441114.1_3 Reverse -227 -236 7.37455 0.239
NP_440558.1_2 Forward -238 -219 -5.40875 0.258
NP_440558.1_2 Forward -304 -285 -7.17871 0.289
NP_442789.1_4 Forward -118 -99 -3.04881 0.246
NP_441534.1_5 Reverse -27 -46 0.491109 0.293
NP_441445.1_1 Forward -125 -106 -0.197208 0.286
NP_441433.1_8 Reverse -185 -204 -4.72043 0.294
NP_440233.1_2 Forward -202 -183 -2.95047 0.285
NP_441574.1_1 Forward -147 -128 -2.85214 0.233
NP_441549.1_9 Reverse -216 -234 -9.81395 0.261
NP_442347.1_2 Reverse -311 -320 6.29291 0.175
NP_442317.1_6 Reverse -85 -104 3.34271 0.263
NP_440136.1_2 Forward -255 -248 3.97235 0.288
NP_440899.1_2 Forward -187 -168 6.1935 0.269
NP_441799.1_1 Reverse -243 -257 6.68548 0.165
NP_442333.2_5 Reverse -227 -246 -14.4552 0.275
NP_441118.1_10 Reverse -225 -243 16.3421 0.115
NP_440915.1_6 Forward -238 -224 -0.393733 0.193
NP_440717.1_3 Forward -244 -230 7.3738 0.28
NP_440319.1_5 Forward -278 -259 13.3716 0.294
NP_442866.1_1 Forward -252 -233 -9.34199 0.292
NP_439985.1_2 Forward -352 -333 12.6841 0.138
NP_442386.1_9 Forward -313 -304 10.4224 0.129
NP_442791.1_5 Reverse -302 -321 -12.2919 0.299
NP_442950.1_1 Forward -175 -156 -1.47551 0.206
NP_440684.1_3 Forward -187 -168 17.0107 0.178
NP_441232.1_10 Forward -224 -205 1.57275 0.279
NP_439937.1_8 Forward -149 -130 -5.11376 0.286
NP_439937.1_9 Reverse -137 -154 -15.1047 0.287
NP_442374.1_3 Forward -40 -23 12.4285 0.269
NP_440439.1_1 Forward -322 -309 -0.570702 0.226
NP_441572.1_1 Reverse -259 -278 -3.63879 0.214
NP_440267.1_2 Reverse -158 -172 5.01387 0.285
NP_440344.1_10 Forward -154 -137 -11.6625 0.223
NP_440562.1_3 Forward -277 -260 3.67709 0.219
NP_441896.1_3 Reverse -203 -222 0.196116 0.23
NP_440575.1_1 Forward -342 -323 -3.24622 0.294
NP_442845.1_2 Reverse -297 -311 6.78443 0.202
NP_443062.1_6 Forward -152 -133 3.6377 0.231
NP_442204.1_1 Reverse -263 -274 7.53183 0.127
NP_442859.1_2 Forward -233 -214 2.0644 0.28
NP_440673.1_3 Forward -30 -23 6.23397 0.283
NP_440436.1_4 Reverse -139 -148 5.80084 0.182
NP_440436.1_4 Forward -255 -246 4.22755 0.277
NP_441884.1_9 Forward -119 -100 -14.7502 0.138
NP_442907.1_9 Forward -323 -304 -6.39206 0.289
NP_441004.1_1 Forward -226 -207 -13.4719 0.257
NP_442206.1_7 Forward -236 -217 8.55425 0.295
NP_442854.1_4 Reverse -316 -335 10.7167 0.278
NP_443054.1_2 Reverse -89 -103 4.71948 0.24
NP_441851.1_9 Forward -304 -285 11.3075 0.224
NP_441851.1_10 Forward -257 -247 11.1898 0.0788
NP_441668.1_4 Reverse -335 -354 -0.590531 0.259
NP_441396.1_5 Reverse -343 -352 8.25953 0.224
NP_441982.1_6 Reverse -146 -155 12.1989 0.288
NP_440940.1_7 Forward -182 -164 2.67334 0.295
NP_439960.1_6 Reverse -135 -154 7.7676 0.28
NP_440474.1_8 Reverse -239 -253 5.99717 0.235
NP_440726.1_1 Reverse -363 -382 11.7992 0.113
NP_442006.1_2 Reverse -261 -278 -14.3175 0.203
NP_442243.1_1 Forward -307 -289 -1.55487 0.279
NP_441570.1_1 Reverse -220 -238 -17.8771 0.295
NP_442729.1_5 Reverse -230 -240 16.008 0.199
NP_442729.1_5 Reverse -197 -207 8.1415 0.248
NP_442729.1_5 Reverse -260 -270 8.04317 0.251
NP_442729.1_6 Reverse -221 -239 19.1431 0.108
NP_442443.1_1 Reverse -205 -224 -2.26216 0.254
NP_442443.1_4 Reverse -152 -162 16.1058 0.155
NP_440793.1_1 Forward -162 -148 12.192 0.279
NP_441091.1_5 Reverse -215 -234 3.14605 0.286
NP_441432.1_8 Forward -235 -226 2.65466 0.292
NP_442344.1_7 Reverse -248 -267 -5.9004 0.168
NP_442274.1_8 Reverse -137 -155 13.9515 0.286
NP_441945.1_10 Reverse -308 -327 12.0942 0.225
NP_442353.1_4 Reverse -139 -158 -0.29631 0.289
NP_440913.1_1 Reverse -290 -308 6.41066 0.228
NP_440713.1_3 Reverse -18 -37 8.84924 0.191
NP_441022.1_1 Forward -345 -336 11.834 0.273
NP_441022.1_1 Reverse -157 -166 10.8747 0.284
NP_439956.1_7 Forward -240 -221 4.52268 0.257
NP_442346.1_5 Reverse -22 -32 7.94484 0.152
NP_442346.1_5 Forward -56 -46 6.46988 0.201
NP_440352.1_5 Reverse -186 -205 13.0451 0.208
NP_440545.1_3 Reverse -237 -254 -0.846137 0.159
NP_441629.1_1 Reverse -162 -181 11.4058 0.154
NP_440459.1_2 Forward -356 -339 7.61033 0.285
NP_441943.1_8 Forward -327 -308 -5.21209 0.256
NP_442603.1_9 Reverse -218 -236 -0.275845 0.3
NP_440449.1_6 Forward -229 -211 4.85163 0.288
NP_442060.1_5 Forward -142 -123 11.5042 0.29
NP_440671.1_4 Forward -235 -221 5.40779 0.283
NP_440671.1_9 Reverse -73 -86 18.5055 0.159
NP_440594.1_5 Forward -275 -256 12.4867 0.293
NP_439901.1_1 Forward -115 -96 7.86593 0.235
NP_442089.1_6 Forward -234 -215 6.09597 0.222
NP_440035.1_6 Reverse -358 -377 7.86593 0.283
NP_441892.1_1 Reverse -216 -233 -5.56602 0.283
NP_440833.1_6 Reverse -53 -67 8.16044 0.277
NP_442138.1_10 Forward -172 -153 -1.67217 0.185
NP_440546.1_4 Forward -55 -45 6.65249 0.288
NP_441230.1_5 Reverse -93 -112 -1.08219 0.298
NP_442039.1_4 Forward -228 -221 8.69224 0.172
NP_440753.1_5 Reverse -244 -263 8.06259 0.29
NP_440160.1_2 Reverse -219 -238 -0.4922 0.232
NP_440160.1_9 Reverse -55 -74 7.47261 0.291
NP_442532.1_7 Forward -147 -133 1.76955 0.267
NP_440914.1_1 Forward -234 -224 8.41992 0.191
NP_441011.1_8 Forward -255 -246 4.91628 0.296
NP_442101.1_10 Reverse -155 -174 -13.2752 0.288
NP_442533.1_6 Reverse -126 -135 2.26134 0.266
NP_441219.1_6 Forward -257 -239 9.36059 0.274
NP_441482.1_7 Forward -312 -298 -3.83532 0.142
NP_441028.1_6 Forward -203 -193 12.6642 0.183
NP_441028.1_6 Reverse -311 -321 9.02601 0.216
NP_440721.1_5 Forward -353 -334 6.88182 0.28
NP_440115.1_6 Forward -175 -165 5.68323 0.227
NP_440007.1_9 Forward -310 -296 3.34284 0.27
NP_440007.1_9 Reverse -222 -236 1.27789 0.289
NP_441602.1_6 Forward -149 -130 12.7825 0.277
NP_441106.1_9 Forward -167 -157 15.6147 0.286
NP_441815.1_6 Forward -365 -346 8.65176 0.135
NP_441869.1_9 Reverse -97 -116 15.8307 0.219
NP_439903.1_6 Reverse -222 -241 5.60352 0.178
NP_439903.1_7 Forward -220 -201 7.7676 0.256
NP_442588.1_6 Reverse -258 -277 -3.04881 0.296
NP_441286.1_1 Reverse -106 -118 -5.95921 0.235
NP_442674.1_2 Forward -37 -18 11.1109 0.208
NP_441930.1_2 Reverse -225 -235 11.8781 0.271
NP_440886.1_7 Reverse -134 -144 3.12618 0.296
NP_441001.1_10 Forward -145 -126 8.65258 0.249
NP_442614.1_2 Reverse -22 -36 9.5377 0.242
NP_441808.1_8 Reverse -261 -280 5.80098 0.295
NP_441463.1_2 Reverse -73 -91 -1.1671 0.293
NP_441463.1_3 Forward -239 -220 -8.85033 0.274
NP_441463.1_3 Reverse -174 -193 -9.24366 0.278
NP_442238.1_1 Reverse -292 -311 5.60432 0.175
NP_441521.1_9 Reverse -191 -209 14.8671 0.287
NP_441993.1_1 Reverse -292 -311 4.28566 0.222
NP_441993.1_1 Forward -234 -215 1.55686 0.274
NP_440114.1_10 Forward -107 -93 9.73436 0.164
NP_442323.1_7 Reverse -292 -311 2.85027 0.258
NP_441510.2_7 Forward -240 -226 9.6354 0.281
NP_440293.1_3 Forward -72 -53 -5.60541 0.28
NP_442867.1_8 Forward -332 -313 7.96426 0.242
NP_440457.1_1 Forward -176 -164 -0.157684 0.254
NP_441801.1_4 Reverse -312 -322 2.92996 0.231
NP_440801.1_5 Reverse -76 -90 19.8624 0.101
NP_440801.1_10 Forward -151 -132 4.42435 0.291
NP_442509.1_9 Reverse -373 -383 13.3526 0.0571
NP_442862.1_3 Reverse -268 -285 7.11867 0.258
NP_442862.1_3 Reverse -73 -90 6.52869 0.263
NP_442341.1_9 Reverse -295 -309 4.71887 0.294
NP_442395.2_4 Reverse -219 -238 4.03023 0.188
NP_442495.1_4 Reverse -188 -198 12.8614 0.21
NP_440149.1_10 Reverse -292 -311 -11.7019 0.285
NP_441105.1_3 Reverse -214 -233 -3.83545 0.185
NP_441105.1_3 Forward -240 -221 -5.01543 0.211
NP_441105.1_3 Reverse -256 -275 -7.37537 0.251
NP_442329.1_8 Forward -205 -186 10.1275 0.17
NP_441226.1_7 Forward -311 -304 8.29857 0.205
NP_442834.1_9 Reverse -229 -248 16.8141 0.0851
NP_440416.1_9 Forward -236 -217 -6.78538 0.0943
NP_442154.1_1 Forward -146 -128 -8.24065 0.158
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATTAATCATAATCAAAGGCGGTTCATCGGGCTTATCCTGTTCACAATCCACCACCAAAAGTTGTTTGTTAATACCCACCTGGGGAGCAGCCAACCCGATACCATTGGCACTGTACATAGTCTGCAACATCTCCTTGGCCAATTTGCGAATGCTGTCATCCACCTTGGCAATGCGCTTGGCCGGTTGTCGGAGCACCTTGTCCCCTAGGTAATGAAGTTCTAAAGGGGGACGATCAACTTTTTGCTTTTCAACGAGGATGGTGGCAGTCATGGACGTTCTACGGGCCTATCTCAACAATGGGGTCTTGGACTACATCTTAACAAAATCACGGCCTGGACAATTTTCGCTATGGTTTAAAAGGTTTGCTTACCGTTGCCCGTTTGACTAGTTACACATCCT

CDS

ATGAATTTTTTGCTCACCAATGACGATGGCATTGATGCCCCTGGTATTGAAGCTCTCTATGAAGCCCTTGGTAAAAGGGGGGTGTGGGTGGCTCCCAAAAATCAACATTCCGGCTGTGGCCATAAGGTGACCACTGACCAGGCGATCGCCGTGGAACAAAGAGGCAAAAATCGTTACGCAGTGGACGGCACTCCGGCGGACTGTACCCGGTTGGGAGTAGTTCATTTTTATCCAGAAGTGGATTGGGTTATTGCCGGCATCAATGCGGGGGGCAATATGGGCATTGATTCCTACCTATCTGGCACAGTGGCGGCGGTACGGGAGGCGGCTATCCTTGGCCATAAGGCGATCGCCATTTCCCACTGGATTAACAAACCCCGCACCATTAACTGGGCCTGGGCTTCCCATTGGGCCAATGCTGTCTTCAATACCCTTTGGCAACAGGATTTACCCCCCCAACATTTTTGGAACGTTAACTTACCCCATTGGCAAAGTGGCGACCCGGAACCGGAGGTTATTTTTTGTGAACCCAGTCGGGATCCTCTGCCCGTGGCATTCACCATAGAAGGATCGAATTTCTTTTATCGGGGGGAATATAGCCAGCGACCACGGCAACCCGGCTCCGACATTGACGTTTGTTTTTCCGGCAACATTGCCATCACTCAGTTGAGAGTTTAA

Protein

MNFLLTNDDGIDAPGIEALYEALGKRGVWVAPKNQHSGCGHKVTTDQAIAVEQRGKNRYAVDGTPADCTRLGVVHFYPEVDWVIAGINAGGNMGIDSYLSGTVAAVREAAILGHKAIAISHWINKPRTINWAWASHWANAVFNTLWQQDLPPQHFWNVNLPHWQSGDPEPEVIFCEPSRDPLPVAFTIEGSNFFYRGEYSQRPRQPGSDIDVCFSGNIAITQLRV