Your browser is old and dusty. Try Google Chrome!

Details for sll1452

ORF sll1452
Accession NP_440810.1
Symbol nrtC
Category nitrate/nitrite transport system ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -240 -226 13.6676 0.166
NP_441061.1_2 Forward -260 -246 -2.55701 0.296
NP_441061.1_2 Reverse -216 -230 -2.55701 0.296
NP_440795.1_7 Reverse -11 -18 6.43063 0.265
NP_441418.1_6 Forward -261 -242 -19.0768 0.0844
NP_440897.1_6 Reverse -252 -271 10.1267 0.0705
NP_441453.1_1 Reverse -245 -263 13.4897 0.0938
NP_441453.1_4 Forward -261 -253 6.70593 0.121
NP_441960.1_2 Forward -238 -219 14.3558 0.298
NP_440561.1_5 Forward -290 -271 12.0942 0.278
NP_440259.1_4 Forward -220 -206 15.0951 0.175
NP_441098.1_3 Forward -170 -151 -7.6503 0.296
NP_443002.1_5 Reverse -244 -262 14.6697 0.196
NP_443002.1_5 Reverse -216 -234 11.2281 0.247
NP_442173.1_1 Reverse -253 -261 5.82095 0.2
NP_442752.1_4 Forward -261 -254 13.8055 0.0199
NP_439997.1_4 Forward -112 -93 6.58763 0.266
NP_442975.1_10 Reverse -248 -262 18.7801 0.00613
NP_440784.1_7 Reverse -253 -260 6.23397 0.241
NP_440784.1_7 Forward -260 -253 6.13563 0.241
NP_440061.1_9 Reverse -214 -228 6.88214 0.228
NP_440061.1_9 Reverse -219 -233 6.0955 0.261
NP_442826.1_6 Forward -287 -268 16.4207 0.122
NP_441859.1_1 Forward -327 -308 12.9791 0.296
NP_442242.1_4 Forward -260 -253 12.4288 0.0393
NP_440044.1_8 Reverse -253 -272 5.70265 0.0991
NP_439918.1_2 Forward -293 -274 2.0644 0.207
NP_441935.1_1 Forward -149 -130 8.55425 0.227
NP_440365.1_1 Reverse -322 -341 12.8432 0.256
NP_442110.1_7 Forward -293 -279 1.37622 0.23
NP_441925.1_4 Reverse -217 -236 -8.26108 0.207
NP_441083.1_5 Reverse -252 -262 9.81313 0.0224
NP_441738.1_2 Reverse -254 -261 15.28 0.0102
NP_440209.1_1 Forward -261 -253 14.8674 0.012
NP_440209.1_1 Reverse -252 -260 5.62429 0.0821
NP_442136.1_4 Forward -387 -368 5.80018 0.295
NP_440056.1_1 Reverse -273 -292 11.2092 0.191
NP_440178.1_7 Forward -225 -206 -22.8133 0.279
NP_442570.1_3 Forward -290 -271 -8.26035 0.283
NP_442461.1_4 Forward -228 -209 15.8307 0.202
NP_442111.1_4 Reverse -376 -390 4.42448 0.207
NP_442111.1_4 Reverse -129 -143 2.16287 0.286
NP_442111.1_4 Forward -262 -248 1.96621 0.292
NP_441495.1_1 Reverse -208 -227 7.86593 0.292
NP_440343.1_3 Reverse -217 -235 6.60656 0.228
NP_440906.1_5 Forward -260 -253 12.0355 0.0724
NP_440906.1_5 Reverse -253 -260 12.0355 0.0724
NP_440747.1_10 Forward -264 -252 -4.58258 0.109
NP_440322.1_2 Reverse -213 -231 20.9636 0.186
NP_441486.1_1 Forward -264 -250 -4.62196 0.204
NP_441014.1_2 Forward -231 -212 13.1758 0.245
NP_442848.1_9 Reverse -216 -235 1.17943 0.265
NP_443018.1_3 Forward -260 -253 5.34899 0.212
NP_443018.1_3 Reverse -253 -260 5.34899 0.212
NP_441634.1_8 Forward -263 -249 -2.95034 0.295
NP_441634.1_8 Reverse -195 -209 -3.34366 0.295
NP_440376.1_1 Forward -261 -252 -0.000272808 0.285
NP_440376.1_1 Reverse -252 -261 -0.0986038 0.285
NP_440376.1_1 Forward -225 -216 -0.0986038 0.285
NP_441588.1_4 Reverse -254 -264 8.92815 0.14
NP_442730.1_8 Forward -290 -271 17.1082 0.0647
NP_441077.1_6 Reverse -21 -37 10.7072 0.16
NP_442485.1_3 Forward -21 -2 -5.50708 0.291
NP_442735.1_2 Forward -266 -247 31.7604 0.000167
NP_442735.1_3 Forward -308 -289 31.8587 0.0000262
NP_442735.1_6 Forward -143 -124 27.2371 0.000992
NP_442735.1_7 Forward -245 -226 26.2538 0.00242
NP_440667.1_2 Forward -236 -217 -8.752 0.293
NP_440550.1_9 Reverse -254 -273 15.4374 0.281
NP_441950.1_7 Forward -236 -217 -1.57384 0.194
NP_441950.1_7 Forward -264 -245 -8.752 0.287
NP_442296.1_5 Forward -92 -73 0.58944 0.289
NP_440360.1_10 Reverse -217 -231 4.52282 0.227
NP_442658.1_1 Reverse -250 -260 13.2542 0.04
NP_442658.1_1 Reverse -139 -149 7.0594 0.214
NP_441855.2_4 Reverse -244 -263 16.85 0.0721
NP_440656.1_2 Reverse -92 -111 0.58944 0.258
NP_440656.1_8 Reverse -204 -223 -0.688862 0.162
NP_441414.1_9 Reverse -252 -271 -10.227 0.279
NP_442937.1_5 Forward -286 -267 6.09597 0.288
NP_442937.1_5 Forward -266 -247 5.80098 0.3
NP_441958.1_5 Forward -262 -252 -6.41148 0.28
NP_441127.1_1 Forward -261 -247 7.57108 0.3
NP_440450.1_7 Reverse -223 -237 15.3386 0.28
NP_440203.1_5 Reverse -218 -228 9.81266 0.245
NP_440203.1_5 Reverse -143 -153 9.81266 0.245
NP_440203.1_5 Reverse -255 -265 9.71433 0.245
NP_439905.1_1 Reverse -216 -229 9.2624 0.221
NP_442690.1_1 Forward -174 -155 -3.3438 0.142
NP_442064.1_4 Reverse -242 -261 5.30853 0.271
NP_443055.1_6 Reverse -133 -151 3.65664 0.195
NP_443055.1_6 Reverse -244 -262 3.36165 0.196
NP_440138.1_1 Reverse -140 -158 8.86816 0.197
NP_440138.1_6 Reverse -274 -293 2.16195 0.273
NP_441913.1_1 Reverse -203 -219 13.8198 0.246
NP_441099.1_5 Reverse -242 -261 -10.4236 0.253
NP_441654.1_5 Reverse -155 -174 13.6718 0.252
NP_441646.1_1 Forward -231 -212 1.37609 0.231
NP_442438.1_10 Forward -320 -306 0.88457 0.213
NP_442431.1_10 Forward -236 -218 0.412472 0.275
NP_441000.1_6 Reverse -251 -265 -4.62196 0.248
NP_442771.1_1 Forward -263 -245 -10.0106 0.239
NP_442870.1_4 Forward -214 -200 14.5526 0.289
NP_440147.1_4 Forward -263 -250 0.707601 0.247
NP_441550.1_8 Forward -263 -253 5.28945 0.255
NP_440206.1_4 Reverse -268 -287 -2.06626 0.293
NP_441041.1_4 Forward -293 -274 -1.57384 0.101
NP_441041.1_4 Forward -236 -217 -11.7019 0.251
NP_442642.1_9 Reverse -245 -262 2.89044 0.192
NP_440703.1_9 Forward -85 -72 5.13193 0.293
NP_439966.1_7 Reverse -250 -260 9.22267 0.119
NP_439966.1_9 Reverse -250 -259 9.93116 0.186
NP_442941.1_3 Reverse -253 -263 1.35667 0.15
NP_440289.1_2 Reverse -249 -262 0.0192843 0.178
NP_440260.1_8 Forward -57 -39 -4.20908 0.267
NP_441678.1_9 Forward -293 -274 -0.197208 0.225
NP_442281.1_1 Reverse -268 -282 7.17714 0.106
NP_442281.1_1 Reverse -211 -225 6.98048 0.111
NP_442281.1_1 Reverse -136 -150 1.76896 0.29
NP_440177.1_1 Reverse -245 -263 4.24738 0.272
NP_442012.1_1 Reverse -300 -319 10.9142 0.0769
NP_442012.1_5 Forward -322 -303 1.27776 0.275
NP_443030.1_4 Reverse -272 -291 -0.295539 0.222
NP_442068.1_4 Reverse -250 -269 6.09517 0.24
NP_441644.1_6 Reverse -252 -262 5.87944 0.174
NP_442247.1_8 Forward -263 -249 8.25939 0.281
NP_440253.1_2 Forward -261 -243 -2.73412 0.274
NP_441346.1_4 Forward -95 -76 17.0107 0.184
NP_442933.1_10 Forward -261 -252 5.40793 0.19
NP_442554.1_8 Reverse -253 -263 5.5849 0.145
NP_441762.1_7 Forward -262 -250 4.66053 0.0458
NP_441762.1_7 Reverse -251 -263 -7.63084 0.296
NP_442142.1_4 Reverse -249 -262 8.86849 0.106
NP_442292.1_1 Reverse -253 -262 8.75118 0.0306
NP_443009.1_5 Reverse -196 -207 8.02298 0.118
NP_442301.1_2 Reverse -214 -233 11.7 0.159
NP_440183.1_9 Reverse -217 -236 -15.3402 0.273
NP_440379.1_5 Reverse -243 -262 -7.17871 0.24
NP_441468.1_1 Reverse -253 -260 6.13563 0.209
NP_441468.1_1 Forward -260 -253 6.0373 0.223
NP_441020.2_6 Forward -263 -246 5.84037 0.289
NP_441673.1_1 Forward -261 -252 1.27803 0.155
NP_441673.1_1 Reverse -252 -261 1.27803 0.155
NP_440286.1_1 Forward -291 -273 13.1955 0.156
NP_442490.1_9 Reverse -240 -259 -5.01543 0.273
NP_442868.1_6 Forward -263 -253 -0.0199663 0.255
NP_442719.1_2 Reverse -67 -85 -11.2896 0.291
NP_442227.1_2 Reverse -245 -264 -2.0655 0.27
NP_442808.1_1 Reverse -251 -261 17.5808 0.00507
NP_442808.1_1 Reverse -264 -274 2.43787 0.266
NP_440918.1_2 Forward -278 -259 14.7491 0.259
NP_442542.1_2 Reverse -250 -263 4.93583 0.29
NP_442739.1_2 Forward -40 -21 12.672 0.246
NP_440385.1_5 Reverse -319 -338 15.4374 0.255
NP_441114.1_3 Reverse -217 -226 17.1093 0.113
NP_441114.1_3 Reverse -142 -151 8.35786 0.231
NP_441114.1_3 Reverse -274 -283 7.37455 0.239
NP_440558.1_2 Reverse -275 -294 3.83436 0.153
NP_440558.1_2 Reverse -212 -231 -2.55715 0.229
NP_440558.1_2 Forward -319 -300 -3.73712 0.238
NP_441878.1_6 Forward -225 -215 -6.70647 0.194
NP_441036.1_3 Reverse -265 -284 -3.63879 0.258
NP_441036.1_8 Reverse -251 -261 13.8447 0.0353
NP_441557.1_5 Forward -261 -252 0.983037 0.0911
NP_441557.1_5 Reverse -252 -261 0.688044 0.128
NP_441445.1_1 Forward -270 -251 6.19431 0.153
NP_441445.1_1 Forward -249 -230 3.73603 0.208
NP_440084.1_5 Forward -210 -191 13.4708 0.133
NP_441458.1_10 Reverse -243 -262 2.94938 0.26
NP_442183.1_1 Forward -261 -247 8.75105 0.109
NP_441407.1_5 Forward -338 -319 3.44104 0.279
NP_442347.1_2 Forward -98 -89 4.81794 0.257
NP_442347.1_2 Reverse -253 -262 3.93297 0.284
NP_441037.1_4 Forward -263 -253 6.92787 0.237
NP_441633.1_3 Forward -263 -250 -1.25902 0.154
NP_440136.1_2 Reverse -253 -260 6.23397 0.171
NP_440136.1_2 Forward -260 -253 6.13563 0.193
NP_442998.1_10 Reverse -254 -261 15.5754 0.0102
NP_440899.1_1 Forward -293 -274 5.96765 0.291
NP_440299.1_1 Reverse -248 -261 7.98351 0.1
NP_440299.1_1 Forward -265 -252 3.85363 0.228
NP_440810.1_1 Forward -218 -199 35.0053 0.00000578
NP_440810.1_4 Forward -287 -268 26.1555 0.00375
NP_440810.1_5 Forward -173 -154 22.9106 0.0378
NP_440810.1_8 Forward -332 -313 22.8114 0.0221
NP_440810.1_9 Forward -392 -373 22.3206 0.038
NP_440810.1_10 Forward -353 -334 23.7947 0.0255
NP_441799.1_1 Forward -265 -251 9.53707 0.0901
NP_441799.1_1 Forward -228 -214 5.89884 0.19
NP_441799.1_4 Reverse -216 -235 5.89931 0.0864
NP_440256.1_1 Forward -243 -224 -1.96717 0.111
NP_440256.1_1 Forward -350 -331 -9.047 0.273
NP_441512.1_4 Forward -265 -246 11.1109 0.237
NP_440915.1_6 Forward -229 -215 -2.36035 0.268
NP_442158.1_4 Forward -213 -203 13.943 0.21
NP_442158.1_4 Forward -158 -148 13.5497 0.231
NP_441866.1_4 Forward -146 -133 12.3695 0.282
NP_442866.1_1 Forward -230 -211 -8.85033 0.285
NP_440748.1_5 Reverse -275 -294 17.6007 0.0713
NP_441464.1_10 Forward -235 -221 17.4042 0.129
NP_441939.1_3 Forward -260 -241 13.3725 0.0913
NP_441939.1_4 Reverse -71 -90 14.5621 0.202
NP_442386.1_9 Reverse -196 -205 9.04574 0.175
NP_442386.1_9 Reverse -251 -260 8.06244 0.209
NP_442386.1_9 Forward -207 -198 8.06244 0.209
NP_440570.1_5 Forward -291 -272 3.93269 0.231
NP_441340.1_5 Forward -260 -253 6.13563 0.175
NP_441340.1_5 Reverse -253 -260 5.93897 0.198
NP_440327.1_6 Forward -293 -274 4.71934 0.269
NP_440194.1_3 Forward -109 -90 5.60432 0.271
NP_440586.1_8 Forward -260 -253 11.4451 0.0645
NP_442251.1_6 Reverse -253 -260 12.0355 0.0627
NP_441262.1_3 Forward -261 -254 14.7888 0.0223
NP_443051.1_1 Forward -262 -253 0.786375 0.125
NP_439937.1_9 Reverse -251 -268 -9.40158 0.188
NP_441657.1_5 Forward -257 -238 7.57094 0.133
NP_440408.1_7 Forward -259 -240 12.4875 0.21
NP_440372.1_2 Forward -260 -253 6.72562 0.0929
NP_440372.1_2 Reverse -253 -260 6.62729 0.151
NP_441181.1_6 Forward -260 -242 10.5406 0.219
NP_441181.1_6 Forward -239 -221 2.47742 0.295
NP_440819.1_5 Reverse -367 -375 7.8859 0.266
NP_441803.1_2 Reverse -301 -320 -0.787193 0.286
NP_439977.1_5 Forward -299 -280 -0.295539 0.222
NP_439977.1_5 Reverse -246 -265 -2.85214 0.29
NP_440267.1_2 Reverse -210 -224 7.17714 0.207
NP_442384.1_10 Reverse -252 -265 5.62415 0.124
NP_442035.1_4 Reverse -198 -217 11.6025 0.217
NP_442035.1_8 Reverse -249 -263 19.8624 0.0866
NP_442085.1_1 Reverse -150 -169 14.5621 0.246
NP_441604.1_4 Forward -289 -270 -6.29373 0.293
NP_441018.1_7 Forward -285 -266 10.6192 0.201
NP_441018.1_7 Forward -234 -215 6.4893 0.286
NP_440344.1_10 Reverse -245 -262 7.90532 0.0119
NP_440344.1_10 Forward -213 -196 -12.4492 0.254
NP_441335.1_4 Reverse -186 -205 9.43923 0.26
NP_441965.1_10 Reverse -249 -265 3.69678 0.256
NP_440297.1_9 Reverse -216 -226 4.20827 0.238
NP_440350.1_1 Forward -277 -258 0.687771 0.21
NP_442187.1_3 Forward -262 -252 16.893 0.0619
NP_441592.1_4 Reverse -216 -235 -4.03212 0.293
NP_440990.1_7 Reverse -240 -259 4.42435 0.292
NP_440999.1_9 Reverse -248 -262 5.1128 0.113
NP_440999.1_9 Forward -316 -302 3.24451 0.133
NP_440888.1_2 Reverse -306 -320 8.06211 0.172
NP_440052.1_5 Reverse -241 -260 -1.47551 0.197
NP_441949.1_4 Forward -238 -219 11.8975 0.174
NP_441543.1_2 Reverse -253 -262 7.17789 0.131
NP_442845.1_2 Reverse -191 -205 14.5526 0.0796
NP_442845.1_2 Forward -231 -217 6.29277 0.212
NP_441178.1_6 Reverse -249 -268 1.08032 0.291
NP_441469.1_8 Forward -207 -198 5.80125 0.253
NP_441469.1_8 Reverse -251 -260 5.70292 0.257
NP_442315.1_1 Forward -235 -217 4.44404 0.271
NP_443064.1_6 Reverse -252 -262 8.39772 0.292
NP_443064.1_7 Forward -352 -333 15.7972 0.262
NP_442337.1_8 Forward -272 -253 0.687771 0.245
NP_442578.1_7 Reverse -115 -122 9.38056 0.138
NP_442578.1_7 Forward -260 -253 5.93897 0.183
NP_440710.1_1 Reverse -264 -282 -3.02911 0.205
NP_440220.1_4 Forward -348 -329 -3.83621 0.297
NP_441462.1_2 Forward -261 -251 -0.118297 0.184
NP_443062.1_6 Forward -269 -250 5.70265 0.198
NP_440516.1_8 Forward -261 -252 17.6993 0.00442
NP_442428.1_5 Reverse -253 -260 6.13563 0.209
NP_442428.1_5 Forward -260 -253 6.0373 0.212
NP_442120.1_10 Forward -224 -205 -9.73531 0.244
NP_440673.1_2 Forward -271 -252 9.51162 0.243
NP_440673.1_3 Reverse -254 -261 12.4288 0.0426
NP_441714.1_3 Reverse -245 -263 15.2596 0.157
NP_441052.1_2 Reverse -252 -262 10.7964 0.0285
NP_442219.1_8 Forward -235 -216 6.71761 0.291
NP_442219.1_9 Reverse -253 -262 8.06287 0.0696
NP_440436.1_4 Reverse -253 -262 13.9623 0.0193
NP_440436.1_4 Forward -260 -251 5.80084 0.182
NP_441884.1_9 Reverse -249 -268 -22.0267 0.275
NP_440222.1_6 Reverse -104 -117 12.409 0.289
NP_441719.1_4 Forward -260 -253 6.72562 0.093
NP_441719.1_4 Reverse -253 -260 6.62729 0.151
NP_441004.1_2 Forward -257 -238 4.12936 0.198
NP_442366.1_5 Forward -264 -254 17.2858 0.0141
NP_442176.1_9 Reverse -246 -260 15.4376 0.174
NP_442694.1_4 Reverse -343 -352 12.5861 0.249
NP_442694.1_4 Forward -219 -210 11.3078 0.277
NP_442206.1_1 Reverse -215 -234 -9.63698 0.219
NP_442206.1_1 Reverse -306 -325 -14.7502 0.282
NP_443054.1_2 Reverse -214 -228 0.294584 0.269
NP_441851.1_10 Forward -207 -197 10.9931 0.0821
NP_440593.1_3 Forward -304 -285 -3.73712 0.241
NP_440355.1_2 Reverse -346 -365 13.0766 0.27
NP_442689.1_8 Forward -170 -153 -5.95935 0.279
NP_442450.1_3 Forward -360 -342 5.32826 0.275
NP_442168.1_5 Forward -205 -186 -2.16383 0.264
NP_440588.1_2 Forward -270 -251 -1.27885 0.155
NP_442006.1_2 Forward -261 -244 -16.2841 0.247
NP_441078.1_4 Reverse -252 -261 0.0980582 0.205
NP_441078.1_4 Forward -261 -252 0.0980582 0.205
NP_442729.1_5 Forward -262 -252 8.1415 0.248
NP_442729.1_8 Reverse -193 -206 6.80412 0.178
NP_441663.1_8 Reverse -362 -381 0.294447 0.22
NP_442348.1_2 Forward -150 -141 12.2911 0.218
NP_442348.1_2 Forward -225 -216 11.8978 0.225
NP_441432.1_8 Forward -262 -253 7.17789 0.102
NP_441432.1_8 Forward -225 -216 3.83464 0.243
NP_441432.1_8 Forward -282 -273 2.65466 0.292
NP_442320.1_8 Reverse -246 -260 -1.8687 0.0845
NP_441732.1_2 Reverse -217 -233 -17.346 0.253
NP_440503.1_8 Reverse -9 -28 20.7473 0.0777
NP_441057.1_4 Forward -262 -244 -2.93078 0.276
NP_442400.1_10 Reverse -25 -38 8.0831 0.279
NP_442400.1_10 Reverse -100 -113 7.12818 0.298
NP_442489.1_7 Reverse -252 -261 0.786375 0.152
NP_442489.1_7 Forward -261 -252 0.589713 0.17
NP_440559.1_1 Reverse -253 -262 14.1594 0.0317
NP_440442.1_3 Reverse -245 -259 14.5526 0.287
NP_442346.1_5 Forward -262 -252 6.8632 0.188
NP_442346.1_5 Forward -225 -215 4.40493 0.29
NP_440545.1_3 Forward -265 -248 -4.09106 0.218
NP_440545.1_5 Forward -265 -248 7.61033 0.21
NP_440459.1_2 Forward -290 -273 10.3636 0.2
NP_440010.1_1 Forward -164 -145 8.16093 0.213
NP_440010.1_10 Forward -264 -245 5.30933 0.234
NP_441585.1_5 Forward -92 -73 -0.00131823 0.291
NP_441948.1_4 Forward -268 -250 10.6389 0.0543
NP_441833.1_4 Reverse -253 -260 14.1004 0.0258
NP_441833.1_4 Forward -260 -253 6.13563 0.198
NP_442162.1_9 Reverse -253 -260 6.62729 0.142
NP_442162.1_9 Forward -260 -253 6.52896 0.178
NP_440671.1_4 Forward -246 -232 11.2093 0.138
NP_441044.1_4 Reverse -138 -156 3.46073 0.235
NP_442073.1_6 Reverse -243 -262 0.982764 0.25
NP_442140.1_3 Forward -260 -250 17.7779 0.0159
NP_441609.1_1 Reverse -344 -363 5.30933 0.189
NP_441813.1_5 Reverse -250 -260 0.471689 0.201
NP_442089.1_1 Forward -264 -245 6.19431 0.144
NP_440590.1_4 Reverse -253 -266 8.77074 0.042
NP_440590.1_4 Forward -260 -247 1.39592 0.125
NP_440590.1_4 Reverse -285 -298 -5.68391 0.286
NP_440567.1_1 Forward -260 -246 8.94771 0.0517
NP_440567.1_1 Reverse -253 -267 -0.0987402 0.264
NP_442497.1_10 Reverse -253 -262 0.688044 0.141
NP_440821.1_4 Reverse -250 -260 6.66654 0.0837
NP_440821.1_4 Forward -263 -253 -0.41329 0.257
NP_442707.1_2 Forward -309 -299 16.7946 0.27
NP_441239.1_9 Reverse -250 -262 6.52882 0.185
NP_441239.1_9 Reverse -83 -95 2.98891 0.3
NP_441951.1_4 Forward -267 -248 4.03102 0.273
NP_442568.1_8 Reverse -210 -224 14.7492 0.237
NP_441892.1_1 Forward -296 -279 -0.944468 0.193
NP_442669.1_1 Forward -121 -102 3.14605 0.168
NP_442044.1_1 Reverse -216 -235 -4.72043 0.18
NP_442270.1_9 Forward -292 -273 -8.45701 0.219
NP_442270.1_9 Forward -272 -253 -9.24366 0.228
NP_442643.1_3 Reverse -273 -292 -3.24547 0.261
NP_440546.1_4 Forward -261 -251 11.0156 0.0991
NP_440462.1_6 Reverse -250 -260 7.45319 0.0788
NP_440868.1_4 Forward -265 -253 6.1355 0.0878
NP_441582.1_5 Reverse -250 -269 3.63691 0.264
NP_442402.1_10 Reverse -102 -112 13.8442 0.182
NP_441084.1_6 Reverse -270 -284 10.8954 0.226
NP_440843.1_8 Forward -224 -205 13.9625 0.297
NP_442696.1_2 Forward -262 -244 9.55725 0.244
NP_442837.1_3 Reverse -253 -260 6.13563 0.25
NP_442837.1_3 Forward -260 -253 5.93897 0.265
NP_442053.1_1 Forward -261 -252 7.76787 0.0895
NP_442053.1_1 Reverse -252 -261 7.17789 0.104
NP_440505.1_3 Forward -263 -253 7.94484 0.147
NP_442532.1_2 Forward -361 -342 0.429291 0.275
NP_442532.1_3 Forward -220 -201 16.2394 0.277
NP_442532.1_7 Forward -261 -247 15.4376 0.0593
NP_440914.1_1 Reverse -252 -262 13.4947 0.0297
NP_440914.1_1 Reverse -141 -151 12.3236 0.0614
NP_440914.1_1 Reverse -216 -226 11.9332 0.0746
NP_440914.1_1 Reverse -273 -283 8.41992 0.191
NP_440914.1_1 Reverse -231 -241 6.3705 0.283
NP_441011.1_8 Forward -260 -251 5.60459 0.247
NP_442101.1_6 Reverse -339 -358 18.1907 0.133
NP_442533.1_6 Reverse -216 -225 4.0313 0.194
NP_440816.1_7 Reverse -248 -267 12.2908 0.209
NP_440116.1_5 Forward -264 -247 3.97208 0.222
NP_441527.1_4 Reverse -111 -130 4.15348 0.111
NP_441527.1_4 Reverse -322 -341 -6.25514 0.215
NP_441527.1_7 Forward -45 -26 9.24175 0.282
NP_440115.1_6 Forward -264 -254 8.33817 0.13
NP_442673.1_7 Forward -214 -195 13.7982 0.208
NP_441972.1_5 Forward -298 -279 0.982764 0.143
NP_441106.1_1 Reverse -251 -260 5.70292 0.131
NP_439903.1_6 Reverse -212 -231 8.94676 0.131
NP_439903.1_6 Reverse -269 -288 4.52188 0.193
NP_439903.1_6 Reverse -275 -294 2.55527 0.225
NP_439903.1_6 Forward -59 -40 -0.787962 0.285
NP_442306.1_10 Forward -266 -247 -11.2103 0.121
NP_441286.1_1 Forward -262 -250 11.2487 0.013
NP_440670.1_8 Reverse -252 -261 6.8829 0.0907
NP_440886.1_7 Reverse -251 -261 8.53436 0.0805
NP_440886.1_7 Reverse -245 -255 4.89613 0.213
NP_440886.1_7 Reverse -223 -233 4.89613 0.213
NP_442125.1_2 Reverse -321 -340 6.98095 0.224
NP_441021.1_1 Reverse -273 -292 -3.83545 0.162
NP_441463.1_3 Forward -181 -162 -5.80207 0.232
NP_441463.1_6 Reverse -214 -228 7.189 0.265
NP_441626.1_2 Forward -260 -253 6.0373 0.212
NP_441626.1_2 Reverse -253 -260 6.0373 0.212
NP_442615.1_1 Forward -270 -252 -4.40575 0.185
NP_440387.1_1 Forward -261 -245 -2.89139 0.152
NP_441836.1_2 Forward -264 -245 3.14605 0.159
NP_441993.1_1 Forward -281 -262 9.06107 0.136
NP_441993.1_1 Forward -246 -227 3.60346 0.231
NP_440814.1_8 Reverse -10 -29 0.294447 0.269
NP_440114.1_10 Forward -225 -211 9.63603 0.168
NP_440114.1_10 Reverse -337 -351 7.17775 0.243
NP_441510.2_7 Reverse -273 -287 13.1753 0.28
NP_440293.1_3 Forward -232 -213 -2.45882 0.241
NP_441237.1_9 Reverse -216 -226 10.7964 0.218
NP_441237.1_9 Reverse -253 -263 10.5014 0.228
NP_440643.1_6 Reverse -273 -292 6.19431 0.214
NP_442930.1_1 Forward -305 -295 9.41933 0.287
NP_439910.1_2 Reverse -207 -224 -22.6756 0.285
NP_440213.1_5 Reverse -333 -352 12.5858 0.205
NP_440801.1_8 Reverse -251 -270 2.16274 0.229
NP_441984.1_3 Reverse -130 -148 5.72234 0.278
NP_442509.1_9 Reverse -47 -57 8.23937 0.192
NP_442936.1_7 Reverse -71 -90 18.879 0.026
NP_440734.1_9 Reverse -221 -240 9.53756 0.287
NP_441885.1_5 Reverse -252 -262 1.35667 0.11
NP_442341.1_7 Forward -262 -248 1.86788 0.278
NP_440423.1_6 Forward -248 -229 -12.9802 0.204
NP_443000.1_7 Forward -263 -253 0.471689 0.298
NP_441842.1_1 Reverse -254 -267 16.0466 0.0502
NP_441842.1_10 Forward -268 -254 6.58777 0.283
NP_440275.1_3 Reverse -250 -260 6.46988 0.105
NP_442932.1_9 Reverse -33 -52 8.75091 0.239
NP_440679.1_10 Forward -265 -246 -20.1584 0.283
NP_439962.1_4 Reverse -244 -263 -0.000545616 0.197
NP_440216.1_9 Reverse -292 -301 5.40793 0.294
NP_440172.1_1 Forward -224 -214 4.3066 0.194
NP_440249.1_2 Reverse -21 -31 15.0242 0.268
NP_442015.1_10 Reverse -280 -293 -1.16069 0.297
NP_441111.1_7 Reverse -253 -261 8.96754 0.0463
NP_441766.1_2 Reverse -252 -261 8.65285 0.0495
NP_442116.1_6 Forward -342 -325 8.64641 0.244
NP_442154.1_1 Forward -269 -251 -16.8938 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACAGGTTCCCCAGGATTATCGGAATGTTTCCCGGGTTCTAAAACTCTCCAAAAGCCAATACTTTTTCAATATTCTATTCCCGGCAGCAGTGCCCTACATTTTCACTGGCCTACGCATTGGCATTGGTCTTTCCTGGTTGGCGATCGTGGCAGCGGAAATGCTGATTGGTGGTGTGGGCATTGGCTTTTTTATCTGGGATGCCTATAACAGCTCCCTGATCAGTGAAATCATTATTGCCTTAATTTATGTGGGCATTGTCGGTTTATTGCTAGATCGTTTTATCGCTTTTCTGGAAAGTTTAGTGGTCCCAGCGGAGCAAAAGTGACCAAACATCCATAGGAAGGCCGTTTTTCCTAGCTACTAGTTCTCAATTTTTGATTTGTCACCCCCGGACTAACT

CDS

ATGATGCCCTTCATTGAAATTGATCATGTTGACCGTATTTTTCCCCTCCCCGACGGGGGGCGTTACATTGCCCTCAAAAACATTGAGCTGAAAATTAGTCAGGGAGAATTTATTTCCTTGATTGGTCACTCTGGCTGCGGCAAGTCTACCTTGTTGAACATGATCTCTGGGCTAGATAAGCCCACCTTTGGCGGGGTCATCATGGAGGGGAAAGAAATCACCGAGCCTGGCCCTGAAAGGATGGTGGTGTTTCAAAACTACTCCCTGTTGCCTTGGTTGACGGTGCGACAAAATATCGCCCTGGCTGTGAATCGAGTTCTGCGGGATCTGCCCAAACCAGAACAAGAAAAAATTATTGACGACAATATTGCCCTGGTGGGGTTACAACGGGCAGCCCATAAACGACCGGGGGAATTGTCCGGGGGCATGAAACAGCGGGTGGCGATCGCCAGGGCATTATCGACCCGTCCTAAGGTTTTATTATTGGATGAACCGTTTGGGGCTTTGGATGCTTTAACCCGGGGGAATCTCCAGGAACGGTTAATGGAAATTGTCCAAGAAAGTGGCGTAACCTGCATTATGGTCACCCATGATGTGGACGAAGCATTGTTACTTTCTGACCGGGTGGTGATGTTAACCACAGGGCCCGAAGCCCACATTGGGCAAATTTTGGAAGTGCCCATTCCTCGACCCCGTCACCGTTTGGAAGTGGTCAACCATCCCAGTTACTACGCCCTGCGGGGGGAAATGGTTTATTTCCTCAATCAACAAAAACGGGCTAAAAAAGTTGGGGCGGTCAGTCAGTTTGCCGAGGCCATGGGGGGCAATGGCCTGGAAAAAATCAATCTGGACTTAGGTTTTATCCCCCTCACCGATTGCGCCCCGTTAGTGGTAGCCAAAGAGAAAGGTTTCTTCCAAAAGCATGGTTTAGAGCAAGTTAACCTGGTGAAAGAACCCAGTTGGCAGGCGATCGCCGACGGCATTCGGGAAAGACGGTTAGACGGAGCCCAAATGGTAGCGGGTATGCCCCTAGCTCTAACCCTAGGCATGGGGGGGAAAACCCCTTTACCCATGGTTACGGCCATGGTGATGAGTCGCAACGGCAATGCCATTACCCTCAGCAAAAAGTTTGCTGAAGCGGGGGTTAAAACCCTCGAAGATTTACGGTTAAAGCTAGCAGAAACTCCCGATCAAGTTTCCACCCTGGGCATGGTTCACCCCGCATCTATGCAAAATCTGTTACTGCGGTATTGGCTTGCTTCTGGCAGTATTGATCCAGACCAAGATATTAATTTAATGCGCCTACCACCGCCCCAAATGGTGTCTAATTTAGAAGCTGGCAATATTGACGGTTTTTGTGTGGGGGAACCATGGAATTCCTATGCTGTTAAACAGAATTTAGGCTATGTTATTGCCACGGATTTAGACATTTGGAACGGTCATCCGGAAAAGGTTTTAGGAATGCGGGAAGAATGGGTCAATAAATATCCAGCCACCCATTTAGCCCTGGTTAAAGCTCTGTTGGAAGCCTGTGAATATTGTGACGATCGCCGTCATCGCCAAGAAATTCTAGACTATTTGGCATTGCCTCAATATGTCGGCACCTCCACGGAATATATCAGTCCAGGCTTTTTGACTGAATATGATCAAGGAAATGACGCAGAAGCGGAAATGTTGCTGGACTTCAATCAATTTTATGTCAAGCAATCTAACTATCCCTCCCGCAGTGAAGGGTTATGGATTCTGACCCAATTAGCCCGTTGGGGTTACATTGATTTTCCTAAAAACTGGGTGGAAATTATTGAACGGGTACGCCGTCCTGACCTATTTGGGGAAGCCTGTCGCCATTTAGGGTGGCCAGATTTAGAAGGTGATCACCACAATGTTTCCCTGTTTGATGGCATGGTTTTCACCCCGAATGATCCCCTTGGTTACATTAAACGTTTCACCATTCACCGGGATATTCAAGTCACAGAAATTCTCATCGACCAAATTGATCAAGTTAATCAATAG

Protein

MMPFIEIDHVDRIFPLPDGGRYIALKNIELKISQGEFISLIGHSGCGKSTLLNMISGLDKPTFGGVIMEGKEITEPGPERMVVFQNYSLLPWLTVRQNIALAVNRVLRDLPKPEQEKIIDDNIALVGLQRAAHKRPGELSGGMKQRVAIARALSTRPKVLLLDEPFGALDALTRGNLQERLMEIVQESGVTCIMVTHDVDEALLLSDRVVMLTTGPEAHIGQILEVPIPRPRHRLEVVNHPSYYALRGEMVYFLNQQKRAKKVGAVSQFAEAMGGNGLEKINLDLGFIPLTDCAPLVVAKEKGFFQKHGLEQVNLVKEPSWQAIADGIRERRLDGAQMVAGMPLALTLGMGGKTPLPMVTAMVMSRNGNAITLSKKFAEAGVKTLEDLRLKLAETPDQVSTLGMVHPASMQNLLLRYWLASGSIDPDQDINLMRLPPPQMVSNLEAGNIDGFCVGEPWNSYAVKQNLGYVIATDLDIWNGHPEKVLGMREEWVNKYPATHLALVKALLEACEYCDDRRHRQEILDYLALPQYVGTSTEYISPGFLTEYDQGNDAEAEMLLDFNQFYVKQSNYPSRSEGLWILTQLARWGYIDFPKNWVEIIERVRRPDLFGEACRHLGWPDLEGDHHNVSLFDGMVFTPNDPLGYIKRFTIHRDIQVTEILIDQIDQVNQ