Your browser is old and dusty. Try Google Chrome!

Details for sll1446

ORF sll1446
Accession NP_441617.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -289 -275 1.17956 0.193
NP_440795.1_7 Reverse -175 -182 10.2655 0.154
NP_441418.1_6 Reverse -294 -313 -21.24 0.143
NP_441418.1_6 Reverse -281 -300 -29.7948 0.238
NP_442291.1_5 Forward -291 -275 4.48343 0.0906
NP_440897.1_6 Reverse -9 -28 3.63691 0.143
NP_441453.1_4 Forward -290 -282 6.80426 0.121
NP_441453.1_4 Reverse -281 -289 6.11594 0.121
NP_441623.1_1 Reverse -176 -194 -1.45582 0.24
NP_441623.1_1 Forward -399 -381 -3.42244 0.258
NP_442151.1_6 Forward -303 -289 9.73436 0.141
NP_441818.1_9 Reverse -6 -25 -4.42544 0.236
NP_442623.1_1 Reverse -73 -92 -17.6018 0.282
NP_442744.1_9 Reverse -275 -289 14.0957 0.266
NP_442655.1_2 Reverse -63 -82 2.65439 0.259
NP_443002.1_5 Forward -26 -8 9.26148 0.296
NP_442173.1_1 Reverse -282 -290 12.0158 0.0316
NP_442173.1_1 Forward -289 -281 10.7375 0.0611
NP_442173.1_1 Forward -374 -366 5.72262 0.203
NP_442173.1_6 Reverse -177 -191 11.5043 0.21
NP_442752.1_3 Reverse -82 -92 16.2308 0.239
NP_442752.1_4 Forward -290 -283 13.8055 0.0199
NP_443027.1_4 Reverse -279 -289 5.97822 0.294
NP_442975.1_10 Reverse -182 -196 2.94893 0.266
NP_441225.1_4 Forward -25 -6 -11.8986 0.284
NP_440784.1_7 Forward -289 -282 6.23397 0.241
NP_440784.1_7 Reverse -282 -289 6.13563 0.241
NP_442062.1_8 Forward -290 -280 9.32148 0.0633
NP_440304.1_4 Reverse -161 -171 2.7333 0.299
NP_440044.1_8 Forward -238 -219 -0.688862 0.225
NP_441208.1_9 Forward -126 -112 7.9644 0.219
NP_441208.1_9 Forward -195 -181 4.62115 0.297
NP_441594.1_6 Reverse -15 -34 4.42435 0.221
NP_441594.1_6 Reverse -297 -316 4.03102 0.223
NP_441925.1_4 Reverse -91 -110 -14.1609 0.261
NP_441925.1_4 Forward -25 -6 -16.6192 0.284
NP_440856.1_7 Reverse -365 -384 -2.65548 0.191
NP_440856.1_7 Forward -81 -62 -6.78538 0.246
NP_441083.1_5 Reverse -281 -291 0.766681 0.218
NP_441083.1_5 Forward -290 -280 -0.904945 0.283
NP_441434.1_3 Forward -196 -177 2.0644 0.194
NP_441738.1_2 Reverse -283 -290 15.28 0.0102
NP_440209.1_1 Forward -290 -282 8.57422 0.0425
NP_442136.1_4 Reverse -176 -195 4.91521 0.295
NP_442889.1_8 Reverse -278 -292 6.98048 0.167
NP_441025.1_5 Forward -182 -168 14.5526 0.258
NP_441327.1_5 Forward -196 -187 14.356 0.192
NP_442111.1_3 Forward -207 -194 15.436 0.197
NP_442111.1_4 Reverse -280 -294 8.25939 0.0773
NP_441163.1_1 Forward -89 -72 8.39624 0.232
NP_440906.1_5 Forward -289 -282 6.23397 0.234
NP_440906.1_5 Reverse -282 -289 6.13563 0.241
NP_441486.1_1 Reverse -278 -292 6.58777 0.0344
NP_441486.1_1 Reverse -227 -241 -5.90027 0.266
NP_442634.1_2 Forward -242 -223 4.42435 0.27
NP_442634.1_2 Forward -153 -134 2.85105 0.285
NP_442760.1_8 Reverse -272 -291 14.6508 0.274
NP_440842.1_10 Forward -85 -71 2.94952 0.269
NP_441695.1_6 Reverse -239 -258 13.4708 0.293
NP_441012.1_4 Forward -310 -297 9.45906 0.272
NP_441012.1_4 Forward -16 -3 8.37742 0.272
NP_443018.1_3 Reverse -282 -289 11.7405 0.0655
NP_443018.1_3 Forward -289 -282 5.44732 0.193
NP_443018.1_3 Reverse -175 -182 4.36568 0.254
NP_443018.1_3 Forward -182 -175 4.07068 0.299
NP_441634.1_8 Forward -188 -174 -1.18038 0.282
NP_441634.1_8 Reverse -372 -386 -4.62196 0.295
NP_440376.1_1 Forward -290 -281 5.99792 0.111
NP_440376.1_1 Reverse -281 -290 -0.196935 0.285
NP_441588.1_4 Forward -237 -227 7.45319 0.178
NP_442687.1_1 Reverse -85 -98 10.8351 0.291
NP_442687.1_7 Forward -184 -174 8.23984 0.11
NP_442687.1_7 Forward -291 -281 4.50326 0.245
NP_442687.1_7 Reverse -344 -354 4.40493 0.249
NP_442485.1_3 Forward -23 -4 -4.91709 0.286
NP_441846.1_10 Reverse -12 -31 -20.8467 0.256
NP_441846.1_10 Reverse -7 -26 -21.0434 0.256
NP_441846.1_10 Reverse -18 -37 -21.7317 0.256
NP_440642.1_10 Forward -167 -153 1.67063 0.29
NP_441950.1_8 Forward -187 -173 6.98109 0.21
NP_442296.1_5 Forward -181 -162 4.81767 0.251
NP_440360.1_10 Forward -261 -247 3.14618 0.245
NP_442658.1_1 Reverse -343 -353 6.46942 0.229
NP_442658.1_1 Forward -292 -282 6.17443 0.235
NP_442658.1_1 Forward -83 -73 5.48612 0.265
NP_442658.1_1 Reverse -172 -182 4.89613 0.292
NP_440141.1_8 Forward -299 -280 4.81767 0.28
NP_442782.1_7 Reverse -147 -166 0.884433 0.207
NP_441414.1_6 Reverse -54 -73 -0.4922 0.227
NP_441414.1_9 Forward -183 -164 -3.14714 0.13
NP_441414.1_9 Forward -290 -271 -10.227 0.279
NP_441487.1_6 Forward -180 -161 3.93269 0.254
NP_439919.1_5 Reverse -12 -26 17.5025 0.293
NP_442937.1_5 Reverse -10 -29 6.58763 0.275
NP_441958.1_5 Forward -291 -281 0.865012 0.12
NP_440651.1_1 Forward -191 -172 5.01433 0.294
NP_441127.1_1 Reverse -174 -188 11.3077 0.23
NP_440203.1_5 Forward -79 -69 9.81266 0.245
NP_442364.1_2 Forward -122 -103 8.75091 0.279
NP_439990.1_5 Reverse -67 -80 13.294 0.1
NP_439990.1_6 Reverse -174 -193 9.24257 0.197
NP_442690.1_9 Reverse -237 -255 16.0508 0.217
NP_441580.1_6 Forward -301 -282 -1.86883 0.207
NP_440153.1_5 Forward -289 -275 2.45787 0.223
NP_440153.1_5 Reverse -282 -296 0.589577 0.297
NP_440153.1_8 Forward -312 -299 -2.83231 0.266
NP_443055.1_6 Reverse -366 -384 8.76983 0.141
NP_443055.1_6 Reverse -121 -139 -2.73484 0.299
NP_440827.1_3 Forward -301 -282 15.1424 0.183
NP_440827.1_3 Reverse -288 -307 11.9958 0.262
NP_440602.1_8 Forward -290 -276 13.9626 0.164
NP_441913.1_3 Forward -89 -76 14.1946 0.281
NP_442002.1_9 Reverse -162 -169 11.3472 0.185
NP_442002.1_9 Forward -291 -284 10.7572 0.185
NP_442002.1_9 Reverse -365 -372 9.08556 0.289
NP_440809.1_9 Reverse -197 -215 -8.04399 0.225
NP_441000.1_6 Forward -291 -277 3.24451 0.116
NP_441000.1_6 Reverse -280 -294 -5.60527 0.285
NP_440147.1_4 Reverse -364 -377 5.62415 0.119
NP_440147.1_4 Forward -356 -343 1.19926 0.235
NP_441550.1_8 Forward -292 -282 4.7978 0.283
NP_441041.1_6 Reverse -366 -385 21.0423 0.092
NP_440569.1_6 Reverse -159 -178 5.30933 0.228
NP_443063.1_7 Forward -393 -377 6.05672 0.288
NP_441725.1_5 Reverse -282 -292 1.455 0.135
NP_441725.1_5 Forward -289 -279 0.275027 0.192
NP_441725.1_8 Reverse -377 -396 8.25926 0.275
NP_439966.1_7 Reverse -279 -289 14.9258 0.0177
NP_439966.1_7 Forward -292 -282 8.73102 0.13
NP_439966.1_7 Forward -185 -175 5.09279 0.243
NP_439966.1_7 Forward -346 -336 4.60114 0.265
NP_439966.1_9 Forward -292 -283 0.983037 0.253
NP_440736.1_3 Forward -292 -273 5.99764 0.223
NP_442941.1_3 Reverse -282 -292 1.65166 0.147
NP_442941.1_5 Forward -277 -263 14.334 0.293
NP_440289.1_2 Reverse -152 -165 -0.570702 0.202
NP_440289.1_2 Reverse -278 -291 -4.20895 0.283
NP_440983.1_5 Reverse -288 -307 -7.67036 0.291
NP_440260.1_8 Forward -40 -22 -7.25734 0.295
NP_442281.1_1 Reverse -276 -290 10.717 0.055
NP_442281.1_1 Reverse -361 -375 5.50552 0.155
NP_442575.1_8 Reverse -10 -29 -1.57384 0.232
NP_001035871.2_2 Forward -206 -187 19.9503 0.154
NP_440498.1_1 Reverse -272 -290 4.24738 0.13
NP_440453.1_5 Reverse -102 -120 5.62401 0.276
NP_441644.1_6 Forward -383 -373 6.66608 0.152
NP_442029.1_1 Reverse -7 -26 -19.9617 0.297
NP_440929.1_8 Reverse -281 -290 14.651 0.0105
NP_440929.1_8 Forward -290 -281 7.66954 0.0624
NP_442554.1_8 Forward -289 -279 8.1415 0.0785
NP_442554.1_8 Reverse -282 -292 4.0116 0.2
NP_441762.1_7 Reverse -173 -185 6.23383 0.0203
NP_441762.1_7 Forward -291 -279 -5.07423 0.187
NP_441762.1_7 Reverse -280 -292 -5.27089 0.195
NP_442142.1_4 Reverse -278 -291 2.87033 0.273
NP_442292.1_1 Reverse -282 -291 -0.196935 0.239
NP_442292.1_1 Forward -289 -280 -0.68859 0.268
NP_440919.1_7 Reverse -186 -204 5.16171 0.286
NP_441899.1_1 Forward -212 -194 11.9172 0.271
NP_440895.1_6 Reverse -3 -16 8.18076 0.291
NP_443009.1_5 Forward -193 -182 3.40144 0.296
NP_442406.1_9 Reverse -366 -385 2.26107 0.271
NP_442301.1_2 Forward -313 -294 5.01354 0.269
NP_441715.1_4 Reverse -282 -292 6.46988 0.143
NP_441448.1_2 Forward -265 -246 0.883656 0.216
NP_441468.1_1 Forward -289 -282 6.13563 0.209
NP_441468.1_1 Reverse -282 -289 6.0373 0.223
NP_441468.1_1 Reverse -175 -182 4.46401 0.224
NP_439939.1_4 Forward -175 -156 0.294447 0.218
NP_441020.2_6 Reverse -172 -189 10.9536 0.131
NP_441015.1_10 Reverse -10 -29 -0.885524 0.169
NP_441015.1_10 Reverse -4 -23 -1.96717 0.176
NP_441673.1_1 Forward -290 -281 1.37636 0.114
NP_441673.1_1 Reverse -281 -290 1.1797 0.163
NP_441339.1_4 Reverse -217 -236 -2.45882 0.227
NP_441320.1_4 Reverse -176 -195 16.5191 0.289
NP_441876.1_9 Forward -387 -377 10.9926 0.28
NP_441876.1_9 Reverse -250 -260 10.796 0.287
NP_441826.1_2 Forward -296 -282 2.94952 0.117
NP_441826.1_2 Reverse -149 -163 -3.54032 0.286
NP_441330.1_1 Forward -359 -340 -14.5535 0.229
NP_442719.1_2 Forward -282 -264 -10.9946 0.286
NP_442227.1_2 Forward -25 -6 13.4708 0.143
NP_442227.1_2 Forward -22 -3 -2.26216 0.272
NP_442227.1_2 Forward -391 -372 -2.55715 0.276
NP_443058.1_1 Forward -35 -16 12.0933 0.287
NP_442808.1_1 Reverse -280 -290 10.4026 0.0481
NP_440031.1_10 Forward -115 -96 0.982764 0.274
NP_442692.1_10 Reverse -186 -199 19.314 0.155
NP_440038.1_4 Forward -29 -10 -0.295539 0.282
NP_441114.1_3 Forward -80 -71 8.35786 0.231
NP_441114.1_3 Reverse -225 -234 7.66954 0.231
NP_440558.1_2 Reverse -69 -88 -2.26216 0.225
NP_440558.1_2 Forward -306 -287 -2.65548 0.229
NP_440558.1_2 Forward -396 -377 -7.08038 0.287
NP_440558.1_2 Reverse -220 -239 -7.27704 0.291
NP_442789.1_4 Reverse -22 -41 1.27776 0.185
NP_441518.1_3 Reverse -271 -290 -7.17871 0.152
NP_441036.1_8 Reverse -280 -290 7.45319 0.197
NP_441036.1_8 Forward -291 -281 6.8632 0.213
NP_441557.1_5 Reverse -281 -290 7.57121 0.049
NP_441557.1_5 Forward -290 -281 1.08137 0.0794
NP_441445.1_5 Forward -28 -9 14.7483 0.265
NP_441590.1_2 Reverse -4 -17 20.5705 0.143
NP_441308.1_8 Forward -292 -282 8.4365 0.254
NP_441458.1_10 Forward -299 -280 3.04771 0.256
NP_442183.1_1 Forward -290 -276 16.3225 0.0151
NP_442183.1_9 Forward -113 -103 9.41981 0.296
NP_442347.1_2 Reverse -282 -291 8.94785 0.0718
NP_441633.1_3 Reverse -279 -292 -4.50394 0.199
NP_441633.1_3 Reverse -364 -377 -7.25721 0.3
NP_440136.1_2 Forward -289 -282 6.23397 0.171
NP_440136.1_2 Reverse -282 -289 6.13563 0.193
NP_442590.1_10 Reverse -6 -25 6.4893 0.244
NP_442998.1_5 Forward -195 -185 14.7297 0.149
NP_442998.1_5 Forward -207 -197 11.7798 0.176
NP_442998.1_10 Reverse -283 -290 15.5754 0.0102
NP_442998.1_10 Forward -373 -366 9.28223 0.117
NP_440899.1_1 Reverse -288 -307 7.43152 0.257
NP_440899.1_8 Reverse -186 -205 -8.55534 0.257
NP_440899.1_8 Forward -281 -262 -8.94866 0.258
NP_440299.1_1 Forward -294 -281 2.47701 0.288
NP_440256.1_1 Reverse -278 -297 -2.45882 0.118
NP_440256.1_1 Forward -315 -296 -7.4737 0.238
NP_442007.1_8 Forward -264 -246 10.8348 0.258
NP_441559.1_8 Reverse -340 -354 -0.590395 0.178
NP_442158.1_4 Forward -119 -109 14.238 0.193
NP_440717.1_3 Forward -30 -16 14.1586 0.221
NP_442785.1_7 Forward -234 -220 8.75105 0.291
NP_440134.1_2 Reverse -153 -172 -0.39387 0.298
NP_442452.1_2 Forward -24 -5 10.4217 0.212
NP_441464.1_8 Reverse -366 -380 7.76774 0.206
NP_441113.1_3 Reverse -112 -126 14.9452 0.27
NP_440695.1_6 Reverse -183 -197 12.3505 0.26
NP_442993.1_1 Forward -290 -274 11.8583 0.0141
NP_442993.1_1 Reverse -135 -151 -8.10294 0.153
NP_442386.1_9 Reverse -280 -289 10.619 0.121
NP_442386.1_9 Forward -184 -175 6.9808 0.219
NP_442386.1_9 Forward -291 -282 5.9975 0.23
NP_442386.1_9 Reverse -173 -182 5.21086 0.262
NP_440570.1_5 Reverse -62 -81 3.6377 0.234
NP_441750.1_1 Reverse -3 -22 -13.1769 0.3
NP_441750.1_7 Reverse -12 -22 14.828 0.254
NP_441340.1_5 Forward -289 -282 13.5105 0.0314
NP_441340.1_5 Reverse -282 -289 5.84064 0.208
NP_441340.1_5 Forward -182 -175 3.97235 0.274
NP_442484.1_2 Forward -301 -282 1.37609 0.236
NP_441160.1_5 Reverse -163 -182 -4.52377 0.288
NP_440586.1_8 Reverse -282 -289 9.47853 0.146
NP_440586.1_8 Forward -289 -282 5.74197 0.283
NP_442959.1_7 Forward -385 -366 -5.40875 0.299
NP_440684.1_9 Reverse -275 -289 7.76774 0.253
NP_441262.1_3 Forward -290 -283 14.7888 0.0223
NP_440027.1_3 Forward -354 -336 5.72158 0.237
NP_443051.1_1 Forward -291 -282 7.47288 0.0571
NP_439937.1_9 Reverse -71 -88 -10.3849 0.227
NP_442294.1_3 Reverse -181 -195 13.4703 0.269
NP_442294.1_3 Forward -286 -272 12.487 0.283
NP_440408.1_3 Forward -386 -367 -5.01543 0.276
NP_440439.1_1 Forward -293 -280 -2.144 0.298
NP_440372.1_2 Forward -289 -282 13.8055 0.0214
NP_440372.1_2 Reverse -282 -289 6.52896 0.188
NP_441138.1_5 Reverse -188 -201 2.83104 0.297
NP_441789.1_7 Reverse -236 -255 -1.08295 0.251
NP_440819.1_5 Reverse -272 -280 7.8859 0.266
NP_440819.1_5 Reverse -113 -121 7.68924 0.266
NP_441803.1_2 Forward -191 -172 -1.18052 0.294
NP_440267.1_2 Forward -359 -345 19.1735 0.0217
NP_442384.1_10 Reverse -281 -294 3.95252 0.172
NP_440948.1_10 Forward -156 -137 15.1424 0.223
NP_442790.1_4 Forward -299 -280 -14.1602 0.272
NP_442262.1_10 Reverse -282 -289 13.2155 0.0213
NP_442262.1_10 Forward -374 -367 7.90559 0.266
NP_441689.1_5 Forward -292 -282 5.97777 0.197
NP_441689.1_5 Reverse -119 -129 4.99446 0.285
NP_440163.1_10 Forward -293 -283 14.238 0.102
NP_442910.1_1 Forward -158 -139 -8.55534 0.299
NP_441965.1_10 Forward -186 -170 2.41848 0.288
NP_440297.1_9 Forward -289 -279 -0.118297 0.282
NP_440297.1_9 Reverse -282 -292 -0.511621 0.289
NP_442280.1_10 Reverse -220 -238 7.11023 0.268
NP_441896.1_3 Reverse -336 -355 -1.67217 0.267
NP_440894.1_10 Forward -320 -301 3.83436 0.263
NP_443036.1_3 Reverse -68 -85 17.8367 0.159
NP_443036.1_3 Forward -219 -202 12.4285 0.299
NP_440999.1_2 Forward -204 -185 15.2408 0.155
NP_440999.1_9 Reverse -341 -355 -0.688726 0.214
NP_440999.1_9 Forward -37 -23 -1.96703 0.254
NP_440999.1_9 Reverse -173 -187 -3.63866 0.299
NP_440888.1_2 Reverse -281 -295 9.14375 0.137
NP_440888.1_2 Forward -354 -340 5.21053 0.288
NP_442892.1_9 Reverse -189 -203 11.602 0.296
NP_442225.1_10 Reverse -220 -239 10.4217 0.206
NP_439969.1_3 Reverse -340 -359 -1.08219 0.271
NP_442033.1_10 Forward -356 -337 -8.45701 0.199
NP_442033.1_10 Forward -302 -283 -13.1769 0.283
NP_441543.1_2 Reverse -282 -291 8.65285 0.0968
NP_442336.1_6 Forward -107 -88 19.469 0.269
NP_441469.1_8 Reverse -280 -289 6.68623 0.227
NP_441469.1_8 Forward -291 -282 6.39124 0.227
NP_441469.1_8 Reverse -173 -182 5.11294 0.289
NP_442578.1_7 Forward -289 -282 6.0373 0.18
NP_440071.1_6 Reverse -12 -26 13.611 0.261
NP_441462.1_2 Forward -290 -280 0.963343 0.109
NP_441621.1_3 Reverse -146 -164 17.9154 0.148
NP_441621.1_7 Forward -185 -171 -4.52363 0.232
NP_443062.1_1 Reverse -281 -299 10.3986 0.117
NP_443062.1_1 Forward -290 -272 7.96088 0.163
NP_441601.1_2 Forward -374 -355 0.294447 0.219
NP_441601.1_4 Forward -307 -288 -1.96717 0.293
NP_440519.1_8 Reverse -294 -310 5.27008 0.21
NP_442204.1_1 Forward -294 -283 0.255333 0.282
NP_442204.1_6 Reverse -3 -22 4.916 0.286
NP_441560.1_3 Reverse -375 -393 10.4422 0.271
NP_442487.1_5 Forward -250 -231 7.86512 0.198
NP_440516.1_6 Forward -392 -378 12.192 0.196
NP_440516.1_8 Forward -290 -281 9.53783 0.0136
NP_440516.1_8 Reverse -281 -290 5.01461 0.118
NP_440516.1_8 Reverse -155 -164 -0.491928 0.262
NP_442428.1_5 Forward -289 -282 6.13563 0.209
NP_442428.1_5 Reverse -282 -289 6.0373 0.212
NP_442428.1_5 Reverse -175 -182 4.759 0.223
NP_442120.1_10 Reverse -177 -196 -15.0452 0.289
NP_440673.1_3 Reverse -283 -290 12.4288 0.0426
NP_440673.1_7 Forward -141 -122 4.71934 0.185
NP_440592.1_1 Reverse -67 -86 6.78429 0.186
NP_440436.1_4 Reverse -282 -291 8.55409 0.0997
NP_440436.1_4 Forward -182 -173 4.42421 0.265
NP_441893.1_10 Forward -212 -193 11.1109 0.24
NP_441719.1_4 Forward -289 -282 6.82395 0.0855
NP_441719.1_4 Reverse -282 -289 6.52896 0.188
NP_441004.1_1 Reverse -288 -307 1.67108 0.111
NP_442366.1_3 Forward -291 -273 4.05072 0.101
NP_442366.1_3 Reverse -280 -298 -2.24246 0.224
NP_442366.1_5 Reverse -227 -237 11.9759 0.148
NP_442873.1_5 Forward -25 -6 16.4199 0.149
NP_443054.1_2 Reverse -272 -286 0.0979218 0.278
NP_441851.1_10 Forward -291 -281 6.17489 0.182
NP_441851.1_10 Reverse -280 -290 4.60159 0.259
NP_441542.1_4 Forward -87 -73 4.91614 0.264
NP_441668.1_4 Reverse -139 -158 0.294447 0.244
NP_440593.1_3 Forward -307 -288 -7.08038 0.285
NP_441982.1_6 Reverse -80 -89 11.1485 0.288
NP_441046.1_2 Reverse -163 -182 -2.16383 0.295
NP_440432.1_9 Forward -165 -150 -5.62497 0.26
NP_440474.1_8 Forward -289 -275 10.3237 0.14
NP_440195.1_4 Forward -302 -283 21.9273 0.0182
NP_442006.1_2 Reverse -294 -311 -15.4975 0.227
NP_442038.1_1 Forward -335 -316 0.687771 0.278
NP_440078.1_10 Reverse -12 -31 3.04771 0.269
NP_441078.1_4 Forward -290 -281 0.196389 0.205
NP_441078.1_4 Reverse -281 -290 -0.000272808 0.205
NP_442729.1_8 Forward -294 -281 4.8375 0.278
NP_441663.1_7 Forward -293 -274 3.53937 0.295
NP_442348.1_2 Reverse -162 -171 6.5879 0.299
NP_440707.1_9 Reverse -13 -32 5.70265 0.235
NP_441432.1_8 Forward -291 -282 5.50626 0.151
NP_442320.1_8 Forward -296 -282 3.8345 0.0578
NP_442320.1_8 Reverse -275 -289 -5.70361 0.245
NP_442344.1_7 Forward -289 -270 -7.08038 0.177
NP_440199.1_10 Reverse -152 -162 6.56821 0.296
NP_442298.1_10 Reverse -73 -92 14.2574 0.219
NP_442353.1_4 Forward -266 -247 7.96345 0.164
NP_440280.1_2 Forward -386 -367 18.289 0.0879
NP_442400.1_10 Reverse -265 -278 9.51548 0.271
NP_442489.1_7 Forward -290 -281 0.688044 0.152
NP_442489.1_7 Reverse -281 -290 0.688044 0.152
NP_440559.1_1 Forward -289 -280 5.11294 0.151
NP_442749.1_5 Reverse -155 -172 11.3087 0.183
NP_442913.1_10 Reverse -326 -345 -5.21209 0.26
NP_439956.1_7 Reverse -297 -316 1.57275 0.287
NP_440545.1_3 Reverse -290 -307 -0.747806 0.157
NP_440545.1_3 Forward -397 -380 -3.10775 0.199
NP_441629.1_3 Reverse -224 -243 -4.72118 0.297
NP_442551.1_4 Reverse -70 -85 0.668214 0.245
NP_442551.1_4 Forward -84 -69 -0.118434 0.245
NP_440847.1_3 Forward -25 -11 11.307 0.269
NP_441833.1_4 Reverse -282 -289 6.52896 0.0924
NP_441833.1_4 Forward -289 -282 6.23397 0.163
NP_442699.1_8 Reverse -307 -326 -3.83545 0.238
NP_442162.1_9 Forward -289 -282 12.9205 0.0282
NP_442162.1_9 Reverse -282 -289 12.9205 0.0282
NP_440788.1_8 Reverse -374 -393 9.14423 0.286
NP_440671.1_4 Reverse -275 -289 13.3726 0.0834
NP_440671.1_4 Forward -296 -282 9.83269 0.17
NP_440671.1_4 Reverse -149 -163 5.80112 0.271
NP_442821.1_2 Reverse -91 -110 8.06259 0.177
NP_442140.1_3 Reverse -175 -185 8.82982 0.119
NP_442140.1_3 Reverse -282 -292 6.27322 0.176
NP_442723.1_1 Forward -155 -136 7.17681 0.276
NP_441813.1_5 Reverse -279 -289 13.2547 0.0178
NP_441813.1_5 Forward -292 -282 7.45319 0.0746
NP_440590.1_4 Reverse -336 -349 9.45906 0.0359
NP_440590.1_4 Reverse -282 -295 1.88757 0.108
NP_440590.1_4 Reverse -294 -307 0.412608 0.157
NP_440590.1_4 Forward -238 -225 -1.45568 0.22
NP_440590.1_4 Forward -353 -340 -5.38892 0.277
NP_442497.1_10 Reverse -282 -291 0.589713 0.153
NP_442497.1_10 Forward -289 -280 -1.18024 0.256
NP_440821.1_4 Forward -292 -282 9.32148 0.03
NP_440821.1_4 Reverse -279 -289 8.63316 0.0454
NP_441239.1_9 Reverse -279 -291 14.592 0.0271
NP_441239.1_9 Forward -185 -173 5.25052 0.223
NP_440400.1_1 Forward -181 -162 6.88182 0.22
NP_440400.1_1 Reverse -214 -233 -2.36125 0.285
NP_441892.1_4 Forward -313 -294 -1.86883 0.292
NP_442193.1_1 Reverse -162 -180 9.26226 0.249
NP_442643.1_8 Forward -346 -328 13.3914 0.216
NP_440354.1_7 Forward -296 -278 9.75391 0.224
NP_441617.1_1 Forward -227 -208 30.4821 0.000173
NP_441617.1_3 Forward -176 -157 28.6138 0.00134
NP_441617.1_5 Forward -325 -306 21.828 0.0725
NP_441617.1_6 Forward -282 -263 23.5989 0.0114
NP_441617.1_8 Forward -205 -186 22.0247 0.0707
NP_441617.1_8 Reverse -316 -335 10.0284 0.289
NP_442138.1_10 Forward -290 -271 -3.04881 0.225
NP_442138.1_10 Reverse -177 -196 -3.63879 0.242
NP_440462.1_6 Forward -292 -282 5.87989 0.135
NP_440462.1_6 Reverse -279 -289 3.81494 0.228
NP_440868.1_4 Forward -294 -282 -0.944332 0.284
NP_441582.1_5 Reverse -181 -200 5.99684 0.202
NP_442402.1_1 Reverse -200 -219 7.47261 0.293
NP_442402.1_4 Reverse -189 -208 4.03023 0.147
NP_441084.1_6 Forward -356 -342 10.5076 0.238
NP_442460.1_7 Forward -302 -283 0.58944 0.266
NP_440696.1_3 Forward -243 -225 -3.6191 0.287
NP_442039.1_4 Forward -289 -282 11.6422 0.0747
NP_442039.1_7 Forward -155 -145 15.8113 0.211
NP_442039.1_7 Reverse -176 -186 7.15819 0.279
NP_441926.1_3 Forward -290 -274 4.77842 0.179
NP_442837.1_3 Forward -289 -282 6.0373 0.25
NP_442837.1_3 Reverse -282 -289 6.0373 0.25
NP_442053.1_1 Reverse -281 -290 7.07956 0.105
NP_440505.1_3 Forward -292 -282 12.2714 0.0543
NP_441252.1_6 Forward -208 -201 11.6422 0.288
NP_441203.1_1 Reverse -282 -301 -14.8485 0.205
NP_442532.1_7 Reverse -174 -188 2.16287 0.252
NP_440914.1_1 Forward -81 -71 9.7862 0.172
NP_441011.1_8 Reverse -282 -291 7.07956 0.179
NP_441011.1_8 Forward -289 -280 5.70292 0.237
NP_442533.1_1 Reverse -9 -28 -11.8986 0.236
NP_442533.1_6 Reverse -281 -290 4.42462 0.179
NP_441482.1_7 Forward -296 -282 -1.47537 0.0721
NP_439944.1_10 Forward -255 -236 16.3224 0.208
NP_441028.1_6 Forward -388 -378 13.5492 0.158
NP_441028.1_6 Reverse -188 -198 5.48612 0.255
NP_440116.1_8 Reverse -282 -301 -1.7705 0.122
NP_441527.1_4 Reverse -115 -134 -0.334645 0.146
NP_441527.1_4 Reverse -108 -127 -11.4117 0.282
NP_439965.1_1 Forward -299 -280 -3.24547 0.182
NP_441972.1_5 Reverse -207 -226 -3.73712 0.201
NP_441972.1_5 Reverse -367 -386 -10.227 0.3
NP_441106.1_1 Forward -291 -282 8.45619 0.0548
NP_441106.1_1 Reverse -173 -182 4.71961 0.21
NP_440429.1_4 Reverse -15 -34 10.6192 0.299
NP_441869.1_9 Forward -371 -352 13.9625 0.249
NP_442588.1_6 Forward -386 -367 -3.24547 0.296
NP_441286.1_1 Reverse -280 -292 -6.15587 0.251
NP_440670.1_8 Forward -290 -281 16.0277 0.00443
NP_440670.1_8 Reverse -281 -290 12.5861 0.0253
NP_440670.1_8 Reverse -335 -344 3.24465 0.29
NP_440886.1_7 Reverse -280 -290 7.64939 0.0865
NP_440886.1_7 Forward -184 -174 7.15773 0.103
NP_440886.1_7 Forward -22 -12 5.78111 0.163
NP_440886.1_7 Forward -25 -15 4.7978 0.218
NP_440886.1_7 Forward -165 -155 4.30615 0.243
NP_440886.1_7 Forward -19 -9 3.32285 0.287
NP_440828.1_4 Forward -319 -300 -0.787962 0.19
NP_440828.1_4 Forward -355 -336 -7.86776 0.294
NP_442614.1_2 Reverse -22 -36 5.70279 0.298
NP_442382.1_9 Forward -307 -288 8.65176 0.281
NP_441753.1_10 Forward -230 -211 0.58944 0.289
NP_440907.2_8 Reverse -282 -292 6.0761 0.179
NP_440907.2_8 Forward -30 -20 5.38779 0.203
NP_441626.1_2 Forward -289 -282 12.2322 0.0511
NP_441626.1_2 Reverse -282 -289 5.93897 0.231
NP_442221.1_4 Reverse -167 -186 8.75091 0.296
NP_442362.1_7 Reverse -380 -398 13.9821 0.22
NP_441962.1_4 Reverse -289 -308 -12.0953 0.252
NP_441962.1_4 Reverse -19 -38 -14.2585 0.285
NP_440855.1_1 Reverse -291 -310 0.687771 0.229
NP_441431.1_2 Forward -186 -172 8.65209 0.209
NP_441836.1_2 Reverse -168 -187 -6.1954 0.292
NP_441174.1_4 Reverse -134 -144 11.2881 0.288
NP_440114.1_10 Forward -290 -276 13.8643 0.0481
NP_440114.1_10 Forward -130 -116 6.88276 0.253
NP_442090.1_10 Reverse -375 -388 10.639 0.281
NP_442698.1_10 Reverse -15 -34 6.98095 0.233
NP_441510.2_7 Reverse -101 -115 11.012 0.28
NP_440766.1_4 Reverse -151 -165 8.06273 0.0871
NP_440766.1_4 Forward -294 -280 5.30946 0.112
NP_440766.1_4 Reverse -277 -291 0.687908 0.271
NP_439988.1_3 Reverse -219 -233 3.53951 0.298
NP_441979.1_5 Forward -296 -277 -12.1936 0.228
NP_439910.1_2 Reverse -273 -290 -21.4956 0.183
NP_439910.1_2 Reverse -166 -183 -22.479 0.25
NP_440457.1_1 Forward -294 -282 9.28209 0.0929
NP_440457.1_1 Reverse -13 -25 2.59558 0.207
NP_442940.1_2 Forward -392 -373 -0.197208 0.296
NP_442680.1_5 Forward -207 -188 -1.00237 0.297
NP_440801.1_8 Forward -384 -365 2.85105 0.229
NP_440942.1_6 Reverse -222 -241 10.9134 0.257
NP_441332.1_6 Reverse -253 -263 12.5181 0.223
NP_441436.1_2 Reverse -9 -28 -6.88371 0.296
NP_440473.1_9 Reverse -270 -289 -9.93197 0.267
NP_442509.1_9 Forward -290 -280 9.71433 0.192
NP_442509.1_9 Reverse -281 -291 9.41933 0.192
NP_442509.1_9 Reverse -335 -345 7.74772 0.205
NP_440554.1_4 Reverse -282 -292 11.6814 0.0377
NP_440554.1_4 Forward -289 -279 6.17489 0.126
NP_442862.1_3 Reverse -186 -203 16.3618 0.137
NP_441885.1_5 Forward -290 -280 0.0783647 0.183
NP_440478.1_10 Reverse -301 -315 8.65272 0.257
NP_442341.1_7 Reverse -280 -294 9.2427 0.0751
NP_442341.1_7 Forward -165 -151 1.57289 0.286
NP_441842.1_10 Forward -297 -283 8.16106 0.233
NP_440275.1_3 Forward -292 -282 5.87989 0.13
NP_440091.1_1 Reverse -277 -289 8.59377 0.0631
NP_442451.1_2 Reverse -175 -194 0.196116 0.153
NP_441122.1_1 Reverse -219 -234 4.79811 0.28
NP_439962.1_4 Forward -26 -7 -7.86702 0.291
NP_439962.1_4 Forward -25 -6 -8.94866 0.298
NP_442495.1_4 Reverse -244 -254 11.5831 0.271
NP_440149.1_8 Forward -192 -173 -6.58872 0.255
NP_442373.1_2 Reverse -291 -310 -8.55534 0.249
NP_440216.1_1 Reverse -281 -295 -4.81863 0.115
NP_440216.1_1 Forward -151 -137 -11.3085 0.178
NP_440216.1_9 Reverse -109 -118 11.7011 0.254
NP_440172.1_1 Reverse -345 -355 4.0116 0.208
NP_442371.1_1 Forward -197 -187 13.9425 0.191
NP_442015.1_10 Reverse -277 -290 0.60927 0.221
NP_442015.1_10 Forward -25 -12 -0.865694 0.285
NP_441226.1_7 Forward -289 -282 12.7234 0.0312
NP_441226.1_7 Reverse -282 -289 11.5435 0.0757
NP_441226.1_7 Reverse -255 -262 6.82361 0.246
NP_441226.1_7 Reverse -108 -115 6.52862 0.253
NP_441111.1_7 Reverse -282 -290 8.86921 0.0589
NP_440244.1_1 Reverse -381 -400 -8.94866 0.287
NP_440244.1_1 Reverse -14 -33 -9.63698 0.287
NP_441766.1_2 Reverse -281 -290 12.6844 0.0158
NP_442417.1_5 Reverse -281 -295 11.0127 0.106
NP_440416.1_1 Forward -290 -271 -10.817 0.272
NP_440416.1_9 Forward -28 -9 -15.3402 0.189
NP_440416.1_9 Forward -297 -278 -17.7001 0.245
NP_440416.1_9 Forward -38 -19 -18.7818 0.264
NP_440416.1_9 Reverse -223 -242 -19.8634 0.279
NP_443052.1_8 Reverse -271 -290 -10.4236 0.208
NP_443052.1_9 Forward -28 -9 2.85105 0.167
NP_443052.1_9 Forward -307 -288 -1.47551 0.228
NP_443052.1_9 Forward -25 -6 -5.70374 0.273
NP_442403.1_1 Reverse -69 -88 16.8132 0.145
NP_442154.1_1 Reverse -10 -28 -13.4522 0.217
NP_442154.1_1 Reverse -1 -19 -16.0088 0.229
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCCCTGTGTCACTGCCCCCCATGGTCAGATTGCCGATTTACAACAAGCCATTACCGCCGATCCTAATTTGGCAGTGAATTTAGACCTAACCACCGCTGCCGTTACCTACGGCGATCGGAGTTTTCCCGTAATTCTCTCCGACGGGGCCCAGCAAATGTTGCTGGATGGCCAATGGGACACCTGTGGTCAACTGGTGCAAAATCAGGGGAAAATTGCCGCCACCGCTGAAAAATTGCCCTATCTCCATTGGCAAACTTCCGCCGCCTAGAACCTATTGCTTTTTTCCGTTGGGTGTGTTGGTAAGTCAGCTTTTTTGGGCACAATGCCCACAGAGTTGGTTTATGTCTGGTCGTCAGAACACACCGCTTTGCTCTCCCCTCCCACCACCGTCAGGACACA

CDS

ATGGAAACTGAGCAACTTCTTTGGCAATATGGCCAGGGCACTAGGGATTTCAGCCGCATTGAACTACATCATGCCGATTTAATCCAGTCCGATCTAGTGGGCATTATCCTCAACCGGGCCCTGCTCGCATATGGCAACTTCAGCGGCAGTAATTTATCTGAAGCCCAGCTACGGCGTACTAACCTAAGCCATGCCCGTTTGATGGGAGTGAAATTTGTCGGGTCAGACCTGACTGGCATAGATTTAAGCTATTCAGATCTCAGTTGGGCGGACCTAACCGATTGTGACCTCAGTGGAGCCAATTTGGCCTATGCCAAGCTCAAGCAAGCCCGGTTAATACGGACAAATTTAGAAGGGGCTAACTTGGCGGAAACCGATTGCCAGGGAGCAATCCTAGAAGCAGTTAATTTCAGTCGAGCGGATTTGAGTGGGGCCGATCTCACACGAGTTGATCTGGCAGAGGCTAATTTCAGTCGGGCAGATTTGAGTGGGGCCGATTTTCGCAAAGCCAACTTTGACCATGCCAATTTGTATAAGGTGAATCTAAGTCAAGCCCAATTACGTCATGGCACAGTGGAGGAGGCTTTTCTGCAGGGAGCAGACCTCAGTCAAGCTAATTTGAAAGGAGCGAATTTAGGCAGGGCATTGATGAAGGAAGTTAACCTCAGTTTGATTAATCTATCGGAAATTCATCTTAAAGCTCTCCCCAACAAGGAGCAGATTAACTGTGCCGGTTGCGCCCTGCGGGGCACTATTTTCCAGGGAGCTAATTTCCAGAATGCTAATTTTGAGTATGCTTTGATGGAAAAAGCTTTATTGGCCGGGGCCATACTCCGGGGCGCCAATTTAATCGATGCCTGTTTACGGGGGGCAGACCTACGTAATGTCAATTTTCAAAATAGTCACATTAGCGGCATAAACTTGGCAAAAACAATTATGCCCGATGGGAGTGTACATCCCTGA

Protein

METEQLLWQYGQGTRDFSRIELHHADLIQSDLVGIILNRALLAYGNFSGSNLSEAQLRRTNLSHARLMGVKFVGSDLTGIDLSYSDLSWADLTDCDLSGANLAYAKLKQARLIRTNLEGANLAETDCQGAILEAVNFSRADLSGADLTRVDLAEANFSRADLSGADFRKANFDHANLYKVNLSQAQLRHGTVEEAFLQGADLSQANLKGANLGRALMKEVNLSLINLSEIHLKALPNKEQINCAGCALRGTIFQGANFQNANFEYALMEKALLAGAILRGANLIDACLRGADLRNVNFQNSHISGINLAKTIMPDGSVHP