Your browser is old and dusty. Try Google Chrome!

Details for sll1444

ORF sll1444
Accession NP_441618.1
Symbol
Category Branched chain family
Definition 3-isopropylmalate dehydratase small subunit
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -279 -265 11.7993 0.0505
NP_440795.1_7 Reverse -260 -267 10.2655 0.154
NP_441418.1_6 Reverse -259 -278 -19.6667 0.093
NP_441343.1_3 Forward -364 -345 14.2574 0.276
NP_441818.1_9 Reverse -88 -107 -3.73712 0.231
NP_441818.1_9 Forward -223 -204 -4.91709 0.246
NP_442287.1_1 Forward -53 -43 13.1559 0.288
NP_443027.1_4 Reverse -146 -156 8.23984 0.215
NP_442975.1_10 Reverse -163 -177 3.63724 0.252
NP_439979.1_9 Reverse -260 -278 10.9339 0.227
NP_441900.1_2 Reverse -352 -370 -6.07808 0.293
NP_441035.1_1 Forward -384 -365 17.404 0.215
NP_441208.1_9 Forward -313 -299 6.48943 0.244
NP_440370.1_10 Reverse -250 -269 10.4225 0.206
NP_442742.1_9 Forward -331 -312 -3.63879 0.221
NP_441925.1_4 Forward -281 -262 -8.35941 0.209
NP_441925.1_4 Reverse -201 -220 -13.3743 0.257
NP_441925.1_4 Forward -201 -182 -17.4058 0.294
NP_441083.1_5 Forward -201 -191 3.12662 0.182
NP_441083.1_5 Reverse -364 -374 2.14332 0.195
NP_442827.1_4 Forward -278 -259 5.70185 0.298
NP_441645.1_7 Forward -269 -255 18.2765 0.237
NP_441624.1_7 Forward -317 -303 6.3911 0.286
NP_441163.1_1 Reverse -294 -311 4.95467 0.282
NP_440343.1_9 Forward -381 -362 9.14423 0.251
NP_440747.1_10 Forward -193 -181 -11.6624 0.131
NP_440747.1_10 Forward -314 -302 -12.4491 0.282
NP_441130.1_10 Forward -195 -181 4.62115 0.275
NP_442848.1_1 Reverse -259 -273 -3.44199 0.267
NP_441012.1_4 Forward -272 -259 7.29578 0.272
NP_443018.1_3 Reverse -260 -267 4.36568 0.254
NP_443018.1_3 Forward -267 -260 4.07068 0.299
NP_441634.1_8 Forward -114 -100 -3.24533 0.295
NP_440376.1_1 Reverse -88 -97 0.196389 0.283
NP_440376.1_1 Reverse -192 -201 0.0980582 0.285
NP_442687.1_7 Forward -269 -259 8.23984 0.11
NP_441797.1_7 Forward -308 -290 9.65558 0.292
NP_441846.1_10 Reverse -181 -200 -23.6983 0.295
NP_440642.1_10 Forward -147 -133 7.47213 0.221
NP_440141.1_8 Reverse -118 -137 5.211 0.277
NP_440141.1_8 Reverse -314 -333 4.22769 0.292
NP_442223.1_9 Forward -229 -211 14.2771 0.179
NP_440607.1_8 Reverse -189 -208 0.294447 0.28
NP_442486.1_6 Forward -280 -261 -1.27885 0.266
NP_442911.1_2 Reverse -116 -135 -7.96535 0.223
NP_440153.1_8 Forward -274 -261 6.60746 0.17
NP_442064.1_4 Forward -161 -142 6.48849 0.25
NP_442536.1_8 Reverse -256 -275 13.1758 0.241
NP_443055.1_3 Forward -106 -87 10.5496 0.288
NP_443055.1_6 Reverse -167 -185 5.42659 0.179
NP_441294.1_7 Forward -284 -270 13.6661 0.0583
NP_441646.1_1 Forward -287 -268 -0.197208 0.259
NP_441646.1_1 Reverse -258 -277 -0.688862 0.271
NP_442438.1_10 Reverse -260 -274 0.687908 0.218
NP_442431.1_10 Reverse -259 -277 3.95239 0.213
NP_442431.1_10 Reverse -145 -163 0.609134 0.269
NP_442771.1_1 Forward -347 -329 0.314141 0.0986
NP_440345.1_3 Reverse -354 -368 11.0887 0.259
NP_441041.1_4 Reverse -259 -278 14.9458 0.0174
NP_441041.1_4 Reverse -148 -167 -13.1769 0.282
NP_441041.1_4 Reverse -88 -107 -13.5702 0.291
NP_442004.1_6 Forward -274 -260 1.96621 0.276
NP_440703.1_5 Reverse -320 -339 20.649 0.096
NP_439966.1_7 Forward -270 -260 6.0761 0.195
NP_440260.1_8 Forward -83 -65 -5.97904 0.282
NP_442012.1_5 Reverse -258 -277 -0.885524 0.288
NP_443030.1_4 Forward -280 -261 -5.11376 0.261
NP_443030.1_6 Reverse -198 -217 14.0608 0.248
NP_442029.1_6 Forward -370 -351 7.57094 0.223
NP_440929.1_3 Reverse -181 -200 8.94757 0.294
NP_442142.1_4 Forward -271 -258 8.86849 0.106
NP_442142.1_4 Forward -160 -147 7.19687 0.144
NP_441525.1_1 Forward -363 -350 11.0324 0.296
NP_440730.1_4 Reverse -126 -145 -3.73712 0.298
NP_440379.1_5 Forward -326 -307 -6.1954 0.231
NP_440379.1_5 Forward -47 -28 -11.1119 0.288
NP_441468.1_1 Reverse -260 -267 4.46401 0.224
NP_441618.1_5 Forward -208 -189 19.174 0.0624
NP_441618.1_8 Forward -382 -363 22.6156 0.022
NP_441618.1_9 Forward -291 -272 17.1476 0.244
NP_441020.2_6 Reverse -257 -274 12.2319 0.0995
NP_441015.1_10 Reverse -260 -279 -1.18052 0.171
NP_441015.1_10 Reverse -179 -198 -2.16383 0.178
NP_441015.1_10 Forward -376 -357 -8.45701 0.273
NP_441673.1_1 Forward -190 -181 -7.86675 0.187
NP_441673.1_1 Reverse -181 -190 -7.96508 0.206
NP_441826.1_2 Reverse -37 -51 -2.45868 0.271
NP_441379.1_2 Forward -183 -164 9.73422 0.263
NP_442868.1_6 Forward -54 -44 1.25834 0.205
NP_441056.1_1 Forward -280 -261 -7.4737 0.272
NP_442227.1_2 Forward -116 -97 -1.67217 0.264
NP_442808.1_1 Forward -323 -313 5.78111 0.141
NP_442808.1_1 Forward -158 -148 2.63453 0.26
NP_442808.1_1 Forward -194 -184 1.15957 0.292
NP_442692.1_1 Forward -134 -115 -5.9004 0.276
NP_442542.1_2 Reverse -149 -162 6.1158 0.234
NP_442113.1_10 Forward -275 -256 -4.42544 0.224
NP_440630.1_5 Forward -354 -335 6.88262 0.274
NP_441114.1_3 Forward -330 -321 7.57121 0.231
NP_441114.1_3 Forward -51 -42 7.57121 0.231
NP_440558.1_2 Forward -56 -37 -4.32711 0.244
NP_440558.1_2 Forward -277 -258 -4.72043 0.248
NP_440558.1_2 Reverse -261 -280 -4.91709 0.249
NP_440558.1_2 Forward -335 -316 -5.01543 0.251
NP_440558.1_2 Reverse -190 -209 -7.08038 0.287
NP_441878.1_4 Reverse -294 -313 7.66927 0.219
NP_441878.1_6 Reverse -301 -311 -7.0998 0.204
NP_441036.1_8 Forward -191 -181 5.48657 0.279
NP_441445.1_1 Reverse -175 -194 1.17943 0.259
NP_441445.1_1 Forward -277 -258 0.196116 0.281
NP_441590.1_4 Reverse -346 -365 5.01354 0.279
NP_442830.1_5 Forward -53 -39 8.94708 0.192
NP_441564.1_2 Reverse -93 -112 -5.01543 0.244
NP_441574.1_1 Reverse -259 -278 -3.14714 0.236
NP_442645.1_6 Reverse -349 -368 23.5006 0.0121
NP_440547.1_1 Forward -328 -309 21.9264 0.0474
NP_442047.1_2 Forward -337 -323 14.9459 0.186
NP_440299.1_1 Forward -272 -259 2.57534 0.284
NP_440299.1_1 Forward -194 -181 2.37867 0.291
NP_441799.1_9 Forward -194 -175 2.16274 0.213
NP_441007.1_5 Forward -46 -27 8.45592 0.267
NP_441007.1_10 Reverse -260 -273 -0.37404 0.277
NP_440256.1_1 Forward -100 -81 -9.44032 0.28
NP_441957.1_7 Reverse -84 -103 15.1424 0.232
NP_441362.1_2 Reverse -52 -71 3.73847 0.299
NP_441559.1_8 Forward -128 -114 -5.11362 0.248
NP_440915.1_6 Reverse -188 -202 4.12949 0.0999
NP_440915.1_6 Reverse -319 -333 0.196253 0.173
NP_440915.1_6 Reverse -261 -275 0.196253 0.173
NP_441296.1_9 Forward -122 -109 11.9167 0.23
NP_440717.1_3 Forward -198 -184 12.2903 0.23
NP_440134.1_2 Reverse -113 -132 5.50599 0.298
NP_440749.1_6 Forward -132 -113 9.83255 0.227
NP_440702.1_2 Forward -379 -360 -5.70374 0.257
NP_440695.1_5 Reverse -259 -278 6.68596 0.15
NP_442993.1_1 Forward -317 -301 -13.3145 0.291
NP_442386.1_9 Forward -53 -44 7.2758 0.219
NP_442386.1_9 Forward -269 -260 6.9808 0.219
NP_441340.1_5 Forward -267 -260 3.97235 0.274
NP_443028.1_5 Forward -367 -354 17.2272 0.262
NP_442484.1_2 Reverse -27 -46 -1.57384 0.294
NP_439976.1_4 Forward -196 -177 4.42355 0.287
NP_442240.1_2 Reverse -182 -201 -20.7484 0.295
NP_441160.1_5 Forward -219 -200 -5.9004 0.288
NP_440586.1_1 Reverse -261 -280 -4.03212 0.277
NP_441912.1_2 Reverse -323 -342 15.6882 0.275
NP_440027.1_3 Forward -200 -182 6.70489 0.223
NP_439937.1_9 Forward -333 -316 -3.30509 0.157
NP_439937.1_9 Forward -136 -119 -11.2699 0.248
NP_441595.1_3 Forward -206 -196 15.5163 0.28
NP_442239.1_8 Reverse -175 -194 7.66927 0.255
NP_440171.1_3 Reverse -319 -338 6.39097 0.265
NP_440171.1_3 Reverse -121 -140 5.40766 0.284
NP_440991.1_10 Reverse -215 -234 15.9291 0.258
NP_440316.1_10 Reverse -183 -193 11.0914 0.214
NP_441803.1_2 Forward -279 -260 5.30933 0.17
NP_441803.1_2 Forward -208 -189 -1.27885 0.297
NP_440139.1_1 Forward -274 -255 0.981987 0.275
NP_441018.1_7 Reverse -255 -274 7.07928 0.277
NP_440163.1_10 Reverse -256 -266 10.6981 0.198
NP_440531.1_8 Reverse -27 -46 4.03102 0.269
NP_441640.1_8 Reverse -379 -398 -6.09707 0.296
NP_440297.1_9 Forward -51 -41 0.471689 0.282
NP_441592.1_4 Reverse -330 -349 -1.96717 0.26
NP_441103.1_9 Forward -95 -85 12.3919 0.298
NP_440700.1_8 Reverse -89 -103 10.3243 0.292
NP_440999.1_9 Forward -194 -180 -1.47537 0.239
NP_440888.1_2 Forward -274 -260 11.897 0.0562
NP_440888.1_2 Forward -97 -83 7.07881 0.208
NP_440888.1_2 Forward -268 -254 5.21053 0.288
NP_442948.1_2 Reverse -264 -283 7.37428 0.229
NP_441949.1_4 Reverse -257 -276 5.80098 0.281
NP_440105.1_7 Forward -87 -68 15.5357 0.204
NP_442845.1_2 Reverse -142 -156 4.42448 0.259
NP_442845.1_2 Reverse -301 -315 3.63784 0.282
NP_441918.1_7 Reverse -42 -61 -2.36049 0.297
NP_443064.1_6 Reverse -354 -364 8.59164 0.278
NP_441462.1_2 Forward -190 -180 -0.41329 0.225
NP_441560.1_10 Reverse -35 -54 5.50599 0.292
NP_440516.1_8 Reverse -184 -193 -0.295266 0.232
NP_442428.1_5 Reverse -260 -267 4.759 0.223
NP_441032.1_2 Forward -370 -351 24.2872 0.00352
NP_441032.1_5 Forward -283 -264 30.1871 0.00023
NP_441032.1_6 Forward -193 -174 26.3522 0.00189
NP_441032.1_8 Forward -158 -139 19.6656 0.0906
NP_441867.1_2 Reverse -305 -324 -10.6203 0.202
NP_440673.1_3 Forward -144 -137 6.72562 0.277
NP_441884.1_8 Forward -364 -345 -4.72043 0.164
NP_442864.1_7 Forward -274 -256 6.90232 0.274
NP_441004.1_2 Reverse -312 -331 3.93269 0.2
NP_441004.1_4 Reverse -5 -15 11.0914 0.254
NP_441004.1_4 Reverse -320 -330 9.91146 0.259
NP_442873.1_5 Reverse -364 -383 10.4217 0.248
NP_442206.1_1 Forward -274 -255 -14.0619 0.266
NP_441851.1_10 Forward -364 -354 9.02648 0.114
NP_441668.1_4 Reverse -123 -142 7.47261 0.151
NP_440593.1_3 Forward -336 -317 -4.81876 0.253
NP_440593.1_3 Reverse -379 -398 -6.1954 0.271
NP_440463.1_8 Reverse -190 -209 12.0501 0.203
NP_441349.1_10 Reverse -171 -190 -6.98204 0.239
NP_441661.1_3 Reverse -106 -123 3.38209 0.226
NP_442024.1_9 Forward -225 -212 15.3589 0.272
NP_441409.1_8 Reverse -68 -87 9.04103 0.242
NP_442843.1_1 Reverse -185 -204 -10.1286 0.276
NP_442168.1_5 Forward -278 -259 -1.57384 0.264
NP_440483.1_1 Reverse -143 -162 -7.17871 0.258
NP_441570.1_1 Reverse -88 -106 -8.63398 0.117
NP_442388.1_3 Reverse -145 -164 4.22769 0.293
NP_442443.1_1 Reverse -186 -205 -3.93378 0.267
NP_443024.1_3 Reverse -124 -134 14.238 0.255
NP_441732.1_2 Forward -278 -262 -6.92296 0.0558
NP_441732.1_2 Forward -170 -154 -8.20127 0.124
NP_440685.1_6 Forward -193 -174 15.3382 0.291
NP_440760.1_1 Reverse -336 -355 -22.5183 0.261
NP_442797.1_1 Forward -278 -259 -0.688862 0.231
NP_440713.1_4 Reverse -255 -274 6.98095 0.184
NP_441659.2_8 Reverse -271 -281 -0.0199663 0.282
NP_440708.1_7 Forward -273 -254 5.11266 0.214
NP_440545.1_3 Reverse -177 -194 -1.63279 0.171
NP_440545.1_3 Reverse -261 -278 -6.25434 0.273
NP_440459.1_2 Reverse -299 -316 7.90532 0.276
NP_440010.1_4 Reverse -255 -274 -2.65624 0.288
NP_442900.1_1 Reverse -96 -115 -6.58872 0.245
NP_442603.1_7 Forward -268 -254 7.3738 0.208
NP_441112.1_5 Forward -382 -363 9.43923 0.201
NP_441112.1_6 Forward -300 -281 -3.93378 0.296
NP_442140.1_3 Forward -192 -182 4.89658 0.238
NP_442140.1_3 Reverse -149 -159 3.81494 0.278
NP_440590.1_4 Forward -279 -266 8.67241 0.0431
NP_440590.1_4 Forward -273 -260 0.707601 0.144
NP_440567.1_1 Reverse -260 -274 0.687908 0.236
NP_441239.1_9 Forward -195 -183 5.15219 0.227
NP_441239.1_9 Forward -319 -307 4.75886 0.243
NP_442568.1_6 Forward -133 -114 16.0265 0.0914
NP_440665.1_1 Reverse -247 -266 -14.8485 0.264
NP_441769.1_3 Forward -133 -114 -2.16459 0.245
NP_440354.1_7 Reverse -178 -196 16.6371 0.167
NP_442052.1_7 Reverse -260 -274 16.9125 0.153
NP_442809.1_6 Forward -274 -255 9.43923 0.256
NP_440546.1_4 Reverse -148 -158 7.91294 0.214
NP_441474.1_1 Forward -107 -88 -1.47628 0.262
NP_442402.1_4 Reverse -347 -366 6.1935 0.133
NP_442402.1_4 Reverse -161 -180 -4.32786 0.224
NP_442402.1_10 Reverse -357 -367 11.3859 0.257
NP_442402.1_10 Reverse -356 -366 10.9926 0.272
NP_441811.1_8 Reverse -259 -273 7.76774 0.241
NP_442380.1_10 Reverse -255 -273 9.55725 0.262
NP_440825.1_6 Reverse -149 -168 7.07928 0.287
NP_440505.1_3 Forward -178 -168 4.60159 0.277
NP_441102.1_10 Reverse -97 -116 6.4893 0.265
NP_441252.1_6 Reverse -320 -327 11.9372 0.25
NP_442101.1_10 Reverse -328 -347 -13.2752 0.288
NP_442533.1_1 Forward -380 -361 10.7175 0.0798
NP_442533.1_1 Reverse -85 -104 -12.1936 0.236
NP_442533.1_1 Forward -379 -360 -17.0118 0.279
NP_442533.1_6 Forward -201 -192 4.12963 0.191
NP_442533.1_6 Forward -97 -88 4.0313 0.194
NP_442533.1_6 Reverse -265 -274 3.53964 0.21
NP_442541.1_10 Forward -136 -122 9.6354 0.204
NP_441482.1_7 Forward -103 -89 -5.80194 0.19
NP_441028.1_6 Forward -308 -298 10.1076 0.21
NP_441028.1_6 Reverse -357 -367 6.37109 0.23
NP_440007.1_9 Forward -101 -87 0.491246 0.297
NP_442728.1_2 Forward -379 -360 15.0441 0.244
NP_439965.1_7 Forward -95 -76 12.7531 0.287
NP_439965.1_9 Reverse -308 -327 5.70265 0.287
NP_441602.1_3 Reverse -260 -279 -4.42544 0.265
NP_441972.1_3 Reverse -87 -106 12.0942 0.28
NP_441106.1_1 Forward -191 -182 2.65466 0.269
NP_439903.1_6 Reverse -250 -269 -1.37794 0.299
NP_440670.1_8 Forward -280 -271 3.53964 0.257
NP_441953.1_4 Reverse -175 -194 22.6156 0.0179
NP_441886.1_8 Reverse -62 -81 11.7992 0.243
NP_441930.1_2 Reverse -322 -332 14.3364 0.226
NP_441930.1_2 Reverse -43 -53 14.0414 0.236
NP_440886.1_7 Forward -269 -259 7.15773 0.103
NP_440886.1_7 Forward -194 -184 5.78111 0.163
NP_440828.1_4 Forward -278 -259 -4.91784 0.246
NP_442213.1_5 Reverse -257 -276 -2.36049 0.295
NP_441753.1_10 Reverse -175 -194 11.3075 0.123
NP_442264.1_2 Reverse -313 -330 4.95539 0.288
NP_439967.1_1 Reverse -309 -327 9.85225 0.299
NP_441463.1_3 Forward -278 -259 3.83436 0.0971
NP_441463.1_6 Reverse -41 -55 11.151 0.224
NP_441626.1_2 Reverse -329 -336 7.6106 0.119
NP_442615.1_1 Reverse -172 -190 -3.81576 0.17
NP_441742.1_7 Forward -194 -175 14.8474 0.245
NP_441174.1_1 Reverse -183 -198 17.4828 0.231
NP_441174.1_6 Reverse -130 -142 21.3768 0.236
NP_440814.1_8 Reverse -137 -156 -0.39387 0.277
NP_442090.1_10 Reverse -185 -198 10.344 0.288
NP_442323.1_7 Forward -337 -318 1.96529 0.276
NP_440293.1_3 Reverse -185 -204 3.93269 0.192
NP_441237.1_9 Reverse -44 -54 10.6981 0.22
NP_442867.1_2 Forward -217 -198 6.78429 0.202
NP_440457.1_1 Reverse -188 -200 6.03717 0.132
NP_442297.1_5 Forward -56 -37 7.96426 0.139
NP_441984.1_6 Reverse -186 -198 14.887 0.224
NP_441332.1_6 Forward -195 -185 13.6798 0.184
NP_440524.1_3 Reverse -175 -194 13.8641 0.244
NP_442228.1_3 Reverse -369 -388 0.687771 0.139
NP_441756.1_5 Forward -194 -175 -4.32711 0.294
NP_441173.1_9 Reverse -358 -366 10.1471 0.261
NP_441173.1_9 Forward -396 -388 9.85212 0.275
NP_440275.1_3 Forward -192 -182 2.14332 0.271
NP_440679.1_10 Reverse -255 -274 -20.7484 0.286
NP_441122.1_1 Reverse -195 -210 4.60145 0.28
NP_439962.1_4 Forward -201 -182 1.47442 0.197
NP_440175.1_7 Reverse -374 -392 11.7053 0.23
NP_440175.1_7 Forward -227 -209 9.5583 0.28
NP_441105.1_3 Reverse -254 -273 -5.21209 0.214
NP_440216.1_1 Forward -201 -187 -5.40861 0.129
NP_440216.1_1 Reverse -181 -195 -11.4068 0.184
NP_440216.1_9 Reverse -138 -147 10.7178 0.286
NP_442015.1_10 Forward -14 -1 -0.0790467 0.25
NP_441226.1_7 Reverse -185 -192 9.77352 0.131
NP_441226.1_7 Forward -111 -104 5.64364 0.286
NP_442834.1_10 Forward -193 -174 16.0274 0.0749
NP_440244.1_1 Reverse -320 -339 -0.0988766 0.187
NP_442417.1_5 Reverse -181 -195 4.91614 0.283
NP_440416.1_9 Forward -275 -256 -17.4051 0.239
NP_440416.1_9 Reverse -174 -193 -17.6018 0.243
NP_442154.1_1 Forward -379 -361 -3.6191 0.125
NP_442154.1_1 Reverse -260 -278 -14.3372 0.218
NP_442154.1_1 Reverse -149 -167 -19.0571 0.289
NP_440988.1_10 Forward -114 -100 9.35221 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACCTTTTGCCAGAACAACAGGATGTGGTGGATCTGGGGGGAACCATGCGGTTAGGACTATATCCCTGTCGCATTGCCCCAGATACCCTGGCCTTTTCCCTGTATCAAAAGGAAGTGGTGTACGAACGGCACCGCCACCGCTATGAGTTTAATAACTCCTACCGCACCCAATTCACCGATACTGGTTTTGTGGTCAGTGGCACATCCCCCGACGGCCGCCTAGTGGAAATCGTTGAATATCCCCACCATCCCTTTTTCATTGCCTGCCAATTTCACCCGGAATTCCATTCCCGTCCCAACCAAGCTCATCCCCTTTTTAGCGGCTTTATTAATGCGGTCTTAAAACGTCGCAATGCCCCTGCTAAGATAGCGGTTAACTGCCACACCGTTACCGAAGATC

CDS

ATGAGCCAAGTTAAACAAATCCAGGGTAAGGCCTTGCCCCTAGTGGGGGATGACATCGACACTGACCGCATCATTCCCGCTCGCTTTTTGCGTTGTGTCACCTTTGACGGTCTGGGGGAACATGTTTTTGCCGACGATCGCCAGCAACAGGGGGGCAACCATCCTTTTGATCTGTCCCAATACCAAGACGCCACAGTGTTGGTGGTCAACCGCAACTTTGGTTGTGGCTCCAGCCGGGAACACGCTCCCCAAGCCATTATTAAATGGGGTATCAAGGCCATCATTGGGGAAAGTTTTGCTGAAATCTTTTTGGGTAACTGCTTGGCCAACGGTGTGCCCTGTGTCACTGCCCCCCATGGTCAGATTGCCGATTTACAACAAGCCATTACCGCCGATCCTAATTTGGCAGTGAATTTAGACCTAACCACCGCTGCCGTTACCTACGGCGATCGGAGTTTTCCCGTAATTCTCTCCGACGGGGCCCAGCAAATGTTGCTGGATGGCCAATGGGACACCTGTGGTCAACTGGTGCAAAATCAGGGGAAAATTGCCGCCACCGCTGAAAAATTGCCCTATCTCCATTGGCAAACTTCCGCCGCCTAG

Protein

MSQVKQIQGKALPLVGDDIDTDRIIPARFLRCVTFDGLGEHVFADDRQQQGGNHPFDLSQYQDATVLVVNRNFGCGSSREHAPQAIIKWGIKAIIGESFAEIFLGNCLANGVPCVTAPHGQIADLQQAITADPNLAVNLDLTTAAVTYGDRSFPVILSDGAQQMLLDGQWDTCGQLVQNQGKIAATAEKLPYLHWQTSAA