Your browser is old and dusty. Try Google Chrome!

Details for sll1442

ORF sll1442
Accession NP_441620.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -90 -109 -1.08219 0.27
NP_440795.1_7 Forward -181 -174 14.6904 0.0123
NP_440795.1_7 Reverse -174 -181 14.6904 0.0123
NP_441418.1_6 Forward -182 -163 -21.9284 0.163
NP_441418.1_6 Reverse -161 -180 -28.9099 0.213
NP_442291.1_5 Reverse -172 -188 2.32015 0.128
NP_440897.1_6 Reverse -173 -192 10.815 0.0705
NP_441453.1_4 Reverse -173 -181 16.539 0.00633
NP_441453.1_4 Forward -182 -174 16.539 0.00633
NP_441453.1_4 Reverse -96 -104 14.8674 0.00947
NP_441453.1_4 Forward -105 -97 6.80426 0.121
NP_442151.1_6 Forward -182 -168 15.7325 0.0214
NP_442151.1_6 Forward -105 -91 5.30946 0.284
NP_441818.1_1 Reverse -174 -185 18.0527 0.00639
NP_440226.1_1 Reverse -96 -115 18.289 0.0157
NP_440226.1_1 Forward -182 -163 17.109 0.0203
NP_440226.1_1 Reverse -173 -192 2.65439 0.256
NP_442287.1_1 Forward -93 -83 15.3192 0.22
NP_441721.1_6 Forward -254 -235 8.94757 0.281
NP_442173.1_1 Forward -181 -173 15.4574 0.00633
NP_442173.1_1 Reverse -174 -182 15.4574 0.00633
NP_442173.1_1 Forward -104 -96 13.8841 0.0225
NP_442173.1_1 Reverse -97 -105 12.0158 0.0316
NP_442752.1_4 Forward -182 -175 13.8055 0.0199
NP_442752.1_4 Reverse -173 -180 13.8055 0.0199
NP_442752.1_4 Forward -105 -98 13.8055 0.0199
NP_443027.1_4 Reverse -171 -181 15.3197 0.0437
NP_443027.1_4 Forward -184 -174 11.0914 0.107
NP_443027.1_4 Forward -107 -97 6.66654 0.274
NP_441812.1_3 Forward -183 -169 16.2242 0.0755
NP_442975.1_10 Reverse -169 -183 11.1104 0.0516
NP_440784.1_7 Forward -181 -174 15.9687 0.0123
NP_440784.1_7 Reverse -174 -181 15.9687 0.0123
NP_440784.1_7 Forward -104 -97 6.23397 0.241
NP_440784.1_7 Reverse -97 -104 6.13563 0.241
NP_440061.1_9 Forward -184 -170 14.4536 0.0655
NP_440061.1_9 Reverse -171 -185 12.9786 0.0878
NP_441054.1_2 Reverse -207 -226 9.43923 0.295
NP_441054.1_4 Reverse -163 -181 3.65739 0.168
NP_441054.1_4 Forward -192 -174 1.00246 0.173
NP_441476.1_5 Forward -175 -156 0.884433 0.19
NP_442062.1_8 Reverse -173 -183 17.3846 0.00193
NP_442062.1_8 Forward -182 -172 10.3048 0.0493
NP_442062.1_8 Forward -105 -95 7.94484 0.0848
NP_441859.1_3 Forward -183 -164 2.55527 0.258
NP_440304.1_4 Reverse -171 -181 18.9579 0.00406
NP_440304.1_4 Forward -107 -97 10.2065 0.051
NP_440304.1_4 Forward -184 -174 1.84832 0.299
NP_442242.1_4 Forward -181 -174 14.3954 0.0124
NP_442242.1_4 Reverse -174 -181 14.3954 0.0124
NP_440044.1_8 Forward -181 -162 7.86593 0.0803
NP_441620.1_2 Forward -250 -232 19.2371 0.243
NP_441620.1_3 Forward -112 -93 25.9588 0.00164
NP_441620.1_5 Forward -275 -256 26.4505 0.00698
NP_441208.1_9 Forward -185 -171 9.04604 0.219
NP_441208.1_9 Reverse -170 -184 7.17775 0.226
NP_441208.1_9 Reverse -93 -107 6.09611 0.253
NP_442110.1_7 Forward -182 -168 9.2427 0.0755
NP_442110.1_7 Reverse -96 -110 2.2612 0.222
NP_441083.1_5 Reverse -173 -183 20.3345 0.00053
NP_441083.1_5 Forward -182 -172 11.2881 0.0159
NP_441083.1_5 Forward -105 -95 6.96153 0.0717
NP_441083.1_5 Reverse -96 -106 0.766681 0.218
NP_439957.1_10 Forward -80 -70 16.2046 0.277
NP_441141.1_2 Reverse -95 -114 14.9449 0.209
NP_441738.1_2 Forward -180 -173 15.28 0.0102
NP_441738.1_2 Reverse -175 -182 15.28 0.0102
NP_441738.1_2 Reverse -98 -105 15.28 0.0102
NP_441558.1_5 Reverse -171 -190 19.3707 0.0081
NP_441558.1_5 Forward -184 -165 12.0942 0.0717
NP_441558.1_5 Reverse -234 -253 5.80098 0.24
NP_440209.1_1 Reverse -173 -181 18.1123 0.00295
NP_440209.1_1 Forward -182 -174 18.1123 0.00295
NP_440209.1_1 Forward -105 -97 8.57422 0.0425
NP_442889.1_8 Forward -101 -87 2.8506 0.299
NP_441713.1_1 Reverse -167 -186 4.71934 0.0568
NP_441713.1_1 Forward -188 -169 -5.11376 0.113
NP_441713.1_7 Forward -181 -162 13.8641 0.293
NP_441770.1_4 Reverse -293 -312 -10.522 0.272
NP_440178.1_7 Forward -183 -164 -21.6334 0.232
NP_440178.1_7 Forward -375 -356 -22.8133 0.279
NP_441989.1_5 Forward -111 -92 20.4626 0.127
NP_442570.1_3 Reverse -81 -100 -2.55715 0.212
NP_441716.1_1 Reverse -173 -187 23.1074 0.00274
NP_442111.1_4 Forward -183 -169 10.6193 0.0531
NP_442111.1_4 Reverse -172 -186 7.57108 0.0923
NP_442111.1_4 Reverse -95 -109 4.91614 0.185
NP_440906.1_5 Forward -181 -174 15.8704 0.0124
NP_440906.1_5 Reverse -174 -181 15.8704 0.0124
NP_440906.1_5 Forward -104 -97 6.23397 0.234
NP_440906.1_5 Reverse -97 -104 6.13563 0.241
NP_440747.1_10 Forward -185 -173 16.8536 0.00143
NP_440747.1_10 Reverse -170 -182 -1.92764 0.0192
NP_440747.1_10 Forward -313 -301 -12.3507 0.27
NP_441130.1_10 Forward -184 -170 13.9626 0.0558
NP_441130.1_10 Reverse -171 -185 10.521 0.112
NP_442973.1_5 Reverse -87 -106 12.4875 0.206
NP_441486.1_1 Forward -108 -94 6.09611 0.0344
NP_441486.1_1 Forward -185 -171 -2.65535 0.175
NP_441486.1_1 Reverse -170 -184 -3.04867 0.175
NP_442634.1_2 Forward -188 -169 -0.590531 0.293
NP_442634.1_4 Forward -184 -170 6.09611 0.051
NP_442634.1_4 Reverse -171 -185 -3.54032 0.161
NP_442848.1_1 Forward -111 -97 3.8345 0.12
NP_442848.1_1 Forward -188 -174 -2.45868 0.263
NP_443018.1_3 Forward -181 -174 14.8871 0.0123
NP_443018.1_3 Reverse -174 -181 14.8871 0.0123
NP_443018.1_3 Reverse -97 -104 11.7405 0.0655
NP_443018.1_3 Forward -104 -97 5.44732 0.193
NP_441316.1_7 Forward -184 -169 -1.79006 0.24
NP_441634.1_1 Reverse -84 -103 7.57094 0.166
NP_441634.1_8 Forward -184 -170 15.4376 0.0248
NP_441634.1_9 Reverse -201 -220 8.4551 0.294
NP_441634.1_9 Forward -238 -219 8.16011 0.294
NP_440376.1_1 Forward -182 -173 19.4693 0.000692
NP_440376.1_1 Reverse -173 -182 19.4693 0.000692
NP_440376.1_1 Forward -105 -96 5.89959 0.116
NP_440376.1_1 Reverse -83 -92 1.76968 0.242
NP_440376.1_1 Reverse -96 -105 -0.0986038 0.285
NP_441857.1_5 Reverse -89 -107 4.54237 0.222
NP_441588.1_4 Reverse -98 -108 6.66654 0.185
NP_442730.1_1 Reverse -71 -90 18.584 0.0992
NP_442687.1_7 Reverse -212 -222 10.4031 0.0994
NP_442687.1_7 Reverse -172 -182 9.02648 0.0994
NP_442687.1_7 Forward -183 -173 8.92815 0.0994
NP_442687.1_7 Forward -106 -96 5.78156 0.188
NP_442958.1_3 Reverse -162 -181 2.65439 0.267
NP_442958.1_3 Forward -193 -174 0.884433 0.267
NP_441422.1_7 Forward -184 -167 -5.1727 0.247
NP_442296.1_9 Reverse -90 -109 2.94938 0.17
NP_442658.1_1 Reverse -171 -181 15.9091 0.00966
NP_442658.1_1 Forward -184 -174 7.94438 0.199
NP_442496.1_5 Reverse -229 -247 10.7372 0.217
NP_442205.1_9 Reverse -167 -183 5.95839 0.123
NP_442205.1_9 Forward -111 -95 -3.77637 0.295
NP_441414.1_9 Reverse -173 -192 3.04771 0.0606
NP_441414.1_9 Forward -182 -163 -7.67036 0.223
NP_442321.1_1 Forward -168 -149 -4.91709 0.216
NP_441958.1_5 Reverse -172 -182 21.2195 0.000805
NP_441958.1_5 Forward -106 -96 17.6796 0.00183
NP_441958.1_5 Forward -183 -173 12.2714 0.00183
NP_441958.1_5 Reverse -95 -105 0.963343 0.12
NP_442836.1_5 Reverse -90 -109 8.35759 0.144
NP_442836.1_5 Reverse -167 -186 1.17943 0.287
NP_440203.1_5 Forward -179 -169 9.51767 0.254
NP_439905.1_1 Forward -181 -168 19.3905 0.0174
NP_439905.1_1 Reverse -174 -187 9.75405 0.216
NP_440984.1_7 Reverse -168 -182 22.714 0.000733
NP_441097.1_2 Reverse -226 -243 4.3654 0.28
NP_439990.1_5 Forward -187 -174 5.32916 0.298
NP_442690.1_1 Forward -31 -12 -8.06369 0.183
NP_442911.1_2 Reverse -163 -182 2.16274 0.0531
NP_442911.1_2 Forward -192 -173 -2.65548 0.1
NP_441580.1_6 Reverse -162 -181 -7.17871 0.236
NP_440153.1_5 Forward -181 -167 6.88276 0.174
NP_440153.1_5 Reverse -174 -188 2.94952 0.219
NP_440993.1_2 Reverse -168 -184 3.10679 0.262
NP_440993.1_3 Reverse -163 -182 15.6332 0.0527
NP_440993.1_3 Reverse -368 -387 0.195343 0.259
NP_441913.1_1 Forward -314 -298 12.9485 0.294
NP_441348.1_3 Reverse -168 -187 11.4058 0.174
NP_441099.1_5 Forward -192 -173 -0.885524 0.1
NP_441099.1_8 Reverse -183 -201 13.4897 0.201
NP_442002.1_9 Reverse -313 -320 11.3472 0.185
NP_440809.1_9 Reverse -164 -182 11.4255 0.0632
NP_440809.1_9 Forward -191 -173 -7.65067 0.225
NP_441294.1_7 Forward -186 -172 15.0099 0.0328
NP_441294.1_7 Reverse -92 -106 9.82656 0.223
NP_441294.1_7 Reverse -169 -183 8.86667 0.274
NP_441646.1_1 Forward -189 -170 1.76941 0.228
NP_441646.1_1 Reverse -82 -101 -0.197208 0.259
NP_442438.1_10 Reverse -168 -182 3.63784 0.159
NP_442438.1_10 Forward -187 -173 3.04785 0.166
NP_442566.1_7 Reverse -106 -125 17.7974 0.158
NP_441000.1_6 Reverse -172 -186 4.81781 0.0933
NP_441000.1_6 Reverse -95 -109 -4.7203 0.251
NP_440147.1_4 Forward -184 -171 17.5222 0.00641
NP_440147.1_4 Reverse -171 -184 11.3273 0.0326
NP_440147.1_4 Reverse -94 -107 0.707601 0.247
NP_440147.1_4 Forward -107 -94 0.215946 0.261
NP_441550.1_8 Reverse -171 -181 17.4824 0.00754
NP_441550.1_8 Forward -184 -174 15.1225 0.0132
NP_441550.1_8 Reverse -94 -104 11.8776 0.0415
NP_441550.1_8 Forward -107 -97 11.7793 0.0435
NP_441916.1_6 Forward -135 -116 16.9124 0.228
NP_441916.1_7 Forward -182 -172 18.9579 0.00144
NP_441916.1_7 Reverse -173 -183 10.3048 0.0261
NP_441916.1_7 Reverse -96 -106 10.0098 0.0283
NP_441916.1_7 Forward -105 -95 5.09324 0.146
NP_440206.1_4 Forward -255 -236 1.47364 0.289
NP_440465.1_4 Forward -183 -164 9.63589 0.284
NP_441041.1_4 Reverse -173 -192 -11.5053 0.248
NP_441041.1_4 Reverse -96 -115 -13.2752 0.285
NP_441041.1_7 Reverse -93 -105 10.7216 0.0888
NP_441041.1_7 Reverse -170 -182 8.97244 0.125
NP_442004.1_6 Forward -182 -168 5.80112 0.181
NP_442004.1_6 Reverse -173 -187 2.06454 0.274
NP_442004.1_6 Reverse -96 -110 1.67122 0.283
NP_441725.1_5 Forward -181 -171 8.92815 0.0553
NP_441725.1_5 Reverse -174 -184 2.04498 0.115
NP_441725.1_5 Reverse -97 -107 1.35667 0.137
NP_439966.1_7 Forward -184 -174 15.3192 0.0152
NP_439966.1_7 Reverse -171 -181 13.8442 0.0234
NP_439966.1_7 Forward -107 -97 5.09279 0.243
NP_439966.1_9 Reverse -171 -180 0.983037 0.253
NP_442941.1_3 Reverse -174 -184 19.2529 0.00262
NP_442941.1_3 Forward -181 -171 10.9931 0.0116
NP_442941.1_3 Reverse -97 -107 10.1081 0.024
NP_440289.1_2 Reverse -170 -183 2.2809 0.1
NP_440289.1_2 Forward -108 -95 -2.83231 0.262
NP_440289.1_2 Forward -185 -172 -3.61896 0.267
NP_440260.1_8 Reverse -99 -117 1.98577 0.182
NP_440260.1_8 Reverse -80 -98 1.78911 0.183
NP_442281.1_1 Reverse -91 -105 19.8618 0.00247
NP_442281.1_1 Reverse -168 -182 5.70218 0.15
NP_441079.1_7 Reverse -10 -29 -7.96609 0.298
NP_441058.2_6 Reverse -204 -223 11.1109 0.268
NP_442256.1_2 Forward -184 -166 1.29745 0.107
NP_442012.1_1 Reverse -167 -186 -1.67217 0.294
NP_440498.1_1 Reverse -164 -182 2.87075 0.17
NP_442982.1_5 Reverse -232 -251 -3.44213 0.298
NP_441644.1_6 Forward -182 -172 19.0557 0.000803
NP_441644.1_6 Reverse -173 -183 17.3841 0.00127
NP_441644.1_6 Reverse -96 -106 16.4008 0.00405
NP_442215.1_2 Reverse -87 -103 0.353528 0.153
NP_442215.1_2 Reverse -299 -315 -4.95634 0.242
NP_442215.1_2 Reverse -376 -392 -7.61128 0.3
NP_442029.1_6 Reverse -84 -103 7.17762 0.225
NP_442247.1_8 Forward -184 -170 8.45605 0.272
NP_440253.1_2 Reverse -173 -191 1.69077 0.155
NP_440929.1_8 Forward -182 -173 19.2726 0.000701
NP_440929.1_8 Reverse -173 -182 19.2726 0.000701
NP_440929.1_8 Reverse -96 -105 7.17789 0.0713
NP_442933.1_10 Forward -182 -173 17.601 0.00325
NP_442933.1_10 Reverse -173 -182 17.601 0.00325
NP_442933.1_10 Reverse -96 -105 8.06287 0.0885
NP_442933.1_10 Forward -105 -96 7.96454 0.0937
NP_441751.2_8 Reverse -174 -188 4.91614 0.0453
NP_441751.2_8 Reverse -97 -111 4.12949 0.0534
NP_441751.2_8 Forward -181 -167 -4.52363 0.174
NP_442554.1_8 Forward -181 -171 19.1546 0.00369
NP_442554.1_8 Reverse -174 -184 16.2046 0.0065
NP_442554.1_8 Reverse -97 -107 7.15819 0.0975
NP_442554.1_8 Forward -104 -94 2.24165 0.276
NP_441762.1_7 Forward -183 -171 2.59558 0.0676
NP_441762.1_7 Reverse -95 -107 -6.45087 0.284
NP_441762.1_7 Reverse -172 -184 -6.64753 0.284
NP_442142.1_4 Forward -185 -172 4.93527 0.206
NP_442142.1_4 Reverse -170 -183 3.7553 0.246
NP_442292.1_1 Reverse -174 -183 18.486 0.00229
NP_442292.1_1 Forward -181 -172 17.5026 0.00435
NP_442292.1_1 Reverse -97 -106 7.66954 0.0634
NP_442292.1_5 Reverse -169 -188 -1.18052 0.257
NP_440919.1_1 Reverse -309 -328 -7.57203 0.278
NP_442476.1_6 Forward -181 -167 16.8142 0.0367
NP_442476.1_6 Reverse -174 -188 11.3077 0.056
NP_441523.1_6 Reverse -169 -188 4.42435 0.252
NP_443009.1_5 Forward -183 -172 14.5128 0.02
NP_443009.1_5 Reverse -172 -183 10.1862 0.0792
NP_443009.1_5 Forward -106 -95 6.25303 0.169
NP_441715.1_4 Reverse -174 -184 17.3846 0.0106
NP_441715.1_4 Forward -181 -171 7.25653 0.108
NP_441715.1_4 Reverse -97 -107 4.40493 0.281
NP_442076.1_8 Reverse -162 -181 5.80098 0.286
NP_441198.1_8 Reverse -171 -181 15.4199 0.0427
NP_441468.1_1 Forward -181 -174 15.8704 0.0124
NP_441468.1_1 Reverse -174 -181 15.8704 0.0124
NP_441468.1_1 Forward -104 -97 6.13563 0.209
NP_441468.1_1 Reverse -97 -104 6.0373 0.223
NP_441015.1_10 Reverse -168 -187 1.27776 0.16
NP_441673.1_1 Forward -182 -173 20.8459 0.000698
NP_441673.1_1 Reverse -173 -182 20.8459 0.000698
NP_441673.1_1 Forward -105 -96 1.27803 0.155
NP_441673.1_1 Reverse -96 -105 1.27803 0.155
NP_441826.1_2 Forward -104 -90 1.57289 0.147
NP_441826.1_2 Reverse -96 -110 -2.45868 0.271
NP_441826.1_2 Reverse -90 -104 -3.63866 0.286
NP_441826.1_2 Reverse -167 -181 -3.93365 0.29
NP_442868.1_6 Forward -184 -174 19.2529 0.00563
NP_442868.1_6 Reverse -171 -181 8.63316 0.0555
NP_441251.1_7 Forward -25 -12 17.3255 0.266
NP_441612.1_2 Reverse -173 -183 8.54929 0.21
NP_442808.1_1 Reverse -172 -182 8.73102 0.0481
NP_442808.1_1 Forward -183 -173 8.63269 0.0481
NP_442808.1_1 Forward -125 -115 2.43787 0.266
NP_442692.1_8 Forward -358 -340 18.6037 0.145
NP_440145.1_3 Forward -192 -173 5.40766 0.0662
NP_442542.1_2 Reverse -171 -184 11.3273 0.114
NP_442542.1_2 Forward -159 -146 4.93583 0.29
NP_442050.1_5 Reverse -171 -181 17.1874 0.00812
NP_442050.1_5 Forward -184 -174 14.3359 0.0206
NP_442050.1_5 Forward -107 -97 8.3377 0.234
NP_441878.1_6 Reverse -172 -182 10.5014 0.0176
NP_441878.1_6 Forward -183 -173 10.4031 0.0176
NP_441878.1_6 Reverse -95 -105 0.668351 0.139
NP_441036.1_8 Reverse -172 -182 15.713 0.00724
NP_441036.1_8 Forward -106 -96 10.5014 0.167
NP_441036.1_8 Forward -183 -173 8.33817 0.174
NP_441557.1_5 Forward -182 -173 19.9609 0.000699
NP_441557.1_5 Reverse -173 -182 19.9609 0.000699
NP_441557.1_5 Forward -105 -96 8.94785 0.0289
NP_441557.1_5 Reverse -96 -105 0.688044 0.128
NP_441557.1_8 Reverse -152 -162 14.3359 0.2
NP_441445.1_1 Reverse -164 -183 5.80098 0.163
NP_441445.1_1 Forward -114 -95 2.45773 0.233
NP_441445.1_8 Forward -164 -145 -12.5869 0.286
NP_442066.2_4 Forward -105 -86 -3.44213 0.218
NP_442066.2_9 Reverse -169 -182 12.409 0.154
NP_442962.1_5 Reverse -188 -207 5.01433 0.244
NP_441308.1_8 Reverse -171 -181 12.4681 0.218
NP_441308.1_8 Forward -107 -97 11.6814 0.22
NP_441308.1_8 Reverse -280 -290 10.4031 0.22
NP_441458.1_10 Forward -218 -199 2.94938 0.26
NP_442183.1_1 Forward -182 -168 9.93102 0.0903
NP_442183.1_1 Reverse -241 -255 3.8345 0.295
NP_442397.1_9 Reverse -83 -102 12.2908 0.226
NP_442135.1_8 Forward -116 -98 11.5239 0.207
NP_441549.1_9 Forward -186 -168 10.6389 0.0392
NP_441549.1_9 Reverse -169 -187 -5.58572 0.198
NP_442347.1_2 Reverse -174 -183 12.4878 0.056
NP_442347.1_2 Reverse -283 -292 4.71961 0.266
NP_442347.1_2 Forward -181 -172 3.34298 0.284
NP_442645.1_2 Forward -190 -171 -11.9969 0.144
NP_442645.1_2 Reverse -81 -100 -15.6352 0.206
NP_442645.1_2 Forward -113 -94 -15.7335 0.209
NP_441037.1_4 Reverse -171 -181 16.5761 0.0168
NP_441633.1_3 Forward -184 -171 13.0973 0.018
NP_440136.1_2 Forward -181 -174 15.9687 0.0123
NP_440136.1_2 Reverse -174 -181 15.9687 0.0123
NP_440136.1_2 Forward -104 -97 6.23397 0.171
NP_440136.1_2 Reverse -97 -104 6.13563 0.193
NP_442590.1_10 Reverse -96 -115 6.29264 0.246
NP_442998.1_5 Forward -205 -195 11.7798 0.176
NP_442998.1_10 Forward -180 -173 15.5754 0.0102
NP_442998.1_10 Reverse -175 -182 15.5754 0.0102
NP_442998.1_10 Reverse -98 -105 15.5754 0.0102
NP_440731.1_2 Forward -110 -91 8.16093 0.275
NP_440299.1_1 Forward -186 -173 14.1783 0.0259
NP_441799.1_1 Reverse -169 -183 17.5018 0.011
NP_441799.1_1 Forward -186 -172 17.3052 0.011
NP_441799.1_1 Reverse -92 -106 4.22722 0.261
NP_441007.1_10 Reverse -168 -181 20.6688 0.0139
NP_442201.1_10 Reverse -162 -181 -14.4552 0.282
NP_442333.2_5 Reverse -85 -104 -14.9469 0.286
NP_440256.1_1 Reverse -93 -112 0.786102 0.0805
NP_440256.1_1 Forward -185 -166 -0.983855 0.0988
NP_440256.1_1 Forward -108 -89 -4.32711 0.152
NP_441512.1_4 Forward -109 -90 13.3725 0.19
NP_441559.1_8 Forward -187 -173 10.226 0.0596
NP_440915.1_6 Forward -186 -172 9.14437 0.0457
NP_440915.1_6 Reverse -92 -106 3.63784 0.101
NP_440915.1_6 Forward -109 -95 0.0979218 0.176
NP_440717.1_1 Forward -181 -162 5.89931 0.267
NP_442785.1_7 Reverse -171 -185 12.291 0.228
NP_440749.1_4 Forward -222 -204 15.1613 0.119
NP_442866.1_1 Forward -110 -91 -9.44032 0.293
NP_441939.1_3 Reverse -174 -193 4.916 0.298
NP_441494.1_6 Reverse -168 -181 15.5556 0.128
NP_442386.1_9 Forward -183 -174 13.8639 0.0289
NP_442386.1_9 Reverse -172 -181 6.39082 0.219
NP_442386.1_9 Forward -112 -103 5.40752 0.253
NP_441340.1_5 Forward -181 -174 15.6737 0.0124
NP_441340.1_5 Reverse -174 -181 15.6737 0.0124
NP_441340.1_5 Forward -104 -97 13.5105 0.0314
NP_441340.1_5 Reverse -97 -104 5.84064 0.208
NP_441271.1_8 Reverse -202 -212 18.0729 0.145
NP_442240.1_2 Forward -181 -162 -15.3402 0.209
NP_440586.1_8 Forward -181 -174 13.2151 0.026
NP_440586.1_8 Reverse -174 -181 13.2151 0.026
NP_440586.1_8 Reverse -97 -104 9.47853 0.146
NP_440586.1_8 Forward -104 -97 5.74197 0.283
NP_442251.1_6 Forward -181 -174 15.2804 0.0124
NP_442251.1_6 Reverse -174 -181 15.2804 0.0124
NP_440192.1_4 Reverse -171 -190 12.2112 0.184
NP_441262.1_3 Reverse -173 -180 14.7888 0.0223
NP_441262.1_3 Forward -182 -175 14.7888 0.0223
NP_441262.1_3 Forward -105 -98 14.7888 0.0223
NP_443051.1_1 Reverse -172 -181 19.5676 0.00335
NP_443051.1_1 Forward -106 -97 16.6177 0.00754
NP_443051.1_1 Forward -183 -174 10.4228 0.00754
NP_443051.1_1 Reverse -95 -104 -1.08191 0.281
NP_439937.1_9 Forward -183 -166 -4.68172 0.157
NP_439937.1_9 Reverse -172 -189 -4.97671 0.157
NP_439937.1_9 Forward -171 -154 -16.383 0.287
NP_440408.1_7 Reverse -230 -249 7.66927 0.284
NP_440439.1_1 Reverse -170 -183 12.6056 0.0238
NP_440439.1_1 Forward -185 -172 11.1307 0.0339
NP_440439.1_1 Forward -108 -95 9.45906 0.0462
NP_442239.1_8 Reverse -157 -176 5.60432 0.269
NP_439943.1_1 Reverse -71 -90 -11.8003 0.292
NP_440372.1_2 Forward -181 -174 16.3621 0.0124
NP_440372.1_2 Reverse -174 -181 16.3621 0.0124
NP_440372.1_2 Forward -104 -97 13.8055 0.0214
NP_440372.1_2 Reverse -97 -104 6.52896 0.188
NP_440372.1_3 Reverse -188 -202 13.7625 0.233
NP_442783.1_8 Reverse -153 -172 19.4681 0.0719
NP_441803.1_2 Forward -110 -91 -0.688862 0.284
NP_439977.1_5 Forward -188 -169 -1.7705 0.26
NP_440139.1_1 Forward -111 -92 5.89851 0.151
NP_441572.1_7 Reverse -167 -186 15.2408 0.026
NP_441572.1_7 Reverse -207 -226 -3.14714 0.207
NP_441572.1_7 Forward -104 -85 -4.91709 0.245
NP_441572.1_7 Reverse -90 -109 -5.11376 0.25
NP_442384.1_10 Reverse -173 -186 21.4554 0.00194
NP_442384.1_10 Forward -182 -169 9.06573 0.0574
NP_442384.1_10 Reverse -96 -109 3.46087 0.19
NP_442384.1_10 Reverse -282 -295 1.69091 0.249
NP_442262.1_10 Forward -181 -174 14.1988 0.0123
NP_442262.1_10 Reverse -174 -181 14.1988 0.0123
NP_442262.1_10 Reverse -97 -104 13.2155 0.0213
NP_441689.1_5 Forward -107 -97 15.3192 0.0403
NP_441689.1_5 Reverse -171 -181 8.43603 0.132
NP_441689.1_5 Forward -184 -174 5.78111 0.197
NP_440344.1_10 Reverse -166 -183 -7.13932 0.115
NP_440344.1_10 Forward -177 -160 -13.6292 0.29
NP_440282.1_10 Reverse -163 -182 -5.80207 0.25
NP_440531.1_6 Reverse -165 -184 1.47442 0.176
NP_440189.1_2 Reverse -88 -107 6.09597 0.25
NP_441335.1_8 Forward -160 -141 6.58763 0.281
NP_442832.1_3 Reverse -89 -108 11.9958 0.288
NP_441965.1_3 Forward -192 -173 3.6377 0.181
NP_441965.1_10 Reverse -170 -186 8.80999 0.123
NP_441965.1_10 Forward -185 -169 5.86006 0.196
NP_440297.1_9 Reverse -174 -184 -0.118297 0.282
NP_440297.1_9 Forward -181 -171 -0.314959 0.282
NP_440297.1_9 Reverse -97 -107 -0.609952 0.292
NP_442280.1_10 Forward -219 -201 8.37644 0.258
NP_441592.1_4 Forward -98 -79 5.40766 0.135
NP_441592.1_4 Forward -186 -167 4.52268 0.148
NP_441592.1_4 Reverse -173 -192 -1.18052 0.251
NP_441896.1_3 Forward -191 -172 -1.96717 0.272
NP_443036.1_3 Forward -162 -145 12.6252 0.299
NP_440999.1_9 Reverse -169 -183 8.94771 0.0698
NP_440999.1_9 Forward -186 -172 -2.95034 0.281
NP_440888.1_2 Reverse -173 -187 17.3052 0.00418
NP_440888.1_2 Forward -182 -168 16.0269 0.00832
NP_440888.1_2 Reverse -96 -110 12.487 0.0442
NP_440888.1_2 Reverse -102 -116 6.0955 0.249
NP_442277.1_2 Forward -247 -233 10.4227 0.287
NP_442277.1_4 Reverse -87 -106 5.60352 0.175
NP_442033.1_10 Reverse -171 -190 -7.17871 0.186
NP_440575.1_8 Forward -326 -307 -1.27885 0.222
NP_441543.1_2 Reverse -174 -183 16.9127 0.00359
NP_441543.1_2 Forward -181 -172 15.9293 0.00518
NP_441543.1_2 Reverse -97 -106 6.09625 0.153
NP_442845.1_2 Reverse -167 -181 13.9626 0.088
NP_442845.1_2 Forward -111 -97 8.16106 0.195
NP_442845.1_2 Forward -188 -174 5.40779 0.233
NP_441304.1_10 Reverse -311 -320 16.6177 0.164
NP_441551.1_5 Forward -186 -170 15.2008 0.0915
NP_441319.1_8 Forward -188 -170 12.5072 0.13
NP_441319.1_8 Forward -297 -279 8.37728 0.233
NP_441469.1_8 Reverse -172 -181 6.5879 0.227
NP_441469.1_8 Forward -183 -174 6.48957 0.227
NP_441548.1_2 Reverse -79 -98 12.9791 0.257
NP_442315.1_1 Reverse -162 -180 7.19731 0.251
NP_443064.1_6 Reverse -173 -183 12.5669 0.0796
NP_443064.1_6 Forward -182 -172 10.8217 0.13
NP_443064.1_6 Forward -105 -95 9.07643 0.247
NP_442337.1_8 Forward -193 -174 0.491109 0.251
NP_442578.1_7 Forward -181 -174 14.5921 0.026
NP_442578.1_7 Reverse -174 -181 14.5921 0.026
NP_442578.1_7 Forward -104 -97 6.0373 0.18
NP_440710.1_4 Forward -206 -192 13.7625 0.242
NP_441462.1_2 Forward -182 -172 20.2362 0.000805
NP_441462.1_2 Forward -105 -95 17.3846 0.00406
NP_441462.1_2 Reverse -173 -183 11.5831 0.00406
NP_441462.1_2 Reverse -96 -106 0.668351 0.135
NP_441621.1_4 Forward -320 -307 13.294 0.267
NP_441621.1_7 Forward -184 -170 -5.31028 0.25
NP_443062.1_1 Forward -182 -164 6.69328 0.194
NP_443062.1_1 Reverse -96 -114 4.15809 0.272
NP_443062.1_6 Forward -190 -171 9.53756 0.125
NP_443062.1_6 Forward -331 -312 2.16274 0.26
NP_441410.1_3 Forward -114 -95 10.9142 0.185
NP_442204.1_1 Reverse -169 -180 0.353664 0.281
NP_442204.1_1 Forward -109 -98 0.157002 0.283
NP_442204.1_1 Forward -186 -175 0.0586712 0.284
NP_442204.1_5 Reverse -203 -222 8.55425 0.115
NP_440516.1_2 Forward -188 -170 -1.55415 0.287
NP_440516.1_8 Forward -182 -173 16.9127 0.00442
NP_440516.1_8 Reverse -173 -182 16.9127 0.00442
NP_440516.1_8 Forward -105 -96 9.4395 0.0183
NP_440516.1_8 Reverse -96 -105 5.11294 0.118
NP_442428.1_5 Forward -181 -174 15.8704 0.0124
NP_442428.1_5 Reverse -174 -181 15.8704 0.0124
NP_442428.1_5 Forward -104 -97 6.13563 0.209
NP_442428.1_5 Reverse -97 -104 6.0373 0.212
NP_441267.1_1 Forward -188 -169 7.37428 0.196
NP_442823.1_8 Reverse -213 -232 9.93088 0.299
NP_440673.1_3 Forward -180 -173 12.4288 0.0426
NP_440673.1_3 Reverse -175 -182 12.4288 0.0426
NP_440673.1_3 Reverse -98 -105 12.4288 0.0426
NP_441052.1_2 Reverse -173 -183 19.9412 0.00106
NP_441052.1_2 Forward -182 -172 10.4031 0.0285
NP_441052.1_2 Forward -98 -88 1.74999 0.229
NP_442219.1_8 Reverse -53 -72 7.39404 0.267
NP_442219.1_9 Reverse -174 -183 17.7976 0.00718
NP_442219.1_9 Forward -181 -172 8.25953 0.0681
NP_440436.1_4 Reverse -174 -183 17.2072 0.00233
NP_440436.1_4 Forward -181 -172 9.24241 0.0871
NP_440436.1_4 Forward -104 -95 5.11253 0.222
NP_441884.1_9 Forward -185 -166 -23.6 0.284
NP_442086.1_3 Reverse -174 -193 15.9291 0.0704
NP_440314.1_9 Forward -181 -162 -5.40875 0.223
NP_439982.1_7 Reverse -132 -151 17.3057 0.0576
NP_441719.1_4 Forward -181 -174 16.3621 0.0124
NP_441719.1_4 Reverse -174 -181 16.3621 0.0124
NP_441719.1_4 Forward -104 -97 6.82395 0.0855
NP_441719.1_4 Reverse -97 -104 6.52896 0.188
NP_441733.1_10 Forward -108 -95 6.31247 0.192
NP_441004.1_1 Reverse -124 -143 -17.7985 0.294
NP_441004.1_2 Forward -159 -140 -2.75381 0.265
NP_442813.1_4 Reverse -106 -125 -5.01543 0.299
NP_442366.1_3 Forward -106 -88 5.13236 0.0891
NP_441115.1_4 Forward -183 -165 12.6047 0.0997
NP_441115.1_4 Reverse -172 -190 10.4414 0.179
NP_441115.1_4 Forward -106 -88 9.06482 0.227
NP_442694.1_9 Reverse -284 -303 8.06259 0.277
NP_442206.1_4 Forward -181 -162 8.55425 0.259
NP_440328.1_4 Forward -188 -169 0.196116 0.258
NP_443054.1_2 Forward -184 -170 0.687908 0.256
NP_441851.1_10 Forward -183 -173 15.8113 0.00552
NP_441851.1_10 Reverse -172 -182 8.53483 0.114
NP_442011.1_1 Forward -183 -164 6.39097 0.186
NP_441668.1_5 Forward -160 -141 7.17762 0.277
NP_442515.1_1 Forward -183 -169 13.5693 0.0278
NP_442515.1_1 Reverse -172 -186 0.392915 0.193
NP_442515.1_1 Forward -311 -297 -0.590395 0.228
NP_441349.1_10 Forward -192 -173 2.75272 0.0731
NP_441349.1_10 Reverse -163 -182 -6.78538 0.236
NP_441409.1_6 Reverse -167 -186 -8.35868 0.167
NP_441409.1_6 Forward -188 -169 -9.44032 0.184
NP_440389.1_5 Reverse -166 -185 15.4039 0.195
NP_440432.1_9 Forward -181 -166 -3.06836 0.179
NP_440474.1_8 Forward -181 -167 11.602 0.103
NP_440431.1_3 Reverse -280 -299 -5.01543 0.18
NP_440588.1_2 Forward -191 -172 -3.3438 0.185
NP_440588.1_2 Forward -231 -212 -6.29373 0.276
NP_440195.1_4 Forward -117 -98 6.58763 0.27
NP_440195.1_5 Reverse -167 -186 0.196116 0.3
NP_442243.1_1 Forward -86 -68 1.5917 0.21
NP_441570.1_1 Forward -182 -164 -17.2871 0.269
NP_441078.1_4 Forward -182 -173 19.6659 0.0007
NP_441078.1_4 Reverse -173 -182 19.6659 0.0007
NP_441078.1_4 Reverse -96 -105 0.0980582 0.205
NP_441078.1_4 Forward -105 -96 0.0980582 0.205
NP_442443.1_1 Reverse -153 -172 -5.50708 0.282
NP_440526.1_3 Forward -181 -170 2.31981 0.267
NP_440526.1_3 Reverse -174 -185 0.943182 0.267
NP_441432.1_8 Reverse -172 -181 16.8143 0.00595
NP_441432.1_8 Forward -183 -174 16.8143 0.00595
NP_441432.1_8 Forward -106 -97 14.0611 0.0258
NP_441432.1_8 Forward -388 -379 2.75299 0.287
NP_442320.1_8 Reverse -167 -181 -2.16369 0.0867
NP_441732.1_2 Reverse -169 -185 3.00846 0.0141
NP_441732.1_2 Forward -186 -170 -6.33298 0.0495
NP_442274.1_8 Forward -172 -154 14.1424 0.286
NP_440199.1_10 Forward -108 -98 14.238 0.0861
NP_441057.1_3 Reverse -74 -93 -11.5053 0.236
NP_442353.1_4 Forward -316 -297 0.293673 0.276
NP_441072.1_2 Forward -109 -90 5.30933 0.3
NP_440713.1_4 Forward -192 -173 3.34271 0.246
NP_440713.1_4 Forward -115 -96 0.982764 0.298
NP_442489.1_7 Forward -182 -173 20.1576 0.000695
NP_442489.1_7 Reverse -173 -182 20.1576 0.000695
NP_442489.1_7 Reverse -96 -105 0.786375 0.152
NP_442489.1_7 Forward -105 -96 0.589713 0.17
NP_442079.1_7 Forward -181 -162 3.83436 0.207
NP_440559.1_1 Reverse -174 -183 17.4043 0.00658
NP_440559.1_1 Forward -104 -95 14.651 0.0144
NP_440559.1_1 Forward -181 -172 8.65285 0.0586
NP_441659.2_8 Forward -182 -172 20.9245 0.000805
NP_441659.2_8 Reverse -173 -183 18.1713 0.00133
NP_441659.2_8 Reverse -96 -106 15.5163 0.006
NP_441659.2_8 Forward -105 -95 0.176696 0.271
NP_440860.1_7 Reverse -189 -208 17.3057 0.227
NP_441022.1_1 Reverse -66 -75 11.2584 0.284
NP_442913.1_10 Reverse -164 -183 6.4893 0.06
NP_441040.1_2 Reverse -74 -93 -15.1435 0.286
NP_442346.1_5 Forward -183 -173 16.6963 0.00248
NP_442346.1_5 Reverse -172 -182 16.303 0.00248
NP_442346.1_5 Forward -106 -96 6.66654 0.195
NP_442346.1_5 Reverse -95 -105 5.97822 0.219
NP_440545.1_3 Forward -186 -169 16.8534 0.0111
NP_440545.1_3 Reverse -169 -186 7.80699 0.0482
NP_441856.1_3 Forward -185 -166 8.65258 0.101
NP_440831.1_9 Reverse -163 -182 12.5858 0.296
NP_440459.1_2 Forward -107 -90 9.08529 0.239
NP_441943.1_8 Forward -88 -69 -6.09707 0.261
NP_442603.1_7 Reverse -173 -187 10.9137 0.125
NP_442603.1_7 Forward -182 -168 9.93039 0.137
NP_440449.1_6 Reverse -88 -106 13.7998 0.103
NP_440449.1_6 Reverse -165 -183 11.4655 0.131
NP_440449.1_6 Reverse -205 -223 7.47773 0.222
NP_441502.1_3 Forward -184 -165 7.07928 0.248
NP_441833.1_4 Forward -181 -174 15.9687 0.0124
NP_441833.1_4 Reverse -174 -181 15.9687 0.0124
NP_441833.1_4 Reverse -97 -104 6.52896 0.0924
NP_441833.1_4 Forward -104 -97 6.23397 0.163
NP_442162.1_9 Forward -181 -174 16.2637 0.0124
NP_442162.1_9 Reverse -174 -181 16.2637 0.0124
NP_442162.1_9 Forward -104 -97 12.9205 0.0282
NP_442162.1_9 Reverse -97 -104 12.9205 0.0282
NP_440671.1_4 Forward -111 -97 14.2576 0.0654
NP_440224.1_1 Reverse -162 -181 2.55606 0.132
NP_440224.1_1 Forward -193 -174 -0.4922 0.143
NP_442199.1_5 Reverse -165 -184 -5.60541 0.251
NP_442140.1_3 Reverse -174 -184 10.3048 0.0902
NP_442140.1_3 Forward -181 -171 7.94484 0.124
NP_442140.1_3 Forward -104 -94 4.0116 0.265
NP_440875.1_9 Forward -180 -170 14.5042 0.0411
NP_440875.1_9 Reverse -98 -108 7.59334 0.255
NP_442547.1_7 Reverse -120 -139 12.2664 0.231
NP_441813.1_3 Forward -172 -153 15.9825 0.238
NP_441813.1_5 Forward -184 -174 18.1713 0.00743
NP_441813.1_5 Reverse -171 -181 8.73149 0.0367
NP_441813.1_5 Forward -107 -97 6.17489 0.1
NP_441813.1_5 Reverse -94 -104 4.89658 0.143
NP_440594.1_8 Reverse -174 -187 11.9167 0.152
NP_440594.1_8 Forward -181 -168 8.77016 0.213
NP_440590.1_4 Reverse -174 -187 13.4906 0.013
NP_440590.1_4 Forward -181 -168 3.26421 0.0749
NP_440590.1_4 Forward -104 -91 0.60927 0.148
NP_440567.1_1 Forward -181 -167 18.9775 0.0136
NP_440567.1_1 Reverse -174 -188 4.81781 0.111
NP_440567.1_1 Forward -104 -90 2.5562 0.17
NP_440567.1_1 Reverse -97 -111 -0.197071 0.27
NP_442497.1_10 Forward -181 -172 17.601 0.00813
NP_442497.1_10 Reverse -174 -183 10.4228 0.0087
NP_442497.1_10 Forward -104 -95 8.25953 0.047
NP_442497.1_10 Reverse -97 -106 7.76787 0.0731
NP_440821.1_4 Reverse -171 -181 10.7964 0.0146
NP_440821.1_4 Forward -184 -174 9.41981 0.0286
NP_440821.1_4 Forward -107 -97 1.35667 0.137
NP_441239.1_9 Reverse -171 -183 14.887 0.0247
NP_441239.1_9 Reverse -94 -106 7.90546 0.147
NP_441239.1_9 Forward -184 -172 5.25052 0.223
NP_441727.1_3 Reverse -166 -185 6.19431 0.245
NP_441892.1_1 Reverse -87 -104 -6.15601 0.298
NP_442044.1_1 Reverse -168 -187 -13.8652 0.28
NP_441508.1_4 Forward -93 -79 14.5264 0.277
NP_440354.1_5 Forward -185 -166 10.5209 0.174
NP_440354.1_5 Forward -242 -223 8.35759 0.174
NP_440354.1_7 Forward -145 -127 5.72234 0.297
NP_440546.1_4 Forward -105 -95 15.4756 0.0459
NP_440546.1_4 Forward -182 -172 13.5365 0.0459
NP_440546.1_4 Reverse -96 -106 11.6943 0.0748
NP_440546.1_4 Reverse -173 -183 10.046 0.109
NP_440462.1_6 Reverse -171 -181 19.4496 0.00371
NP_440462.1_6 Forward -184 -174 9.61647 0.0429
NP_440462.1_6 Forward -107 -97 7.35486 0.0803
NP_440868.1_4 Reverse -169 -181 19.0169 0.0123
NP_440868.1_4 Forward -186 -174 17.6402 0.0124
NP_440868.1_4 Forward -109 -97 3.67722 0.134
NP_442499.1_4 Forward -211 -197 14.0609 0.226
NP_442402.1_4 Reverse -165 -184 -9.53937 0.291
NP_441848.1_4 Forward -210 -194 7.64616 0.288
NP_441084.1_6 Reverse -171 -185 9.53803 0.278
NP_442039.1_4 Forward -181 -174 15.1821 0.0124
NP_442039.1_4 Reverse -174 -181 15.1821 0.0124
NP_442039.1_4 Forward -104 -97 11.6422 0.0747
NP_442837.1_3 Forward -181 -174 15.7721 0.0124
NP_442837.1_3 Reverse -174 -181 15.7721 0.0124
NP_442837.1_3 Forward -104 -97 6.0373 0.25
NP_442837.1_3 Reverse -97 -104 6.0373 0.25
NP_440160.1_9 Forward -105 -86 10.6192 0.231
NP_439994.1_3 Reverse -172 -191 10.0969 0.222
NP_442053.1_1 Forward -182 -173 18.3876 0.0007
NP_442053.1_1 Reverse -173 -182 18.3876 0.0007
NP_442053.1_1 Reverse -96 -105 7.17789 0.104
NP_440505.1_3 Forward -184 -174 18.3679 0.00213
NP_440505.1_3 Reverse -171 -181 15.418 0.0114
NP_440505.1_3 Forward -107 -97 13.5497 0.0297
NP_441959.1_8 Forward -14 -1 15.6505 0.201
NP_442532.1_1 Reverse -186 -200 14.0007 0.215
NP_442532.1_1 Forward -308 -294 8.65595 0.295
NP_442532.1_7 Forward -182 -168 5.01447 0.171
NP_440914.1_1 Reverse -173 -183 17.5935 0.000537
NP_440914.1_1 Forward -182 -172 16.3248 0.00196
NP_440914.1_1 Reverse -96 -106 13.1043 0.0386
NP_441011.1_8 Forward -181 -172 16.6177 0.00602
NP_441011.1_8 Forward -104 -95 12.0944 0.0517
NP_441011.1_8 Reverse -174 -183 8.25953 0.144
NP_441011.1_8 Reverse -97 -106 6.78456 0.184
NP_442533.1_6 Forward -182 -173 17.2076 0.00137
NP_442533.1_6 Reverse -173 -182 17.2076 0.00137
NP_442533.1_6 Forward -105 -96 5.40793 0.14
NP_442533.1_6 Reverse -96 -105 4.52295 0.179
NP_442533.1_6 Reverse -89 -98 4.12963 0.191
NP_442229.1_1 Reverse -87 -101 5.70218 0.255
NP_441482.1_7 Forward -111 -97 -1.67204 0.0787
NP_439944.1_9 Forward -181 -171 17.7779 0.00341
NP_439944.1_9 Reverse -174 -184 10.5014 0.0887
NP_439944.1_9 Reverse -97 -107 7.84651 0.127
NP_441028.1_6 Reverse -72 -82 4.7978 0.277
NP_440115.1_6 Reverse -170 -180 16.008 0.0325
NP_440115.1_6 Forward -185 -175 15.0247 0.0505
NP_440007.1_9 Reverse -80 -94 0.88457 0.29
NP_442492.1_2 Forward -105 -86 0.58944 0.241
NP_441602.1_3 Forward -187 -168 -0.0988766 0.219
NP_441972.1_5 Forward -181 -162 5.30933 0.0933
NP_441106.1_1 Reverse -172 -181 18.486 0.0028
NP_441106.1_1 Forward -183 -174 9.63616 0.0311
NP_441106.1_1 Forward -106 -97 8.75118 0.0469
NP_442306.1_10 Forward -187 -168 -10.3253 0.11
NP_441286.1_1 Forward -183 -171 14.6903 0.00418
NP_441286.1_1 Reverse -172 -184 3.48056 0.0467
NP_440670.1_8 Forward -182 -173 18.3876 0.000699
NP_440670.1_8 Reverse -173 -182 18.3876 0.000699
NP_440670.1_8 Forward -105 -96 8.65285 0.0627
NP_440670.1_8 Reverse -96 -105 6.29291 0.124
NP_440886.1_7 Reverse -172 -182 8.04271 0.0805
NP_440886.1_7 Forward -183 -173 7.94438 0.0805
NP_440828.1_1 Forward -180 -161 4.81688 0.207
NP_441001.1_10 Reverse -108 -127 7.17762 0.249
NP_442614.1_2 Reverse -173 -187 14.4542 0.0984
NP_442614.1_2 Forward -182 -168 7.57108 0.271
NP_442072.1_9 Forward -183 -165 -11.0923 0.0789
NP_442072.1_9 Reverse -95 -113 -13.9439 0.126
NP_442072.1_9 Reverse -172 -190 -20.7287 0.204
NP_442072.1_9 Forward -106 -88 -23.0886 0.277
NP_441403.1_4 Forward -242 -224 5.72234 0.293
NP_440907.2_8 Forward -181 -171 19.1541 0.00362
NP_440907.2_8 Reverse -97 -107 7.74772 0.117
NP_440907.2_8 Forward -104 -94 3.8145 0.297
NP_442264.1_5 Reverse -83 -97 12.4876 0.253
NP_441021.1_1 Forward -285 -266 -12.1936 0.281
NP_441463.1_3 Reverse -163 -182 -1.27885 0.138
NP_441463.1_3 Reverse -53 -72 -9.047 0.276
NP_441463.1_7 Forward -213 -194 13.4708 0.285
NP_441626.1_2 Forward -181 -174 15.7721 0.0124
NP_441626.1_2 Reverse -174 -181 15.7721 0.0124
NP_441626.1_2 Forward -104 -97 12.2322 0.0511
NP_441626.1_2 Reverse -97 -104 5.93897 0.231
NP_441626.1_5 Forward -151 -132 11.9958 0.254
NP_441901.1_1 Reverse -80 -99 12.8808 0.11
NP_442365.1_7 Reverse -169 -188 -4.13045 0.235
NP_442365.1_7 Forward -186 -167 -6.68705 0.299
NP_442238.1_7 Reverse -12 -31 10.1267 0.208
NP_442615.1_1 Reverse -164 -182 14.9655 0.00922
NP_442615.1_1 Reverse -87 -105 0.904127 0.0943
NP_442615.1_1 Forward -114 -96 -2.53746 0.145
NP_442615.1_1 Forward -191 -173 -3.6191 0.165
NP_440387.1_1 Forward -182 -166 -1.61309 0.143
NP_440387.1_1 Reverse -173 -189 -2.00642 0.145
NP_440387.1_1 Forward -310 -294 -2.49807 0.148
NP_441431.1_2 Forward -185 -171 6.88214 0.257
NP_441431.1_2 Reverse -170 -184 6.88214 0.257
NP_441488.1_7 Reverse -167 -186 0.884433 0.296
NP_441836.1_2 Forward -188 -169 3.6377 0.151
NP_441836.1_2 Reverse -167 -186 -3.14714 0.234
NP_440634.1_6 Forward -93 -79 19.7641 0.0601
NP_441174.1_2 Forward -185 -171 13.5693 0.196
NP_440358.1_8 Reverse -189 -208 -0.688862 0.272
NP_440814.1_4 Forward -114 -95 -11.6036 0.228
NP_440114.1_10 Forward -182 -168 16.2242 0.0194
NP_440114.1_10 Reverse -96 -110 15.8309 0.0226
NP_440114.1_10 Forward -105 -91 6.09611 0.285
NP_442437.1_8 Reverse -162 -181 8.16093 0.242
NP_442698.1_10 Forward -136 -117 0.196116 0.297
NP_441500.1_7 Reverse -313 -326 19.7968 0.134
NP_440293.1_3 Forward -135 -116 -5.50708 0.279
NP_440766.1_4 Forward -109 -95 8.35772 0.0871
NP_442743.1_1 Reverse -215 -234 6.48849 0.268
NP_442930.1_1 Forward -302 -292 11.3859 0.259
NP_439910.1_2 Forward -190 -173 -12.6459 0.0924
NP_440457.1_1 Forward -109 -97 11.937 0.092
NP_440457.1_1 Forward -186 -174 10.7571 0.092
NP_440457.1_1 Reverse -169 -181 0.23564 0.25
NP_440798.1_6 Forward -181 -168 11.524 0.0592
NP_442509.1_9 Reverse -173 -183 8.14104 0.192
NP_442509.1_9 Forward -182 -172 8.04271 0.192
NP_440524.1_2 Forward -315 -296 -4.42544 0.276
YP_003858595.1_1 Reverse -143 -162 8.25926 0.192
NP_442587.1_10 Reverse -298 -317 20.4405 0.258
NP_442936.1_10 Reverse -291 -305 7.25408 0.288
NP_440554.1_4 Forward -181 -171 15.418 0.0199
NP_440554.1_4 Reverse -97 -107 13.1564 0.0271
NP_440554.1_4 Reverse -174 -184 8.92815 0.0646
NP_441885.1_5 Reverse -173 -183 20.9245 0.000538
NP_441885.1_5 Forward -182 -172 11.3864 0.00668
NP_441885.1_5 Forward -105 -95 7.84651 0.0419
NP_440478.1_10 Reverse -171 -185 10.1277 0.208
NP_442341.1_7 Forward -183 -169 8.65272 0.0858
NP_442341.1_9 Forward -107 -93 8.75042 0.166
NP_442395.2_4 Forward -171 -152 2.55527 0.221
NP_440191.1_6 Forward -17 -3 13.285 0.294
NP_443000.1_7 Forward -184 -174 19.9412 0.00223
NP_443000.1_7 Reverse -171 -181 10.7964 0.0345
NP_443000.1_7 Forward -107 -97 7.74818 0.0666
NP_441842.1_1 Forward -180 -167 20.1765 0.0111
NP_441842.1_1 Reverse -175 -188 19.7832 0.0111
NP_441842.1_10 Reverse -166 -180 18.2892 0.0173
NP_441842.1_10 Forward -112 -98 8.55439 0.218
NP_440275.1_3 Reverse -171 -181 18.6629 0.0082
NP_440275.1_3 Forward -184 -174 15.123 0.0182
NP_440275.1_3 Forward -107 -97 6.56821 0.101
NP_442932.1_9 Forward -135 -116 4.12936 0.285
NP_440091.1_1 Forward -186 -174 8.29878 0.0653
NP_440091.1_1 Forward -109 -97 1.12062 0.212
NP_440091.1_1 Reverse -169 -181 0.825626 0.227
NP_443060.1_5 Reverse -370 -389 13.6666 0.109
NP_442354.1_7 Forward -313 -294 5.50599 0.26
NP_443010.1_10 Reverse -170 -187 21.4211 0.0127
NP_441359.1_5 Forward -185 -166 6.68596 0.188
NP_441122.1_1 Reverse -85 -100 11.288 0.216
NP_441207.1_7 Forward -203 -189 12.6438 0.241
NP_441105.1_3 Forward -116 -97 -0.4922 0.137
NP_441105.1_3 Reverse -162 -181 -4.52377 0.201
NP_441105.1_3 Reverse -150 -169 -6.39206 0.234
NP_441105.1_3 Reverse -85 -104 -9.34199 0.288
NP_440216.1_1 Reverse -173 -187 9.63603 0.00589
NP_440216.1_1 Forward -182 -168 8.25939 0.0061
NP_440216.1_1 Reverse -96 -110 -4.7203 0.114
NP_440216.1_1 Forward -105 -91 -11.2101 0.169
NP_440216.1_9 Forward -208 -199 8.65285 0.286
NP_440216.1_9 Forward -126 -117 8.45619 0.286
NP_440216.1_9 Forward -207 -198 7.27622 0.286
NP_440216.1_9 Forward -96 -87 7.27622 0.286
NP_440172.1_1 Forward -182 -172 17.5813 0.00421
NP_440172.1_1 Reverse -173 -183 15.0247 0.00945
NP_440172.1_1 Forward -105 -95 8.82982 0.0586
NP_440172.1_1 Reverse -96 -106 4.89658 0.162
NP_442371.1_1 Forward -206 -196 12.6642 0.245
NP_441844.1_4 Forward -89 -70 14.3549 0.274
NP_442015.1_10 Forward -186 -173 11.819 0.0372
NP_442015.1_10 Reverse -92 -105 2.67422 0.187
NP_441226.1_7 Forward -181 -174 14.4934 0.0123
NP_441226.1_7 Reverse -174 -181 14.4934 0.0123
NP_441226.1_7 Forward -104 -97 12.7234 0.0312
NP_441226.1_7 Reverse -97 -104 11.5435 0.0757
NP_442446.1_3 Reverse -161 -180 11.6025 0.271
NP_441111.1_7 Forward -181 -173 18.7023 0.00294
NP_441111.1_7 Reverse -174 -182 18.7023 0.00294
NP_441111.1_7 Reverse -97 -105 8.86921 0.0589
NP_442379.1_10 Forward -189 -172 -0.846137 0.223
NP_441766.1_2 Forward -182 -173 17.5026 0.00297
NP_441766.1_2 Reverse -173 -182 17.5026 0.00297
NP_441766.1_2 Forward -105 -96 8.1612 0.0645
NP_441766.1_2 Reverse -96 -105 5.89959 0.103
NP_440416.1_9 Forward -177 -158 -15.0452 0.184
NP_440416.1_9 Forward -112 -93 -17.7985 0.247
NP_443052.1_8 Reverse -163 -182 -8.06369 0.168
NP_442116.1_6 Forward -18 -1 5.59067 0.293
NP_440261.1_5 Forward -181 -168 16.1456 0.0132
NP_440261.1_5 Reverse -174 -187 3.26421 0.0649
NP_440988.1_10 Reverse -171 -185 7.7064 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATACCACAATTGGCAGTCAGTAAGGGCGACTAAATCCTGTTCTAGGGGACTATCAATTATGAATGCCTCTAGATTAATAATTGCCCCTGGCAATAAACAAAATTTCCGGGCATCAGATTCCAACTGTCCTTGACCAAGAATGTACAAGTCCGTTCCCTTGTCCCTATCTTTGGGCAGACTTTCACCCTTAGCCAGGGAAAATTCAATTAATTGGCTGGCGATCGCCTCCAGAATCTCCGGGGCAAGTTGGCCTAATTCCGTCCGTTGTCGGAGCCAGGAAAGCAAATAGGAAAGGCGATCGGTCATGGCAAAACCCCTGAGGAAAAACCTATGATCATACTAATCGATGCTGTAACATCTATCCTGAATTAAGTTCTGGGATATTTTTAATCTAAGTT

CDS

ATGAAATTGCCCTACGGAAACCAAGCTGATGTGAAGCAAATAACTGATAAACTACAGACCTATTCCCTTAACCTAAACCATCCTAATGGCAAACATAAAGCTAGACTTTTTCGAGCTAAATTGGGTATAACAATAGATAACCAAGACTTTCTTATTACTAGGCTCAGAAAAGTAGCCGCTCATTATCAAAATTTTGAATTGACAGATTCTGACCAGTACGGAGAACGTTATGTGGCTGTTTTTCCCATGACCACTACCACTGGAACAGCGAAAGTACTTAGTGCTTGGATAATCCGCCCCGGGGAGACCTATCCTCGACTAACCAATGTTTATCCCATTCGCAATTAG

Protein

MKLPYGNQADVKQITDKLQTYSLNLNHPNGKHKARLFRAKLGITIDNQDFLITRLRKVAAHYQNFELTDSDQYGERYVAVFPMTTTTGTAKVLSAWIIRPGETYPRLTNVYPIRN