Your browser is old and dusty. Try Google Chrome!

Details for sll1440

ORF sll1440
Accession NP_441623.1
Symbol pdxH
Category Pyridoxine
Definition pyridoxamine 5'-phosphate oxidase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_3 Reverse -41 -60 14.7483 0.224
NP_441453.1_1 Reverse -295 -313 8.3765 0.196
NP_441453.1_7 Reverse -77 -84 12.9205 0.23
NP_441623.1_1 Forward -84 -66 26.4702 0.00637
NP_441623.1_1 Forward -85 -67 -0.669169 0.237
NP_441623.1_2 Forward -211 -192 23.2047 0.0221
NP_441623.1_3 Forward -118 -99 27.1519 0.0000332
NP_441623.1_4 Forward -57 -39 22.6344 0.0813
NP_441623.1_5 Forward -187 -168 30.777 0.000248
NP_441623.1_6 Forward -267 -248 23.4022 0.0273
NP_441818.1_9 Forward -378 -359 0.58944 0.191
NP_441818.1_9 Reverse -200 -219 -10.522 0.295
NP_441630.1_3 Reverse -60 -79 12.6841 0.0624
NP_441630.1_3 Forward -167 -148 -0.0988766 0.285
NP_440996.1_5 Reverse -260 -269 14.4986 0.293
NP_441976.1_1 Forward -77 -58 16.6174 0.122
NP_442752.1_4 Reverse -92 -99 13.5105 0.0314
NP_443027.1_4 Forward -116 -106 12.8614 0.0624
NP_443027.1_4 Forward -38 -28 6.8632 0.262
NP_441812.1_3 Reverse -91 -105 11.2093 0.215
NP_440878.1_9 Forward -33 -14 -1.57384 0.245
NP_442062.1_8 Reverse -92 -102 6.96153 0.112
NP_441781.1_7 Forward -144 -125 0.786102 0.241
NP_441781.1_7 Forward -81 -62 -3.04881 0.294
NP_441035.1_3 Forward -81 -62 2.94938 0.227
NP_441035.1_3 Reverse -65 -84 0.0977854 0.272
NP_440307.1_2 Reverse -176 -195 0.786102 0.291
NP_441925.1_4 Reverse -354 -373 -14.7509 0.263
NP_442827.1_8 Forward -85 -66 -0.591301 0.231
NP_440645.1_8 Reverse -21 -40 13.9625 0.127
NP_440178.1_7 Reverse -128 -147 -20.8467 0.201
NP_440178.1_7 Forward -81 -62 -21.7317 0.237
NP_442570.1_3 Reverse -185 -204 -1.37718 0.212
NP_441716.1_2 Reverse -154 -173 3.73847 0.229
NP_441486.1_1 Reverse -89 -103 0.392915 0.138
NP_440842.1_2 Forward -213 -195 14.8671 0.187
NP_440057.1_4 Forward -208 -189 13.4039 0.253
NP_441014.1_8 Reverse -348 -367 -9.24366 0.293
NP_441014.1_8 Reverse -359 -378 -9.63698 0.299
NP_443018.1_3 Reverse -33 -40 8.49558 0.141
NP_441634.1_8 Forward -155 -141 -3.04867 0.295
NP_441857.1_6 Reverse -121 -131 16.598 0.197
NP_442687.1_7 Reverse -91 -101 4.79825 0.234
NP_440066.1_5 Reverse -16 -35 10.52 0.251
NP_442485.1_3 Forward -362 -343 0.0977854 0.247
NP_442485.1_3 Forward -188 -169 -3.93378 0.277
NP_441846.1_10 Forward -361 -342 -15.7335 0.256
NP_442198.1_3 Reverse -188 -207 2.94938 0.297
NP_442205.1_9 Forward -120 -104 4.48343 0.149
NP_439959.1_1 Forward -22 -5 21.475 0.158
NP_442937.1_5 Reverse -84 -103 7.27595 0.258
NP_440610.1_8 Forward -38 -19 11.3075 0.27
NP_440180.1_2 Forward -150 -131 19.764 0.205
NP_441127.1_1 Reverse -245 -259 7.57108 0.3
NP_442836.1_10 Reverse -121 -131 18.4663 0.154
NP_440203.1_5 Forward -135 -125 8.73102 0.288
NP_440203.1_5 Forward -328 -318 8.63269 0.29
NP_442911.1_2 Forward -148 -129 -5.50708 0.16
NP_443055.1_6 Forward -77 -59 -2.24319 0.291
NP_442002.1_9 Forward -312 -305 11.3472 0.185
NP_442431.1_10 Forward -25 -7 -0.177514 0.286
NP_441110.1_10 Reverse -169 -188 12.6841 0.219
NP_440147.1_4 Forward -305 -292 -0.472371 0.287
NP_441916.1_7 Forward -101 -91 6.17489 0.105
NP_441916.1_7 Reverse -105 -115 4.50326 0.174
NP_440983.1_5 Forward -98 -79 -2.36049 0.231
NP_440983.1_5 Reverse -129 -148 -6.58872 0.278
NP_440260.1_8 Reverse -184 -202 0.707465 0.196
NP_442281.1_1 Reverse -124 -138 5.30886 0.163
NP_001035871.2_7 Reverse -319 -329 11.7798 0.278
NP_441644.1_6 Reverse -294 -304 10.1076 0.0628
NP_441644.1_6 Reverse -310 -320 4.60114 0.233
NP_442215.1_2 Forward -140 -124 3.50012 0.0955
NP_442029.1_6 Reverse -123 -142 2.65439 0.291
NP_442029.1_10 Reverse -197 -216 6.39097 0.284
NP_442933.1_10 Reverse -105 -114 11.5045 0.042
NP_442933.1_10 Forward -101 -92 5.40793 0.19
NP_442933.1_10 Reverse -92 -101 4.32629 0.257
NP_441310.1_10 Forward -180 -170 16.6663 0.0807
NP_441762.1_7 Forward -102 -90 1.51394 0.0747
NP_442142.1_4 Forward -215 -202 4.14862 0.231
NP_441024.1_1 Forward -319 -305 16.7159 0.229
NP_440895.1_6 Reverse -267 -280 11.229 0.202
NP_441523.1_6 Reverse -67 -86 6.78429 0.209
NP_441448.1_2 Forward -96 -77 -1.77127 0.286
NP_440183.1_9 Reverse -288 -307 -16.0285 0.276
NP_440183.1_9 Forward -39 -20 -20.7484 0.292
NP_441015.1_10 Forward -375 -356 -4.32711 0.202
NP_441015.1_10 Forward -378 -359 -4.81876 0.212
NP_440265.1_8 Reverse -8 -26 14.7688 0.219
NP_441876.1_4 Reverse -155 -173 19.7828 0.147
NP_441876.1_9 Reverse -73 -83 11.3859 0.275
NP_441330.1_1 Forward -300 -281 -15.2418 0.27
NP_442490.1_9 Forward -398 -379 -6.58872 0.273
NP_441764.1_8 Reverse -161 -171 14.469 0.284
NP_442542.1_9 Forward -26 -12 5.30886 0.266
NP_440558.1_2 Reverse -23 -42 3.44104 0.156
NP_440923.1_10 Reverse -175 -194 13.4708 0.298
NP_442593.1_7 Forward -192 -173 17.0107 0.164
NP_441518.1_4 Reverse -6 -25 0.588665 0.299
NP_441557.1_5 Reverse -92 -101 -0.885252 0.26
NP_441445.1_1 Reverse -83 -102 0.982764 0.264
NP_442066.2_4 Reverse -135 -154 -5.40875 0.242
NP_442397.1_9 Forward -138 -119 7.96426 0.246
NP_442397.1_9 Forward -144 -125 1.96607 0.283
NP_442347.1_2 Forward -100 -91 4.52295 0.282
NP_442998.1_5 Forward -177 -167 12.7631 0.159
NP_442998.1_5 Forward -187 -177 9.32148 0.243
NP_442998.1_10 Forward -99 -92 5.84064 0.235
NP_440087.1_1 Reverse -83 -102 -9.44032 0.297
NP_441559.1_8 Forward -85 -71 -4.91696 0.241
NP_442756.1_2 Reverse -286 -305 3.04771 0.296
NP_441179.1_1 Forward -306 -287 1.27776 0.267
NP_442069.1_7 Forward -394 -375 15.5349 0.201
NP_441464.1_8 Forward -311 -297 5.60446 0.253
NP_440570.1_5 Forward -130 -111 -2.36049 0.278
NP_439976.1_5 Forward -172 -158 12.487 0.257
NP_440211.1_4 Reverse -388 -398 15.2213 0.23
NP_440586.1_8 Forward -113 -106 12.6251 0.0546
NP_442251.1_6 Forward -100 -93 10.4622 0.12
NP_440192.1_4 Reverse -11 -30 9.68867 0.268
NP_442959.1_4 Reverse -168 -187 15.1424 0.161
NP_440027.1_3 Forward -392 -374 5.52492 0.24
NP_439937.1_9 Forward -213 -196 -12.7448 0.276
NP_442239.1_8 Reverse -336 -355 5.40766 0.276
NP_440316.1_10 Forward -304 -294 9.41981 0.235
NP_440267.1_2 Forward -119 -105 9.04542 0.162
NP_442384.1_10 Forward -101 -88 2.18257 0.235
NP_441604.1_4 Reverse -75 -94 -4.13045 0.224
NP_441877.1_7 Forward -106 -87 1.08032 0.244
NP_442262.1_10 Reverse -33 -40 8.59391 0.22
NP_441689.1_4 Reverse -155 -174 11.5064 0.268
NP_441060.1_3 Forward -189 -170 12.1925 0.184
NP_440999.1_2 Reverse -57 -76 12.4875 0.191
NP_440600.1_4 Reverse -97 -115 -4.79907 0.269
NP_441543.1_2 Forward -113 -104 7.96454 0.107
NP_441543.1_2 Forward -100 -91 5.60459 0.189
NP_441469.1_8 Reverse -352 -361 5.40793 0.272
NP_442337.1_8 Forward -70 -51 -1.96717 0.293
NP_442578.1_7 Forward -113 -106 12.6255 0.0418
NP_441621.1_7 Forward -364 -350 -6.39192 0.29
NP_443062.1_1 Reverse -105 -123 15.3714 0.0385
NP_441351.1_8 Forward -146 -127 1.67108 0.267
NP_440516.1_8 Forward -303 -294 -0.295266 0.232
NP_440673.1_3 Reverse -107 -114 11.7405 0.0653
NP_441052.1_2 Reverse -177 -187 2.33998 0.209
NP_442219.1_8 Forward -313 -294 8.45701 0.245
NP_440436.1_2 Reverse -52 -71 15.5448 0.294
NP_441884.1_9 Forward -62 -43 -14.1602 0.138
NP_441884.1_9 Reverse -65 -84 -22.0267 0.275
NP_440314.1_9 Reverse -295 -314 -9.047 0.258
NP_441719.1_4 Forward -113 -106 3.77569 0.285
NP_441004.1_4 Reverse -291 -301 13.8447 0.2
NP_441851.1_9 Forward -45 -26 7.47261 0.279
NP_441851.1_10 Reverse -91 -101 3.91327 0.296
NP_442208.1_5 Reverse -376 -395 -9.63698 0.295
NP_442856.1_7 Reverse -83 -102 -5.50708 0.281
NP_442515.1_1 Forward -312 -298 0.196253 0.2
NP_440432.1_9 Forward -302 -287 -6.21495 0.29
NP_442843.1_1 Forward -40 -21 -0.590531 0.188
NP_442843.1_1 Reverse -77 -96 -7.67036 0.25
NP_440474.1_8 Forward -40 -26 5.01387 0.26
NP_442006.1_2 Reverse -59 -76 -19.234 0.299
NP_440483.1_4 Forward -372 -353 2.0644 0.288
NP_442729.1_8 Forward -105 -92 12.5073 0.125
NP_440707.1_9 Reverse -77 -96 -0.000545616 0.293
NP_442443.1_1 Reverse -279 -298 -5.99873 0.289
NP_441732.1_2 Reverse -62 -78 -16.8544 0.207
NP_440497.1_2 Reverse -331 -350 4.22769 0.293
NP_442003.1_4 Reverse -51 -70 9.24257 0.3
NP_440760.1_1 Reverse -129 -148 -15.2418 0.144
NP_440578.1_8 Forward -234 -215 10.1275 0.289
NP_441945.1_10 Reverse -76 -95 7.17762 0.286
NP_442489.1_7 Forward -101 -92 -2.16355 0.295
NP_442913.1_1 Forward -41 -22 8.06259 0.245
NP_440545.1_3 Forward -366 -349 -1.43612 0.168
NP_440831.1_3 Reverse -342 -361 7.06668 0.265
NP_441943.1_2 Forward -182 -163 12.8808 0.236
NP_440847.1_8 Forward -75 -56 20.649 0.129
NP_442603.1_7 Forward -59 -45 5.99717 0.264
NP_441585.1_5 Reverse -252 -271 1.6703 0.284
NP_441973.1_1 Forward -72 -57 0.569883 0.235
NP_442723.1_8 Reverse -25 -39 17.6008 0.269
NP_441609.1_1 Reverse -111 -130 -0.197208 0.23
NP_442089.1_6 Reverse -188 -207 3.24438 0.275
NP_442089.1_9 Reverse -182 -201 13.5691 0.26
NP_440590.1_4 Reverse -14 -27 1.10092 0.133
NP_440567.1_1 Forward -100 -86 3.44117 0.143
NP_441951.1_9 Reverse -158 -177 2.45773 0.254
NP_440156.1_4 Reverse -166 -176 13.5492 0.176
NP_441892.1_1 Forward -123 -106 1.61214 0.15
NP_440665.1_1 Forward -98 -79 -9.24366 0.244
NP_441508.1_4 Forward -121 -107 13.8579 0.29
NP_440462.1_6 Forward -116 -106 3.22496 0.255
NP_440868.1_4 Reverse -88 -100 0.923956 0.196
NP_442479.1_9 Forward -22 -3 -8.26035 0.266
NP_441474.1_1 Reverse -359 -378 7.96345 0.212
NP_442402.1_10 Reverse -231 -241 12.5659 0.206
NP_441084.1_6 Forward -194 -180 9.44108 0.282
NP_440696.1_3 Reverse -373 -391 -3.52077 0.287
NP_442039.1_7 Reverse -385 -395 14.4347 0.211
NP_442837.1_3 Reverse -106 -113 9.87221 0.106
NP_441408.2_7 Reverse -261 -280 -2.55715 0.272
NP_440914.1_1 Forward -137 -127 8.12715 0.207
NP_441011.1_8 Reverse -93 -102 5.80125 0.227
NP_441011.1_8 Reverse -106 -115 5.3096 0.271
NP_441527.1_4 Reverse -247 -266 -7.78302 0.237
NP_442890.1_3 Forward -362 -343 16.4207 0.222
NP_442588.1_6 Reverse -180 -199 -0.590531 0.267
NP_442588.1_8 Reverse -13 -32 4.71934 0.29
NP_001035870.1_10 Reverse -243 -262 14.5843 0.207
NP_441479.1_9 Forward -150 -132 17.4237 0.23
NP_440886.1_7 Reverse -363 -373 3.32285 0.287
NP_440767.1_5 Forward -184 -165 6.29264 0.271
NP_440907.2_9 Reverse -162 -181 4.91521 0.222
NP_441463.1_3 Reverse -34 -53 -0.197208 0.132
NP_441140.1_7 Forward -170 -152 20.8653 0.0604
NP_441425.1_2 Forward -174 -155 11.2181 0.292
NP_442087.1_2 Forward -256 -237 12.5342 0.289
NP_440766.1_4 Forward -57 -43 11.0127 0.0796
NP_439988.1_7 Forward -99 -85 14.6503 0.292
NP_441237.1_9 Forward -302 -292 9.51814 0.287
NP_442867.1_8 Forward -252 -233 6.98095 0.251
NP_440798.1_1 Reverse -260 -278 11.3149 0.294
NP_440801.1_8 Reverse -293 -312 12.5858 0.134
NP_440942.1_3 Reverse -112 -131 5.50599 0.273
NP_441984.1_6 Reverse -177 -189 15.0836 0.219
NP_441436.1_2 Forward -363 -344 12.0942 0.163
NP_442341.1_7 Forward -102 -88 6.6861 0.12
NP_441756.1_5 Reverse -347 -366 2.0644 0.213
NP_441756.1_5 Reverse -374 -393 1.76941 0.215
NP_443000.1_3 Forward -357 -338 14.916 0.228
NP_443000.1_7 Forward -116 -106 4.20827 0.209
NP_441842.1_1 Forward -99 -86 10.2451 0.3
NP_440149.1_8 Reverse -92 -111 0.196116 0.141
NP_440216.1_9 Forward -200 -191 6.39124 0.289
NP_441045.1_4 Forward -188 -169 12.5858 0.274
NP_442446.1_4 Forward -102 -83 17.404 0.147
NP_441757.1_6 Forward -195 -176 8.06259 0.191
NP_440416.1_9 Reverse -346 -365 -15.7335 0.198
NP_440072.1_5 Forward -373 -355 -4.30741 0.299
NP_440845.1_1 Reverse -67 -86 -6.49039 0.297
NP_442564.1_9 Reverse -32 -46 16.5382 0.218
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTAATTCCGCCAGGGTAACCCGACGACGTTGTAGGGGCGGGACAGCAGTGCGGCGACGCAGACGATTTTCTAAATCCCTTGGTAACCGGGCAATTAGACCATCGGGCCATTCTTCTAGCTCAGCTTCAGGTAAAACTTCTTCTGGTTCCTGCTCCAAATTGTGGAGACTGTCAGCTTTGTAGCGCACCAACATGGAGGCCCAAAGAAAAGCCTGGCCAGAACGGGGTAAATTTTGCTGTTGAAAATTCAGGTCGAGGCTGTTGAGAATGCCCAGATCCTGCAAAAAGCGATCAATTACATCGATCACCGACACGTCCCAGGGGTTAATCTCCCCTTGGTGGGCCATTTCGATCAGGGTATCAATGGCATGACTCGCCGCAGATGGTGTCATAATTCCTT

CDS

ATGTTAACTGCCCGCTGTGAAGATCACCAGTTGGAGGACGCAGGCTTTATGGATGGGGTTTCCCTCGCGGATTTACGCTTGAACTATACCCAGGGGGGTTTAATCGAGGCTGAGGTGGCAGACCATCCCTTTGCCCAATTTCACATATGGCTCCAACAGGCGATCGCCGCTGAGTTGCCAGAACCCAATGCTATGACTTTAAGCACTCTGTCCGAGGAAGGCCATCCGGTGGGGCGTATGGTGCTGCTCAAGGGTTTGGATGAGCGGGGCTTCGTTTTTTACACTAACTATGACAGTGCCAAGGGGCAACAGTTAACGGCCCATCCTTGGGCAGGATTAGTGTTTTGGTGGGCGGCCCTAGAAAGACAGGTACGGGTGGATGGTCAAGTGGAAAAAATTGATCCGGCAGAATCCGATGCCTATTTTCAGTCCCGTCCCCGGGGTTCTCAATTGGGGGCCTGGGCTTCTCCCCAAAGTCGGATTGTTGGCGATCGCCAGGAGTTAGAAGACAATCTAGCCCGTTGGGAAAAACAATACGAAAACCAATCCATTCCCCGCCCCCCCCACTGGGGAGGATTTCGAGTGATTCCCCATCGCATCGAATTTTGGCAAGGCCGCCCTAGTCGTCTCCATGACCGTTTGCAATTTAATTTGCTTGATGGTCAATGGCACAGACAGAGGTTGGCGCCGTAG

Protein

MLTARCEDHQLEDAGFMDGVSLADLRLNYTQGGLIEAEVADHPFAQFHIWLQQAIAAELPEPNAMTLSTLSEEGHPVGRMVLLKGLDERGFVFYTNYDSAKGQQLTAHPWAGLVFWWAALERQVRVDGQVEKIDPAESDAYFQSRPRGSQLGAWASPQSRIVGDRQELEDNLARWEKQYENQSIPRPPHWGGFRVIPHRIEFWQGRPSRLHDRLQFNLLDGQWHRQRLAP