Your browser is old and dusty. Try Google Chrome!

Details for sll1433

ORF sll1433
Accession NP_441631.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_4 Forward -193 -174 16.4199 0.246
NP_441418.1_6 Forward -206 -187 -22.0267 0.166
NP_441623.1_1 Forward -141 -123 -0.7675 0.237
NP_440348.1_6 Forward -319 -300 5.89931 0.217
NP_442173.1_6 Reverse -242 -256 13.6676 0.128
NP_440074.1_6 Reverse -300 -319 9.63507 0.27
NP_441054.1_2 Reverse -117 -136 16.5191 0.132
NP_442062.1_8 Forward -206 -196 4.79825 0.198
NP_442062.1_8 Reverse -23 -33 4.69992 0.201
NP_441900.1_2 Forward -342 -324 -3.42315 0.279
NP_440304.1_4 Reverse -195 -205 3.71661 0.293
NP_441781.1_7 Reverse -139 -158 -2.95047 0.29
NP_441781.1_7 Forward -206 -187 -3.04881 0.294
NP_439918.1_3 Reverse -197 -216 8.75091 0.252
NP_441594.1_6 Reverse -323 -342 3.34271 0.231
NP_441594.1_6 Reverse -328 -347 1.57275 0.266
NP_441925.1_4 Forward -151 -132 -10.916 0.243
NP_441925.1_4 Forward -152 -133 -15.5375 0.266
NP_440856.1_7 Forward -206 -187 -5.21209 0.226
NP_439957.1_10 Forward -271 -261 15.2213 0.289
NP_441558.1_5 Forward -208 -189 9.14423 0.129
NP_440178.1_7 Reverse -259 -278 -20.945 0.204
NP_441209.1_6 Forward -356 -338 24.2647 0.0053
NP_440944.1_2 Forward -165 -146 2.16274 0.249
NP_441667.1_5 Forward -222 -208 17.685 0.217
NP_443018.1_3 Reverse -64 -71 8.49558 0.141
NP_441634.1_8 Reverse -160 -174 0.786239 0.217
NP_441634.1_8 Forward -208 -194 -3.63866 0.295
NP_443065.1_8 Forward -184 -165 10.7175 0.262
NP_441797.1_7 Reverse -60 -78 9.75391 0.292
NP_440533.1_6 Reverse -226 -245 15.0441 0.234
NP_440667.1_2 Reverse -194 -213 2.3594 0.203
NP_440887.1_4 Reverse -226 -245 14.6744 0.247
NP_442658.1_1 Reverse -195 -205 6.56775 0.224
NP_442658.1_1 Forward -178 -168 4.99446 0.288
NP_440141.1_8 Forward -81 -62 12.1925 0.188
NP_442782.1_2 Reverse -151 -165 8.06273 0.202
NP_440656.1_10 Forward -382 -363 15.6341 0.243
NP_439905.1_1 Forward -205 -192 7.39411 0.262
NP_440984.1_9 Forward -177 -164 16.4406 0.12
NP_443055.1_6 Reverse -231 -249 -0.76823 0.266
NP_440615.1_1 Forward -268 -249 24.7789 0.000436
NP_440615.1_6 Forward -349 -330 22.0256 0.00385
NP_442002.1_9 Reverse -330 -337 12.2322 0.185
NP_442002.1_9 Reverse -44 -51 9.47889 0.282
NP_440411.1_10 Reverse -142 -161 9.87132 0.281
NP_442431.1_10 Reverse -52 -70 -0.865831 0.296
NP_441674.1_2 Reverse -187 -206 16.3224 0.11
NP_440147.1_4 Reverse -165 -178 -0.472371 0.287
NP_441041.1_4 Forward -32 -13 -3.14714 0.119
NP_441041.1_4 Reverse -52 -71 -9.53865 0.218
NP_441041.1_4 Reverse -46 -65 -11.3086 0.244
NP_443063.1_7 Reverse -196 -212 5.07341 0.288
NP_439966.1_7 Forward -143 -133 7.84605 0.149
NP_441514.1_6 Forward -314 -307 14.2971 0.248
NP_441079.1_7 Reverse -337 -356 -2.36125 0.217
NP_443030.1_4 Forward -73 -54 2.16274 0.209
NP_442029.1_6 Reverse -134 -153 2.85105 0.286
NP_440253.1_2 Reverse -239 -257 -3.6191 0.297
NP_442933.1_6 Reverse -350 -369 17.0449 0.162
NP_442926.1_3 Reverse -186 -205 2.3594 0.295
NP_442554.1_8 Forward -205 -195 3.02829 0.245
NP_442313.1_3 Forward -397 -378 6.98095 0.25
NP_443009.1_5 Forward -103 -92 5.66304 0.193
NP_443009.1_5 Forward -207 -196 4.38475 0.249
NP_441448.1_1 Forward -113 -94 5.70265 0.261
NP_441468.1_1 Forward -175 -168 7.41394 0.121
NP_441330.1_1 Forward -211 -192 -13.8652 0.206
NP_441612.1_2 Reverse -329 -339 7.19391 0.26
NP_442427.1_6 Reverse -29 -48 16.5191 0.25
NP_442427.1_8 Forward -81 -62 5.211 0.274
NP_441944.1_2 Reverse -157 -175 14.898 0.297
NP_442808.1_1 Forward -144 -134 4.50281 0.197
NP_442808.1_1 Forward -143 -133 3.8145 0.222
NP_441101.1_4 Reverse -374 -393 5.89931 0.295
NP_442692.1_10 Reverse -304 -317 15.0721 0.253
NP_440558.1_2 Reverse -153 -172 -6.58872 0.277
NP_440558.1_2 Reverse -54 -73 -7.67036 0.298
NP_442789.1_4 Reverse -243 -262 -1.18052 0.214
NP_441878.1_6 Reverse -196 -206 -7.59145 0.245
NP_441878.1_6 Reverse -143 -153 -7.68978 0.255
NP_441590.1_4 Reverse -163 -182 2.55527 0.293
NP_442347.1_2 Reverse -68 -77 5.70292 0.226
NP_442965.1_2 Forward -170 -151 -7.17871 0.268
NP_442594.1_8 Reverse -227 -246 4.32602 0.266
NP_442998.1_5 Forward -313 -303 13.0581 0.158
NP_441799.1_9 Forward -164 -145 -3.63879 0.235
NP_440640.1_6 Reverse -179 -198 5.211 0.212
NP_440256.1_1 Forward -209 -190 3.93269 0.0488
NP_440256.1_1 Reverse -20 -39 -3.14714 0.127
NP_440256.1_1 Reverse -313 -332 -6.49039 0.213
NP_440256.1_1 Reverse -42 -61 -7.76869 0.245
NP_440256.1_1 Reverse -164 -183 -10.3253 0.299
NP_441559.1_8 Reverse -192 -206 -5.60527 0.267
NP_440915.1_6 Reverse -193 -207 -3.54032 0.298
NP_440748.1_5 Forward -70 -51 5.40766 0.195
NP_441464.1_10 Reverse -130 -144 14.6509 0.166
NP_440695.1_6 Reverse -301 -315 11.0901 0.265
NP_441494.1_6 Forward -107 -94 6.01747 0.289
NP_442386.1_9 Forward -143 -134 5.50585 0.25
NP_442386.1_10 Reverse -132 -145 14.2773 0.107
NP_441750.1_1 Forward -111 -92 -6.88371 0.244
NP_441750.1_7 Reverse -323 -333 14.4347 0.254
NP_442484.1_2 Forward -59 -40 6.58763 0.156
NP_442240.1_2 Forward -53 -34 -7.4737 0.128
NP_442714.1_7 Reverse -64 -83 -2.36049 0.296
NP_440027.1_3 Forward -153 -135 1.69003 0.299
NP_439937.1_8 Reverse -231 -250 -4.32711 0.283
NP_439937.1_9 Forward -154 -137 -8.51661 0.176
NP_439937.1_9 Forward -207 -190 -11.2699 0.248
NP_439937.1_9 Forward -153 -136 -14.9081 0.287
NP_439937.1_9 Forward -272 -255 -17.268 0.296
NP_441181.1_2 Forward -198 -179 5.80098 0.255
NP_441803.1_2 Reverse -105 -124 0.982764 0.242
NP_440267.1_2 Forward -211 -197 8.25877 0.169
NP_441631.1_5 Forward -164 -145 18.3873 0.199
NP_441018.1_7 Forward -350 -331 6.19431 0.297
NP_442262.1_10 Reverse -64 -71 8.59391 0.22
NP_442750.1_3 Reverse -194 -213 -12.7836 0.288
NP_440297.1_8 Reverse -323 -341 11.6222 0.241
NP_441896.1_5 Forward -171 -164 12.2322 0.273
NP_441103.1_9 Reverse -267 -277 16.2983 0.192
NP_440650.1_3 Reverse -55 -74 18.3873 0.0276
NP_440894.1_10 Forward -59 -40 9.14423 0.163
NP_440894.1_10 Reverse -174 -193 6.09597 0.224
NP_440999.1_2 Reverse -34 -53 9.93088 0.275
NP_440999.1_9 Reverse -193 -207 4.81781 0.115
NP_440888.1_2 Forward -206 -192 12.192 0.0495
NP_440220.1_4 Reverse -149 -168 2.9486 0.227
NP_441621.1_4 Forward -366 -353 16.1456 0.246
NP_441560.1_3 Forward -214 -196 7.09898 0.28
NP_442872.1_1 Forward -250 -231 -9.34199 0.241
NP_442120.1_10 Reverse -191 -210 -14.2585 0.288
NP_440603.1_9 Reverse -157 -176 0.884433 0.284
NP_440673.1_8 Forward -31 -14 16.4601 0.206
NP_441884.1_8 Reverse -139 -158 -12.4886 0.271
NP_442086.1_6 Forward -206 -187 11.6025 0.255
NP_441357.1_3 Forward -234 -220 22.7134 0.0059
NP_442907.1_2 Reverse -180 -198 11.3272 0.181
NP_441004.1_1 Reverse -230 -249 -7.86702 0.2
NP_441004.1_5 Reverse -20 -34 9.04604 0.263
NP_442694.1_4 Reverse -133 -142 11.7011 0.277
NP_443054.1_2 Reverse -22 -36 0.196253 0.274
NP_441851.1_7 Forward -98 -79 6.4893 0.286
NP_440432.1_7 Reverse -34 -53 8.84924 0.292
NP_440432.1_9 Reverse -198 -213 -4.24833 0.202
NP_442843.1_1 Forward -317 -298 -10.3253 0.277
NP_439960.1_6 Reverse -161 -180 10.5209 0.21
NP_440474.1_8 Forward -71 -57 6.19383 0.23
NP_441124.1_5 Reverse -376 -386 11.7668 0.245
NP_442450.1_5 Forward -42 -32 8.23984 0.13
NP_442168.1_5 Forward -170 -151 2.3594 0.232
NP_439950.1_1 Forward -311 -302 13.2744 0.277
NP_439950.1_1 Reverse -248 -257 13.2744 0.277
NP_440954.1_1 Forward -194 -175 3.14605 0.184
NP_440954.1_4 Reverse -250 -269 -1.86883 0.251
NP_440943.1_7 Reverse -298 -317 18.2882 0.293
NP_441450.1_3 Reverse -266 -285 7.76679 0.257
NP_440078.1_4 Reverse -129 -148 9.24257 0.3
NP_441078.1_4 Reverse -197 -206 -1.47524 0.266
NP_442320.1_8 Forward -182 -168 -3.34366 0.117
NP_440913.1_1 Reverse -37 -55 7.29564 0.206
NP_442489.1_7 Reverse -197 -206 -1.6719 0.235
NP_442489.1_7 Forward -206 -197 -1.96689 0.28
NP_441022.1_1 Reverse -124 -133 13.7524 0.188
NP_442776.1_1 Forward -217 -198 3.93269 0.279
NP_440545.1_3 Forward -204 -187 -6.451 0.28
NP_440847.1_8 Reverse -127 -146 14.0608 0.272
NP_441358.1_2 Reverse -42 -61 5.40766 0.277
NP_441329.1_6 Forward -25 -6 -1.28956 0.292
NP_441112.1_6 Forward -216 -197 -0.787193 0.295
NP_440671.1_4 Reverse -185 -199 10.6193 0.154
NP_442404.1_9 Forward -203 -189 11.7003 0.263
NP_442199.1_5 Forward -40 -21 -1.27885 0.18
NP_442199.1_5 Forward -373 -354 -3.63879 0.209
NP_442199.1_7 Reverse -118 -137 1.86696 0.271
NP_440719.1_9 Reverse -219 -238 17.0099 0.284
NP_441239.1_9 Forward -178 -166 4.75886 0.243
NP_441239.1_9 Reverse -195 -207 3.87389 0.272
NP_441239.1_9 Reverse -142 -154 3.87389 0.272
NP_441239.1_9 Forward -208 -196 2.98891 0.3
NP_441951.1_4 Reverse -98 -117 6.78429 0.273
NP_440604.1_6 Reverse -139 -158 -6.39206 0.296
NP_442629.1_5 Reverse -321 -335 17.7975 0.142
NP_441874.1_1 Forward -323 -309 10.4227 0.261
NP_440833.1_6 Reverse -301 -315 7.47213 0.278
NP_442809.1_1 Reverse -169 -188 8.75009 0.299
NP_442809.1_6 Forward -165 -146 8.55425 0.256
NP_443033.1_7 Reverse -156 -175 21.2389 0.0748
NP_440055.1_9 Forward -199 -180 19.174 0.144
NP_440441.1_2 Forward -78 -59 16.3215 0.281
NP_441249.1_3 Reverse -142 -161 10.5209 0.223
NP_442479.1_9 Reverse -46 -65 -4.42544 0.252
NP_442479.1_9 Reverse -154 -173 -13.5702 0.288
NP_442402.1_4 Forward -50 -31 -6.3928 0.257
NP_442402.1_4 Reverse -149 -168 -8.6544 0.284
NP_441848.1_4 Forward -363 -347 13.0892 0.195
NP_440696.1_3 Reverse -140 -158 -3.52077 0.287
NP_441180.1_1 Forward -147 -128 18.9765 0.248
NP_440825.1_6 Forward -355 -336 9.83255 0.285
NP_441760.1_7 Reverse -48 -66 8.67227 0.253
NP_441102.1_1 Reverse -46 -65 6.58763 0.241
NP_441252.1_6 Reverse -328 -335 11.9372 0.25
NP_442844.1_5 Reverse -6 -25 4.52188 0.26
NP_440914.1_1 Reverse -197 -207 10.7621 0.122
NP_441089.1_8 Forward -151 -132 13.7649 0.266
NP_442232.1_3 Reverse -136 -155 -14.9469 0.288
NP_441028.1_6 Reverse -306 -316 5.09279 0.267
NP_441059.1_2 Forward -165 -146 -3.63879 0.242
NP_442306.1_10 Reverse -162 -181 -20.7484 0.226
NP_442674.1_2 Forward -138 -119 7.96426 0.262
NP_440088.1_6 Forward -248 -229 18.289 0.263
NP_440886.1_7 Forward -249 -239 10.6976 0.0805
NP_440886.1_7 Forward -333 -323 4.89613 0.213
NP_440886.1_7 Reverse -196 -206 3.61784 0.272
NP_440828.1_1 Forward -204 -185 2.26028 0.231
NP_440828.1_4 Reverse -28 -47 -7.57277 0.288
NP_442614.1_2 Forward -107 -93 6.09611 0.293
NP_440028.1_6 Reverse -186 -204 14.2771 0.218
NP_441463.1_3 Forward -216 -197 -6.68705 0.247
NP_441463.1_6 Forward -208 -194 5.93276 0.287
NP_441401.1_5 Forward -168 -149 11.9838 0.297
NP_441962.1_4 Forward -71 -52 -13.2752 0.271
NP_441962.1_4 Reverse -111 -130 -14.3569 0.286
NP_440855.1_1 Reverse -179 -198 0.982764 0.226
NP_441431.1_2 Forward -146 -132 7.47213 0.241
NP_441993.1_1 Reverse -233 -252 2.72635 0.254
NP_441993.1_1 Reverse -191 -210 0.582284 0.297
NP_440467.1_3 Forward -152 -133 11.2562 0.281
NP_440114.1_10 Reverse -197 -211 6.29277 0.276
NP_442090.1_10 Reverse -134 -147 12.9006 0.179
NP_442698.1_10 Reverse -322 -341 0.0977854 0.297
NP_440293.1_3 Reverse -126 -145 -5.01543 0.269
NP_440293.1_3 Forward -196 -177 -6.88371 0.294
NP_439988.1_3 Reverse -129 -143 6.48943 0.278
NP_442867.1_8 Reverse -99 -118 6.58763 0.259
NP_440213.1_4 Forward -360 -341 15.3503 0.251
NP_440798.1_2 Forward -335 -321 14.2569 0.272
NP_442680.1_5 Forward -274 -255 -0.123152 0.277
NP_442297.1_4 Forward -111 -92 11.6543 0.294
NP_441332.1_6 Forward -143 -133 11.2595 0.261
NP_441756.1_5 Reverse -193 -212 -2.55715 0.277
NP_441173.1_9 Reverse -159 -167 13.2937 0.17
NP_441122.1_1 Reverse -59 -74 3.71647 0.28
NP_440175.1_7 Reverse -146 -164 14.5355 0.147
NP_440175.1_10 Reverse -93 -112 11.9958 0.219
NP_440149.1_8 Forward -206 -187 -2.16383 0.166
NP_440172.1_1 Reverse -197 -207 9.7148 0.0586
NP_440416.1_9 Reverse -309 -328 -22.0267 0.3
NP_443052.1_9 Reverse -99 -118 -3.73712 0.251
NP_442154.1_1 Reverse -231 -249 -13.9439 0.217
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGGCCCAAAAGTTAGATTTAGACAATATCGATCAATTGATCATTGAAAATGTTGGTAATTTGGTTTGCCCCACCACCTATGATCTAGGGGAAGATTTACGGGTCGTATTATTTTCCGTCACAGAAGGGGAGGATAAACCCCTTAAATATCCCGCCACCTTCAAATCAGCCCAGGTTATTTTAGTCACCAAACAGGACATTGCCGCCGCAGTGGATTTTGATGCAGAGCTGGCTTGGCAAAACCTACGGCAAGTGGCCCCCCAAGCCCAAATTTTTGCAGTGTCTGCCCGCACGGGGAAAGGATTGCAGTCCTGGTATGAGTATTTGGATCAATGGCAACTCCAACACTATTCGCCGTTGGTTGATCCAGCATTGGCCTAAGAGTTGAAGGAAAAAGATT

CDS

ATGGCAGTGACGTCTCCATGGTTCCGGGCAGTGGTCAGTGCGGCCCAAATGCAGGAGATTGAAAATTGGCTATTCACCCAGGGTATGCCAGTGGCGGCCTTGATGGAAAAAGCGGCTCTACAGACCGCCCAGAGATTGCTAACGCTCTATCCCCTCAGCACATATCCCCGCATCGGGGTGGTGGTGGGCCCGGGCCATAACGGTGGCGATGGTTTAGTGGTGGCGAGGGAACTAAAGCTCCAGGGCTACCAGGTTCAGGTTTTACAGCCCTTGGACAAGTTAAAACCCCTGACCCAAAACCACGTTGACTACGGCAAAAGTTTGGGCATCCCTTGGGTGGATGGGGTCCAGGCTTTGGCCCATTGCGATCTGATTATTGATGCCTTGTTCGGCGTTGGTTTAACTAGACTTATCACCGGAGCAATCGCCGACCTAATCACAACTATCAACAATCTACCTATCCCCGTGGTCAGTATCGATCTACCTTCAGGTATTGAGACAGATACGGGGGAAATTTTAGGTGTAGCAGTGGAGGCAGACCGGAGTTTTTGTCTTGGTCTTTGGAAACGAGCTTACTTTCAGGACAGGGCTTTGGCCCACCTAGGTCAGACGGAGTTATTGGGCATCGGCTTACCCCCCCAGGCGATCGCCAATGTTTTAGGAGAAGTTTGGCCAGTGCAAGTCCTTGGAGCTGACCAAGCTCAACAAACATTGCCCCTCAGTCGCCCGTTAGTGACCCACAAGTATCAACAGGGCCACCTATTACTGATCTGCGGTTCTCAACAGTATGCCGGGGGAGCGTTGCTAACCACTCTGGGGGCCAGGGCCAGTGGGGTGGGGATGGTGACAGTGGCGGTGCCCATGGGGATTAAGGCCTTGCTCCACAGTCAATGTCCCGAAGTTTTGGTGAAAGGTCTTTTGGAAACTCCCTCCGGGGCGATCGCCGGTTTGGGCAATTTGGACCTATCCCGTTACAGTGCTGTGGCCCTTGGACCAGGGTTAGGCTCGGACGTGGGCCCCCTGGTGGAAGAAGTTTTGTCGGTTAATTGTCCCCTGATTTTGGATGCCGATGGTCTCAACCAATTGGCTCAGCAACAATTACTACCCCTATTGGCAGTACGGACAGCCCCCACCGTGTTAACTCCCCATGGAGGTGAATTTAAAAGACTTTTTCCCGACATTGACCAAGGCGATCGCCTCACTGCAGTGCAAACAGCGGCGGCCATGTGTCAGGCCACAGTGCTGCTCAAAGGGGCTAAAACGGTCATTGCTAGTCCAACGGGCCCCACCTGGGCAATCAAAGATAGTACTCCAGCCCTAGCCCGAGGAGGCAGTGGGGATGTCCTCACGGGATTAATGGGGGGTATCTTGGCCCAGCCAGAAAAATTTGACCTTGCCCAAAGGGTGGCAACAGCAGCCTGGTGGCATGCCCAAGCCGGTATTTTAGCGTCTCAACAAAGAACAATTCTGGGGGTAGACGCCCAACATTTAGCAGAGTATTTAATTCCGGCCTGTCGCCAGTGGCTTGGTCCCAATGTCGCTAACTGGCCCGCTAATTTGTCCCATTCAAGTTGA

Protein

MAVTSPWFRAVVSAAQMQEIENWLFTQGMPVAALMEKAALQTAQRLLTLYPLSTYPRIGVVVGPGHNGGDGLVVARELKLQGYQVQVLQPLDKLKPLTQNHVDYGKSLGIPWVDGVQALAHCDLIIDALFGVGLTRLITGAIADLITTINNLPIPVVSIDLPSGIETDTGEILGVAVEADRSFCLGLWKRAYFQDRALAHLGQTELLGIGLPPQAIANVLGEVWPVQVLGADQAQQTLPLSRPLVTHKYQQGHLLLICGSQQYAGGALLTTLGARASGVGMVTVAVPMGIKALLHSQCPEVLVKGLLETPSGAIAGLGNLDLSRYSAVALGPGLGSDVGPLVEEVLSVNCPLILDADGLNQLAQQQLLPLLAVRTAPTVLTPHGGEFKRLFPDIDQGDRLTAVQTAAAMCQATVLLKGAKTVIASPTGPTWAIKDSTPALARGGSGDVLTGLMGGILAQPEKFDLAQRVATAAWWHAQAGILASQQRTILGVDAQHLAEYLIPACRQWLGPNVANWPANLSHSS