Your browser is old and dusty. Try Google Chrome!

Details for sll1432

ORF sll1432
Accession NP_441632.1
Symbol hypB
Category Hydrogenase
Definition putative hydrogenase expression/formation protein HypB
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -256 -242 -2.26202 0.287
NP_440795.1_7 Reverse -249 -256 14.1988 0.0267
NP_441418.1_6 Reverse -248 -267 -12.0953 0.0601
NP_441418.1_6 Forward -257 -238 -30.1882 0.262
NP_441418.1_6 Reverse -266 -285 -30.2865 0.267
NP_440897.1_6 Reverse -248 -267 0.686995 0.179
NP_441453.1_4 Reverse -248 -256 6.80426 0.121
NP_441453.1_4 Forward -257 -249 6.70593 0.121
NP_441453.1_7 Forward -323 -316 11.9372 0.298
NP_441623.1_1 Forward -282 -264 5.23069 0.175
NP_441623.1_1 Reverse -241 -259 -4.40575 0.274
NP_441623.1_1 Forward -367 -349 -4.60241 0.274
NP_442151.1_6 Reverse -248 -262 5.01447 0.298
NP_442838.1_7 Reverse -243 -262 -2.36049 0.185
NP_441818.1_1 Reverse -249 -260 14.7094 0.0449
NP_441630.1_3 Reverse -258 -277 6.68596 0.126
NP_440150.1_6 Reverse -245 -264 3.6377 0.245
NP_442173.1_1 Forward -256 -248 5.72262 0.203
NP_442173.1_1 Reverse -249 -257 5.72262 0.203
NP_442173.1_1 Forward -333 -325 5.42762 0.207
NP_442752.1_4 Forward -257 -250 13.5105 0.0314
NP_442752.1_4 Reverse -248 -255 4.26735 0.293
NP_443027.1_4 Reverse -246 -256 12.9597 0.0595
NP_441812.1_1 Reverse -272 -286 15.5352 0.201
NP_442975.1_10 Reverse -244 -258 3.44058 0.259
NP_440784.1_7 Forward -256 -249 13.2155 0.0365
NP_440784.1_7 Reverse -249 -256 12.1338 0.0604
NP_442909.1_7 Forward -333 -319 16.6169 0.0821
NP_442062.1_8 Forward -257 -247 9.7148 0.0559
NP_442062.1_8 Reverse -248 -258 7.94484 0.0848
NP_442062.1_8 Reverse -296 -306 4.69992 0.201
NP_441900.1_2 Forward -126 -108 -5.88141 0.288
NP_440304.1_4 Forward -259 -249 9.12481 0.0626
NP_442242.1_4 Reverse -249 -256 12.0355 0.0521
NP_442242.1_4 Forward -256 -249 11.5438 0.089
NP_440044.1_8 Forward -256 -237 1.86774 0.161
NP_441035.1_3 Reverse -245 -264 0.884433 0.245
NP_441935.1_1 Reverse -297 -316 6.78429 0.264
NP_441208.1_9 Forward -260 -246 8.06273 0.219
NP_441594.1_6 Reverse -239 -258 4.916 0.211
NP_440769.1_8 Forward -388 -369 8.45592 0.23
NP_441083.1_5 Reverse -248 -258 16.7946 0.00546
NP_441083.1_5 Reverse -266 -276 4.40493 0.146
NP_441083.1_5 Forward -257 -247 1.74999 0.198
NP_442827.1_8 Reverse -240 -259 5.99684 0.113
NP_441149.1_9 Reverse -226 -245 -2.16459 0.291
NP_441434.1_7 Forward -255 -241 4.81781 0.225
NP_441738.1_4 Reverse -238 -257 11.0125 0.149
NP_440209.1_1 Reverse -248 -256 8.37755 0.0576
NP_440209.1_1 Forward -257 -249 8.27922 0.0687
NP_442765.1_2 Forward -124 -105 10.9142 0.115
NP_442889.1_8 Reverse -245 -259 7.27547 0.156
NP_441713.1_1 Reverse -242 -261 -14.5535 0.259
NP_441770.1_10 Forward -259 -240 10.7175 0.23
NP_440178.1_7 Forward -258 -239 -11.9969 0.111
NP_440178.1_7 Forward -276 -257 -22.715 0.272
NP_442570.1_3 Reverse -121 -140 -8.06369 0.279
NP_442445.1_2 Reverse -339 -358 11.6025 0.288
NP_441716.1_1 Reverse -248 -262 20.0591 0.00829
NP_441598.1_1 Reverse -229 -248 6.88262 0.295
NP_442111.1_4 Reverse -247 -261 3.8345 0.229
NP_441163.1_1 Forward -100 -83 4.0697 0.294
NP_440906.1_5 Forward -256 -249 13.3138 0.0268
NP_440906.1_5 Reverse -249 -256 6.13563 0.241
NP_440747.1_10 Forward -260 -248 -11.7607 0.142
NP_440747.1_10 Reverse -245 -257 -11.7607 0.142
NP_441130.1_10 Forward -259 -245 14.3559 0.0483
NP_441486.1_1 Reverse -245 -259 2.2612 0.0868
NP_441486.1_1 Forward -260 -246 -5.9986 0.272
NP_442760.1_7 Reverse -261 -280 24.9755 0.0054
NP_440403.1_10 Forward -257 -238 2.26107 0.279
NP_441014.1_5 Forward -217 -199 9.85225 0.272
NP_441014.1_10 Reverse -163 -182 -0.886293 0.254
NP_441014.1_10 Forward -258 -239 -1.18128 0.257
NP_442848.1_4 Forward -341 -327 9.34103 0.282
NP_442848.1_5 Forward -119 -101 -3.42244 0.291
NP_443018.1_3 Reverse -249 -256 5.15232 0.226
NP_443018.1_3 Forward -256 -249 5.05399 0.238
NP_441634.1_8 Forward -259 -245 2.65453 0.166
NP_440376.1_1 Forward -257 -248 9.83282 0.0339
NP_440376.1_1 Reverse -248 -257 9.73449 0.0365
NP_442687.1_7 Forward -258 -248 17.5813 0.0089
NP_442687.1_7 Reverse -247 -257 6.07655 0.179
NP_442485.1_3 Reverse -237 -256 -3.3438 0.273
NP_441846.1_10 Forward -210 -191 -23.2067 0.279
NP_440642.1_10 Reverse -228 -242 9.83206 0.178
NP_442658.1_1 Reverse -246 -256 9.12434 0.167
NP_442658.1_1 Forward -307 -297 5.78111 0.25
NP_442658.1_1 Forward -259 -249 4.99446 0.288
NP_440656.1_8 Reverse -237 -256 -2.16383 0.184
NP_442544.1_2 Reverse -171 -185 -0.885388 0.252
NP_440720.1_6 Forward -394 -376 16.0471 0.281
NP_440607.1_9 Forward -286 -267 17.1898 0.243
NP_442937.1_5 Reverse -243 -262 11.4058 0.14
NP_442937.1_5 Forward -365 -346 9.0459 0.204
NP_441958.1_5 Forward -258 -248 10.6981 0.0112
NP_441958.1_5 Reverse -247 -257 2.53664 0.0409
NP_441958.1_5 Reverse -295 -305 -1.98659 0.265
NP_442690.1_1 Reverse -65 -84 -16.7168 0.291
NP_440153.1_8 Reverse -245 -258 -3.71729 0.299
NP_441591.1_10 Reverse -246 -265 4.71934 0.297
NP_442064.1_4 Forward -370 -351 4.62021 0.286
NP_443055.1_6 Reverse -240 -258 4.54162 0.181
NP_443055.1_6 Forward -275 -257 -0.964891 0.271
NP_443055.1_6 Forward -257 -239 -1.16155 0.273
NP_441099.1_5 Reverse -238 -257 -7.57203 0.177
NP_441099.1_5 Forward -267 -248 -12.0953 0.294
NP_442002.1_9 Reverse -247 -254 10.7572 0.185
NP_440809.1_9 Forward -266 -248 -7.65067 0.225
NP_441294.1_7 Reverse -244 -258 12.5142 0.0944
NP_443020.1_4 Forward -116 -97 17.4032 0.232
NP_442438.1_10 Reverse -243 -257 10.3243 0.0547
NP_441000.1_6 Forward -258 -244 4.42448 0.0953
NP_441000.1_6 Reverse -247 -261 0.491246 0.192
NP_442771.1_1 Forward -259 -241 1.29745 0.081
NP_440147.1_4 Forward -259 -246 2.2809 0.209
NP_440147.1_4 Reverse -246 -259 0.60927 0.249
NP_440147.1_4 Forward -277 -264 0.215946 0.261
NP_441550.1_8 Forward -259 -249 12.8609 0.0296
NP_441550.1_8 Reverse -246 -256 5.38779 0.252
NP_441916.1_7 Forward -257 -247 8.63316 0.0437
NP_441916.1_7 Reverse -248 -258 7.15819 0.0745
NP_440465.1_10 Forward -260 -241 1.57275 0.275
NP_441041.1_7 Reverse -245 -257 10.3329 0.1
NP_442396.1_5 Reverse -133 -146 6.50913 0.234
NP_442004.1_6 Reverse -248 -262 2.5562 0.263
NP_441725.1_4 Reverse -306 -320 4.22722 0.278
NP_441725.1_5 Reverse -249 -259 11.2881 0.0247
NP_441725.1_5 Forward -256 -246 -0.806614 0.271
NP_439966.1_7 Reverse -246 -256 7.94438 0.145
NP_439966.1_8 Forward -278 -259 18.9773 0.0421
NP_439966.1_9 Reverse -246 -255 0.983037 0.253
NP_440202.1_8 Reverse -231 -250 9.90358 0.297
NP_442941.1_3 Reverse -249 -259 8.82982 0.0333
NP_440289.1_2 Reverse -245 -258 12.8023 0.0139
NP_440289.1_2 Forward -260 -247 -3.12731 0.265
NP_440983.1_5 Reverse -325 -344 -5.80207 0.273
NP_441678.1_9 Forward -225 -206 -2.95047 0.273
NP_442281.1_1 Reverse -243 -257 7.66879 0.0949
NP_441334.1_7 Reverse -246 -265 -21.3384 0.296
NP_440437.1_1 Forward -263 -244 9.3409 0.0514
NP_440437.1_1 Forward -131 -112 1.76941 0.143
NP_441457.1_7 Forward -259 -240 5.60432 0.186
NP_441644.1_6 Reverse -248 -258 12.4676 0.0321
NP_441644.1_6 Forward -305 -295 5.38779 0.194
NP_441644.1_6 Reverse -40 -50 4.20782 0.245
NP_442215.1_2 Reverse -246 -262 -1.02311 0.177
NP_442029.1_1 Forward -269 -250 -14.3569 0.272
NP_440253.1_2 Forward -257 -239 10.6389 0.0381
NP_440929.1_8 Reverse -248 -257 9.53783 0.0296
NP_440929.1_8 Forward -257 -248 9.4395 0.0326
NP_442933.1_10 Forward -257 -248 13.9627 0.0192
NP_442933.1_10 Reverse -248 -257 7.86621 0.103
NP_441751.2_8 Reverse -249 -263 -4.22864 0.166
NP_442554.1_8 Forward -256 -246 6.46988 0.117
NP_442554.1_8 Reverse -249 -259 5.09324 0.161
NP_441762.1_7 Forward -258 -246 11.1504 0.0142
NP_441762.1_7 Reverse -247 -259 -7.53251 0.293
NP_442142.1_4 Forward -119 -106 7.59019 0.135
NP_442142.1_4 Reverse -245 -258 3.16532 0.265
NP_442292.1_1 Forward -256 -247 0.196389 0.234
NP_442292.1_1 Reverse -249 -258 -0.196935 0.239
NP_441525.1_1 Forward -309 -296 13.294 0.244
NP_443009.1_5 Forward -258 -247 16.971 0.00677
NP_442408.2_1 Reverse -248 -267 -6.58872 0.282
NP_441715.1_4 Reverse -249 -259 7.25653 0.108
NP_440015.1_9 Reverse -248 -266 1.10079 0.242
NP_441468.1_1 Forward -256 -249 6.3323 0.202
NP_441468.1_1 Reverse -249 -256 6.13563 0.209
NP_441020.2_6 Forward -259 -242 8.39697 0.2
NP_441020.2_6 Reverse -264 -281 7.41366 0.232
NP_441673.1_1 Reverse -248 -257 11.1111 0.0121
NP_441673.1_1 Forward -257 -248 11.0128 0.018
NP_441826.1_2 Forward -263 -249 -0.0987402 0.204
NP_441637.1_9 Reverse -215 -233 -1.45582 0.292
NP_442677.1_3 Reverse -1 -20 -4.52377 0.287
NP_442227.1_2 Reverse -3 -22 3.04771 0.219
NP_442808.1_1 Reverse -247 -257 8.92768 0.0481
NP_442542.1_2 Reverse -246 -259 11.1307 0.114
NP_442789.1_4 Forward -259 -240 -6.58872 0.286
NP_441518.1_3 Reverse -238 -257 10.7175 0.0343
NP_441878.1_6 Forward -258 -248 10.4031 0.0176
NP_441878.1_6 Reverse -247 -257 0.668351 0.139
NP_441036.1_8 Reverse -247 -257 8.04317 0.177
NP_441557.1_5 Reverse -248 -257 10.2261 0.0144
NP_441557.1_5 Forward -257 -248 10.1278 0.0188
NP_442356.1_1 Reverse -104 -123 8.94757 0.268
NP_441445.1_1 Forward -266 -247 14.3558 0.0505
NP_442066.2_4 Reverse -5 -24 -8.45701 0.294
NP_442066.2_9 Reverse -244 -257 6.60746 0.278
NP_440101.1_10 Reverse -242 -261 7.66927 0.193
NP_442183.1_1 Forward -257 -243 7.27608 0.145
NP_442347.1_2 Forward -256 -247 13.3727 0.056
NP_442965.1_4 Reverse -360 -379 12.4875 0.208
NP_440547.1_8 Forward -275 -256 15.6341 0.195
NP_441037.1_4 Reverse -246 -256 6.83041 0.239
NP_441633.1_3 Reverse -246 -259 3.36254 0.0699
NP_441633.1_3 Forward -259 -246 1.69091 0.109
NP_441633.1_3 Reverse -177 -190 -4.79893 0.212
NP_441633.1_7 Reverse -83 -102 20.7473 0.0479
NP_440136.1_2 Forward -256 -249 6.43063 0.154
NP_440136.1_2 Reverse -249 -256 6.23397 0.171
NP_442590.1_10 Reverse -107 -126 5.99764 0.254
NP_442998.1_10 Reverse -353 -360 7.21728 0.144
NP_442998.1_10 Forward -255 -248 5.93897 0.206
NP_442998.1_10 Reverse -250 -257 5.84064 0.235
NP_440299.1_1 Forward -364 -351 3.46031 0.243
NP_440299.1_1 Forward -261 -248 3.16532 0.256
NP_441799.1_1 Forward -261 -247 9.04542 0.1
NP_440256.1_1 Reverse -293 -312 0.0977854 0.087
NP_441512.1_4 Forward -261 -242 9.83255 0.237
NP_441559.1_8 Forward -262 -248 -1.27871 0.182
NP_440915.1_6 Reverse -244 -258 4.62115 0.0953
NP_440915.1_6 Forward -309 -295 0.0979218 0.176
NP_440717.1_3 Forward -272 -258 7.07881 0.285
NP_440748.1_4 Reverse -104 -123 12.88 0.292
NP_441464.1_8 Reverse -248 -262 7.37441 0.21
NP_441199.1_3 Reverse -8 -26 2.37909 0.231
NP_442993.1_1 Forward -257 -241 -9.77456 0.194
NP_442386.1_9 Forward -306 -297 7.07914 0.219
NP_442386.1_9 Reverse -247 -256 6.19416 0.23
NP_441340.1_5 Reverse -249 -256 5.93897 0.198
NP_441340.1_5 Forward -256 -249 5.84064 0.208
NP_442791.1_5 Forward -265 -246 -6.98204 0.279
NP_442326.1_7 Forward -351 -332 19.7631 0.264
NP_440586.1_8 Reverse -249 -256 11.1501 0.0845
NP_442251.1_6 Reverse -249 -256 13.7071 0.0268
NP_443051.1_1 Forward -258 -249 8.25953 0.0414
NP_443051.1_1 Reverse -247 -256 0.688044 0.134
NP_439996.1_1 Reverse -332 -351 10.3242 0.234
NP_441232.1_10 Forward -268 -249 11.3075 0.0997
NP_439937.1_9 Reverse -247 -264 -6.64833 0.157
NP_439937.1_9 Forward -276 -259 -15.4981 0.287
NP_440439.1_1 Reverse -245 -258 1.88757 0.139
NP_440439.1_1 Forward -260 -247 1.39592 0.156
NP_440372.1_2 Reverse -249 -256 6.62729 0.151
NP_440372.1_2 Forward -256 -249 6.52896 0.188
NP_441181.1_6 Forward -256 -238 3.06741 0.283
NP_439977.1_5 Reverse -242 -261 -1.7705 0.26
NP_440139.1_1 Reverse -242 -261 0.490334 0.291
NP_442384.1_10 Reverse -248 -261 15.3589 0.0103
NP_440699.1_3 Reverse -330 -347 17.2468 0.116
NP_442244.1_6 Reverse -245 -264 2.26107 0.291
NP_440344.1_10 Reverse -241 -258 -1.82945 0.0577
NP_440344.1_10 Forward -264 -247 -4.87771 0.102
NP_440531.1_6 Forward -265 -246 -0.197208 0.205
NP_440487.1_1 Reverse -245 -264 -2.55715 0.214
NP_442065.1_7 Reverse -316 -334 1.39578 0.243
NP_440297.1_9 Reverse -249 -259 9.32148 0.0917
NP_441896.1_3 Reverse -239 -258 7.86593 0.0928
NP_440894.1_2 Forward -351 -332 -3.04881 0.296
NP_440894.1_10 Forward -262 -243 2.3594 0.29
NP_440999.1_9 Reverse -244 -258 2.35953 0.151
NP_440888.1_2 Forward -257 -243 14.1586 0.02
NP_440888.1_2 Forward -375 -361 8.75042 0.149
NP_441771.1_4 Forward -193 -174 1.17943 0.231
NP_440491.1_1 Forward -260 -241 7.79413 0.258
NP_440052.1_5 Forward -345 -326 1.37609 0.165
NP_442277.1_4 Reverse -239 -258 3.04693 0.231
NP_442033.1_10 Reverse -246 -265 -12.9802 0.279
NP_441543.1_2 Forward -256 -247 8.65285 0.0968
NP_441543.1_2 Reverse -249 -258 6.29291 0.153
NP_441543.1_3 Reverse -190 -204 6.39049 0.286
NP_442845.1_2 Forward -334 -320 5.1128 0.243
NP_441469.1_8 Reverse -247 -256 12.8811 0.0929
NP_442315.1_5 Forward -16 -6 18.0729 0.195
NP_443064.1_6 Reverse -248 -258 17.7057 0.065
NP_442578.1_7 Reverse -249 -256 12.5271 0.0544
NP_441462.1_2 Reverse -248 -258 10.4031 0.011
NP_441462.1_2 Forward -257 -247 1.74999 0.0811
NP_441621.1_7 Forward -259 -245 -5.31028 0.25
NP_441621.1_7 Reverse -237 -251 -5.31028 0.25
NP_443062.1_6 Forward -265 -246 12.0942 0.0996
NP_441560.1_10 Forward -265 -246 7.57094 0.277
NP_442487.1_9 Forward -260 -241 17.3057 0.112
NP_440516.1_8 Reverse -248 -257 7.17789 0.0754
NP_440516.1_8 Forward -257 -248 7.07956 0.0867
NP_442428.1_5 Forward -256 -249 13.1171 0.038
NP_442428.1_5 Reverse -249 -256 6.23397 0.201
NP_441867.1_2 Forward -203 -184 -14.8485 0.289
NP_440673.1_2 Reverse -238 -257 15.0721 0.0952
NP_440673.1_3 Forward -255 -248 10.1672 0.149
NP_441052.1_2 Forward -257 -247 8.23984 0.0482
NP_441052.1_2 Reverse -248 -258 7.35486 0.0742
NP_442219.1_9 Forward -256 -247 5.11294 0.186
NP_440436.1_4 Forward -256 -247 8.35743 0.109
NP_440436.1_4 Reverse -249 -258 6.39082 0.162
NP_441884.1_9 Reverse -245 -264 -10.7186 0.0848
NP_441719.1_4 Reverse -249 -256 6.62729 0.151
NP_441719.1_4 Forward -256 -249 6.52896 0.188
NP_441733.1_10 Reverse -245 -258 9.36073 0.119
NP_442813.1_5 Reverse -125 -144 1.37609 0.295
NP_440129.1_9 Reverse -41 -60 8.06259 0.247
NP_443029.1_9 Forward -287 -268 16.0274 0.203
NP_443054.1_2 Forward -259 -245 14.0609 0.0722
NP_441851.1_10 Forward -258 -248 8.1415 0.122
NP_441851.1_10 Reverse -247 -257 6.66654 0.159
NP_442814.1_10 Forward -248 -229 10.8159 0.137
NP_442622.1_8 Reverse -248 -266 -18.4671 0.222
NP_441542.1_4 Forward -364 -350 3.04785 0.292
NP_441668.1_4 Reverse -311 -330 -0.197208 0.249
NP_442515.1_1 Reverse -247 -261 2.16287 0.141
NP_442515.1_1 Forward -258 -244 -4.62196 0.298
NP_441396.1_5 Reverse -108 -117 8.35786 0.224
NP_441046.1_2 Reverse -102 -121 1.67108 0.256
NP_440940.1_7 Forward -267 -249 3.65664 0.274
NP_441349.1_10 Reverse -311 -330 -7.27704 0.247
NP_441409.1_6 Forward -263 -244 -9.047 0.178
NP_440432.1_9 Forward -256 -241 0.373221 0.159
NP_440474.1_8 Forward -256 -242 9.34041 0.162
NP_440474.1_8 Reverse -180 -194 9.14375 0.167
NP_442450.1_5 Forward -259 -249 17.0896 0.0321
NP_440588.1_2 Forward -266 -247 -3.63879 0.191
NP_440195.1_5 Reverse -242 -261 10.0292 0.161
NP_442006.1_2 Reverse -257 -274 -9.59759 0.197
NP_442006.1_2 Forward -20 -3 -17.4641 0.276
NP_441570.1_1 Reverse -248 -266 3.85406 0.0211
NP_441570.1_1 Forward -257 -239 -11.6822 0.201
NP_441078.1_4 Reverse -248 -257 10.1278 0.016
NP_441078.1_4 Forward -257 -248 9.83282 0.0226
NP_441094.1_7 Forward -268 -249 15.7062 0.278
NP_440526.1_3 Forward -256 -245 1.92649 0.267
NP_441432.1_8 Reverse -247 -256 5.21127 0.185
NP_442320.1_8 Reverse -242 -256 6.6861 0.0257
NP_441732.1_2 Forward -261 -245 -16.2644 0.165
NP_441732.1_2 Reverse -260 -276 -16.4611 0.167
NP_440497.1_6 Reverse -291 -310 -4.91709 0.264
NP_440713.1_4 Forward -267 -248 9.83255 0.136
NP_442489.1_7 Reverse -248 -257 10.4228 0.0151
NP_442489.1_7 Forward -257 -248 10.3245 0.0193
NP_440941.1_1 Forward -203 -193 14.9263 0.295
NP_440559.1_1 Reverse -249 -258 7.57121 0.106
NP_441659.2_8 Reverse -248 -258 9.61647 0.0284
NP_441659.2_8 Forward -257 -247 2.14332 0.211
NP_442749.1_5 Forward -202 -185 9.7662 0.198
NP_440779.1_5 Forward -257 -240 -14.5141 0.246
NP_442346.1_5 Forward -258 -248 13.5497 0.0226
NP_442346.1_5 Reverse -247 -257 5.68323 0.234
NP_442346.1_10 Reverse -246 -265 -2.75381 0.294
NP_440545.1_3 Reverse -244 -261 -4.18939 0.22
NP_440831.1_3 Reverse -257 -276 6.48422 0.273
NP_440486.1_6 Forward -331 -312 7.07928 0.278
NP_442603.1_7 Reverse -248 -262 8.94708 0.161
NP_441585.1_5 Forward -315 -296 -1.37794 0.298
NP_443022.1_3 Reverse -8 -27 16.8141 0.126
NP_441948.1_4 Forward -264 -246 19.587 0.0121
NP_441833.1_4 Forward -256 -249 6.3323 0.134
NP_441833.1_4 Reverse -249 -256 6.23397 0.163
NP_441895.1_2 Reverse -40 -59 -26.7466 0.247
NP_441895.1_10 Reverse -100 -119 -27.7299 0.29
NP_442162.1_9 Reverse -249 -256 6.52896 0.178
NP_442162.1_9 Forward -256 -249 6.43063 0.208
NP_440671.1_4 Reverse -315 -329 6.48943 0.245
NP_441973.1_1 Reverse -227 -242 -7.98491 0.293
NP_440830.1_3 Forward -86 -67 14.1583 0.284
NP_441915.1_6 Forward -332 -313 18.0395 0.259
NP_442140.1_3 Forward -256 -246 7.64985 0.133
NP_440875.1_9 Forward -255 -245 13.5309 0.0677
NP_441813.1_5 Forward -259 -249 6.27322 0.0971
NP_441813.1_5 Reverse -246 -256 0.275027 0.206
NP_441813.1_7 Forward -122 -108 8.65209 0.278
NP_442254.1_1 Reverse -198 -217 -5.31042 0.282
NP_440590.1_4 Forward -256 -243 2.57589 0.0845
NP_440567.1_1 Forward -256 -242 2.06454 0.184
NP_440567.1_1 Reverse -249 -263 -0.0987402 0.264
NP_442497.1_10 Reverse -249 -258 10.1278 0.0166
NP_442497.1_10 Forward -256 -247 0.589713 0.153
NP_440821.1_4 Forward -259 -249 10.2065 0.0163
NP_440821.1_4 Reverse -246 -256 9.02648 0.0364
NP_440927.1_4 Reverse -270 -289 12.7825 0.247
NP_441239.1_9 Forward -307 -295 10.8554 0.0714
NP_441239.1_9 Reverse -246 -258 9.87208 0.0941
NP_441239.1_9 Forward -259 -247 4.66053 0.248
NP_441892.1_1 Forward -266 -249 0.530496 0.167
NP_441892.1_1 Reverse -257 -274 -3.10775 0.233
NP_440665.1_1 Reverse -251 -270 -4.42544 0.186
NP_441698.1_3 Reverse -191 -205 19.2718 0.232
NP_442772.1_6 Forward -295 -276 16.7536 0.196
NP_440876.1_5 Reverse -353 -372 10.7175 0.244
NP_442809.1_6 Reverse -319 -338 1.17943 0.276
NP_440462.1_6 Reverse -246 -256 8.23984 0.0687
NP_440868.1_4 Reverse -244 -256 0.0389777 0.234
NP_440868.1_4 Forward -261 -249 -0.74767 0.282
NP_442402.1_10 Forward -122 -112 11.1893 0.269
NP_441084.1_6 Reverse -294 -308 9.24716 0.29
NP_441843.2_9 Forward -255 -237 12.0482 0.205
NP_441811.1_8 Forward -263 -249 14.7492 0.162
NP_441180.1_2 Reverse -270 -289 10.3897 0.287
NP_441053.1_3 Reverse -252 -271 1.96607 0.244
NP_442837.1_3 Forward -256 -249 13.5105 0.0268
NP_442837.1_3 Reverse -249 -256 6.13563 0.25
NP_442053.1_1 Reverse -248 -257 8.75118 0.0728
NP_442053.1_1 Forward -257 -248 8.65285 0.0741
NP_440505.1_3 Reverse -246 -256 4.50326 0.284
NP_441536.1_10 Forward -218 -199 10.9142 0.265
NP_442456.1_5 Forward -154 -136 13.5888 0.233
NP_442532.1_7 Forward -257 -243 4.62115 0.171
NP_441299.1_4 Reverse -318 -336 13.4905 0.232
NP_440914.1_1 Forward -305 -295 9.98138 0.164
NP_440914.1_1 Reverse -248 -258 6.66328 0.269
NP_441011.1_8 Forward -256 -247 14.1594 0.0269
NP_442533.1_1 Forward -260 -241 -16.1268 0.263
NP_442533.1_1 Forward -212 -193 -17.1101 0.281
NP_442533.1_6 Reverse -248 -257 14.651 0.01
NP_442533.1_6 Forward -257 -248 7.37455 0.0898
NP_442533.1_6 Reverse -164 -173 1.37636 0.3
NP_442232.1_3 Forward -265 -246 -15.6352 0.295
NP_441482.1_7 Reverse -319 -333 -10.9151 0.222
NP_441482.1_7 Reverse -315 -329 -11.3085 0.254
NP_439944.1_9 Reverse -249 -259 7.74818 0.131
NP_441697.1_5 Reverse -64 -83 -9.02441 0.268
NP_442202.1_4 Reverse -246 -260 17.7801 0.104
NP_441527.1_4 Forward -239 -220 -9.88384 0.262
NP_440115.1_6 Reverse -263 -273 5.68323 0.227
NP_440903.1_2 Forward -214 -204 16.2046 0.275
NP_441106.1_1 Reverse -247 -256 8.45619 0.0548
NP_440429.1_2 Forward -345 -326 7.66927 0.28
NP_442588.1_8 Reverse -93 -112 5.01433 0.289
NP_442306.1_10 Forward -262 -243 -1.37718 0.0484
NP_441286.1_1 Reverse -247 -259 4.66053 0.031
NP_441286.1_1 Forward -258 -246 -4.48425 0.161
NP_440670.1_8 Reverse -248 -257 8.84951 0.0606
NP_440670.1_8 Forward -257 -248 8.55452 0.066
NP_440670.1_8 Reverse -325 -334 3.93297 0.212
NP_441886.1_2 Forward -221 -202 7.17762 0.251
NP_440886.1_7 Reverse -247 -257 17.1874 0.00477
NP_440828.1_4 Reverse -183 -202 -7.3761 0.285
NP_442614.1_2 Reverse -248 -262 11.996 0.172
NP_442072.1_9 Forward -258 -240 -21.712 0.212
NP_441808.1_2 Reverse -38 -57 8.75091 0.235
NP_441808.1_8 Reverse -101 -120 9.43923 0.259
NP_440907.2_8 Forward -256 -246 7.84605 0.117
NP_441021.1_8 Forward -262 -244 4.9357 0.215
NP_441463.1_3 Forward -267 -248 -3.63879 0.181
NP_441626.1_2 Reverse -249 -256 6.0373 0.212
NP_441626.1_2 Forward -256 -249 5.93897 0.231
NP_442615.1_1 Reverse -239 -257 -5.58572 0.217
NP_441962.1_5 Forward -272 -253 10.2259 0.19
NP_440634.1_10 Forward -321 -302 5.80018 0.269
NP_440114.1_10 Forward -305 -291 9.83269 0.16
NP_440114.1_10 Forward -257 -243 7.57108 0.231
NP_440114.1_10 Forward -283 -269 5.99778 0.289
NP_442698.1_10 Forward -146 -127 6.29264 0.233
NP_442324.1_7 Reverse -263 -282 5.85867 0.268
NP_441510.2_2 Reverse -244 -263 5.70185 0.26
NP_441510.2_9 Reverse -249 -268 9.43923 0.165
NP_440287.1_6 Reverse -294 -313 1.67108 0.266
NP_439988.1_3 Forward -253 -239 4.12949 0.295
NP_440457.1_1 Forward -261 -249 11.642 0.092
NP_440457.1_1 Reverse -321 -333 4.16888 0.171
NP_441984.1_3 Reverse -286 -304 7.88563 0.239
NP_441889.1_4 Forward -266 -247 6.29264 0.158
NP_442509.1_9 Forward -257 -247 16.1058 0.00871
NP_442509.1_9 Reverse -248 -258 8.3377 0.192
NP_442514.1_5 Reverse -2 -21 -3.44288 0.228
NP_440554.1_4 Forward -256 -246 4.3066 0.195
NP_441885.1_5 Reverse -248 -258 1.94665 0.0935
NP_441885.1_5 Forward -257 -247 1.65166 0.106
NP_442341.1_7 Reverse -247 -261 5.80112 0.145
NP_442341.1_9 Forward -336 -322 7.96378 0.182
NP_443000.1_7 Forward -259 -249 5.97822 0.125
NP_442513.1_5 Reverse -240 -259 10.52 0.266
NP_441842.1_10 Reverse -259 -273 8.94771 0.203
NP_440275.1_3 Reverse -246 -256 8.23984 0.0602
NP_440091.1_1 Reverse -244 -256 17.1486 0.0153
NP_443010.1_10 Reverse -245 -262 16.1063 0.0512
NP_442451.1_2 Reverse -240 -259 -8.85033 0.254
NP_440149.1_8 Forward -257 -238 1.57275 0.122
NP_440149.1_8 Reverse -290 -309 -6.58872 0.255
NP_440216.1_1 Reverse -248 -262 -1.77037 0.0383
NP_440216.1_1 Forward -257 -243 -3.54032 0.0833
NP_440216.1_9 Reverse -42 -51 6.48957 0.289
NP_440172.1_1 Reverse -248 -258 13.4514 0.021
NP_442015.1_10 Forward -261 -248 7.88576 0.0755
NP_442015.1_10 Forward -17 -4 0.117615 0.241
NP_441226.1_5 Forward -335 -318 10.7569 0.213
NP_441226.1_7 Forward -333 -326 7.1186 0.218
NP_441111.1_7 Reverse -249 -257 8.96754 0.0463
NP_441111.1_7 Forward -256 -248 8.86921 0.0589
NP_441766.1_2 Reverse -248 -257 7.86621 0.0703
NP_441766.1_2 Forward -257 -248 7.66954 0.0723
NP_442252.1_4 Reverse -113 -132 16.6174 0.221
NP_440416.1_9 Forward -341 -322 -14.8485 0.18
NP_440416.1_9 Forward -268 -249 -18.5851 0.26
NP_440416.1_9 Reverse -241 -260 -21.0434 0.29
NP_443052.1_8 Reverse -238 -257 8.94757 0.023
NP_441430.1_7 Forward -106 -87 10.1275 0.277
NP_440261.1_5 Reverse -249 -262 -4.60227 0.158
NP_440261.1_5 Reverse -322 -335 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGGGTTGCAAAATACTTCTAAAAAGACTTCTCCACTGTGGCAATATTCCAAATTCTGTTGCTTCTCCGGTCGGCCTCCCTGGTTAACCTGAGCACCAATGGCCTTTAATTGATTGACCAATTGGTTGATCTCCCCCTGGAGGGTGATCGCCGCTTCGGCACTAAAGGGAAAACGAACAGAACCTTGGAGTAAGTTGAGGGTTAGGGGAGCTGTCATTACAAAAATGGGGCTGGGAAATTGGATATTTAATCAATGGAGCCAGAAAAGACAAACCTGGGTCTCCACCATCAATTCCAGATTACTGTGCCAAATGGCAATTAAAGTAGAACCTCTTTCAAGCATCCTCTCTTACCATGGGGTCATAACATTAATATTTCCGCCCGAGGGGGAAGGTTATT

CDS

ATGTGCCAAAACTGCGGTTGTAGTGCGGTGGGAACCGTTGCCCATAGCCACCATCACCATGGCGATGGAAATTTTGCCCACAGCCATGATGACCATGACCAGCAAGAACATCATCACCACCATGGCAACTACAGCAAAAGTCCAAGTCAGCAGACTGTGACCATTGAACCCGATCGCCAGTCCATTGCCATTGGCCAAGGCATTCTCAGCAAGAATGACCGCCTAGCGGAAAGGAATCGGGGCTATTTCCAGGCTAAGGGCTTACTGGTGATGAATTTCCTCTCTTCTCCCGGAGCCGGTAAAACTGCTCTGATCGAAAAAATGGTCGGCGATCGACAAAAAGACCATCCCACCGCCGTCATTGTGGGGGATTTAGCCACCGATAACGATGCCCAACGTCTCCGCAGTGCCGGGGCGATCGCCATTCAGGTCACCACAGGAAATATTTGCCATCTGGAAGCGGAAATGGTGGCCAAGGCGGCCCAAAAGTTAGATTTAGACAATATCGATCAATTGATCATTGAAAATGTTGGTAATTTGGTTTGCCCCACCACCTATGATCTAGGGGAAGATTTACGGGTCGTATTATTTTCCGTCACAGAAGGGGAGGATAAACCCCTTAAATATCCCGCCACCTTCAAATCAGCCCAGGTTATTTTAGTCACCAAACAGGACATTGCCGCCGCAGTGGATTTTGATGCAGAGCTGGCTTGGCAAAACCTACGGCAAGTGGCCCCCCAAGCCCAAATTTTTGCAGTGTCTGCCCGCACGGGGAAAGGATTGCAGTCCTGGTATGAGTATTTGGATCAATGGCAACTCCAACACTATTCGCCGTTGGTTGATCCAGCATTGGCCTAA

Protein

MCQNCGCSAVGTVAHSHHHHGDGNFAHSHDDHDQQEHHHHHGNYSKSPSQQTVTIEPDRQSIAIGQGILSKNDRLAERNRGYFQAKGLLVMNFLSSPGAGKTALIEKMVGDRQKDHPTAVIVGDLATDNDAQRLRSAGAIAIQVTTGNICHLEAEMVAKAAQKLDLDNIDQLIIENVGNLVCPTTYDLGEDLRVVLFSVTEGEDKPLKYPATFKSAQVILVTKQDIAAAVDFDAELAWQNLRQVAPQAQIFAVSARTGKGLQSWYEYLDQWQLQHYSPLVDPALA