Your browser is old and dusty. Try Google Chrome!

Details for sll1426

ORF sll1426
Accession NP_441327.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -188 -174 8.75105 0.0846
NP_440795.1_7 Forward -188 -181 14.6904 0.0123
NP_440795.1_7 Reverse -181 -188 14.6904 0.0123
NP_441418.1_6 Forward -189 -170 16.1257 0.00231
NP_441418.1_6 Reverse -168 -187 -20.2567 0.108
NP_440815.1_2 Reverse -36 -50 12.5853 0.256
NP_442291.1_5 Reverse -179 -195 16.0865 0.0222
NP_442291.1_5 Forward -190 -174 -1.80975 0.202
NP_441453.1_4 Reverse -180 -188 16.539 0.00633
NP_441453.1_4 Forward -189 -181 16.539 0.00633
NP_441453.1_8 Forward -320 -303 9.28195 0.239
NP_441818.1_1 Reverse -181 -192 15.4961 0.0264
NP_441818.1_6 Reverse -173 -187 11.8976 0.253
NP_440226.1_1 Reverse -180 -199 10.8159 0.0588
NP_440226.1_1 Forward -189 -170 2.45773 0.263
NP_441630.1_3 Forward -197 -178 9.14423 0.101
NP_440120.1_4 Forward -65 -51 14.2576 0.273
NP_441098.1_5 Forward -190 -171 9.93088 0.284
NP_442173.1_1 Forward -188 -180 15.4574 0.00633
NP_442173.1_1 Reverse -181 -189 15.4574 0.00633
NP_442752.1_4 Forward -189 -182 13.8055 0.0199
NP_442752.1_4 Reverse -180 -187 13.8055 0.0199
NP_443027.1_4 Reverse -178 -188 13.943 0.0452
NP_443027.1_4 Forward -191 -181 11.0914 0.107
NP_441812.1_2 Reverse -56 -75 17.6007 0.222
NP_442975.1_10 Reverse -176 -190 20.9434 0.00133
NP_442975.1_10 Forward -181 -167 4.71887 0.241
NP_440784.1_7 Forward -188 -181 15.9687 0.0123
NP_440784.1_7 Reverse -181 -188 15.9687 0.0123
NP_442909.1_7 Forward -188 -174 11.602 0.131
NP_440061.1_9 Forward -191 -177 14.5519 0.0631
NP_440061.1_9 Reverse -178 -192 9.73373 0.14
NP_441145.1_1 Forward -190 -171 5.11266 0.254
NP_439979.1_2 Forward -189 -170 12.2908 0.167
NP_442062.1_3 Forward -141 -122 -0.983855 0.255
NP_442062.1_8 Forward -189 -179 19.4496 0.000558
NP_442062.1_8 Reverse -180 -190 17.3846 0.00193
NP_441900.1_2 Forward -178 -160 -0.276578 0.266
NP_441900.1_2 Forward -86 -68 -6.86472 0.298
NP_441859.1_3 Forward -190 -171 14.7483 0.0704
NP_440304.1_4 Reverse -178 -188 9.91146 0.051
NP_440304.1_4 Forward -191 -181 1.84832 0.299
NP_442242.1_4 Forward -188 -181 14.3954 0.0124
NP_442242.1_4 Reverse -181 -188 14.3954 0.0124
NP_440044.1_8 Forward -188 -169 15.9291 0.0239
NP_440044.1_8 Reverse -181 -200 1.86774 0.161
NP_441581.1_6 Forward -185 -166 11.1347 0.283
NP_441352.1_2 Reverse -12 -31 7.07928 0.173
NP_441594.1_6 Forward -384 -365 6.29264 0.193
NP_441594.1_6 Reverse -171 -190 3.14605 0.236
NP_440370.1_10 Reverse -171 -190 9.93088 0.212
NP_442110.1_7 Forward -189 -175 0.982901 0.241
NP_441083.1_5 Reverse -180 -190 20.3345 0.00053
NP_441083.1_5 Forward -189 -179 11.3864 0.0159
NP_442827.1_8 Reverse -172 -191 -0.00131823 0.217
NP_441738.1_2 Forward -187 -180 15.28 0.0102
NP_441738.1_2 Reverse -182 -189 15.28 0.0102
NP_441558.1_5 Forward -191 -172 14.9458 0.046
NP_440209.1_1 Reverse -180 -188 18.1123 0.00295
NP_440209.1_1 Forward -189 -181 18.1123 0.00295
NP_442136.1_4 Forward -187 -168 6.1935 0.295
NP_442889.1_8 Reverse -177 -191 4.32555 0.27
NP_441713.1_5 Forward -327 -308 6.78429 0.265
NP_440178.1_7 Reverse -179 -198 -12.5869 0.121
NP_441716.1_1 Forward -189 -175 10.7177 0.0936
NP_441716.1_1 Reverse -180 -194 8.55439 0.138
NP_441327.1_1 Forward -35 -16 21.8975 0.123
NP_441327.1_4 Forward -196 -182 15.4376 0.282
NP_441327.1_5 Forward -64 -55 16.6177 0.111
NP_442111.1_4 Forward -190 -176 19.2725 0.00439
NP_441163.1_1 Reverse -172 -189 5.93797 0.267
NP_441163.1_9 Reverse -336 -355 12.5858 0.272
NP_440906.1_5 Forward -188 -181 15.8704 0.0124
NP_440906.1_5 Reverse -181 -188 15.8704 0.0124
NP_440747.1_10 Forward -192 -180 16.7552 0.0019
NP_440747.1_10 Reverse -177 -189 -2.02597 0.0196
NP_441130.1_10 Forward -191 -177 15.8309 0.0282
NP_441130.1_10 Reverse -178 -192 11.0127 0.107
NP_441486.1_1 Reverse -177 -191 4.91614 0.0399
NP_441486.1_1 Forward -192 -178 -4.22864 0.192
NP_442330.1_4 Reverse -165 -184 14.9461 0.263
NP_442634.1_4 Forward -191 -177 -3.34366 0.161
NP_440403.1_4 Reverse -171 -190 12.0942 0.0674
NP_440403.1_4 Forward -198 -179 -5.70374 0.22
NP_440842.1_10 Reverse -105 -119 5.21113 0.251
NP_440842.1_10 Forward -118 -104 4.71948 0.254
NP_441014.1_10 Forward -190 -171 2.75194 0.216
NP_441014.1_10 Reverse -179 -198 0.195343 0.245
NP_442848.1_1 Reverse -174 -188 16.5192 0.0143
NP_442848.1_1 Forward -195 -181 -0.787057 0.263
NP_442848.1_9 Forward -195 -176 -0.295539 0.278
NP_441012.1_4 Forward -187 -174 9.85238 0.272
NP_439978.1_1 Reverse -237 -253 21.298 0.113
NP_443018.1_3 Forward -188 -181 14.8871 0.0123
NP_443018.1_3 Reverse -181 -188 14.8871 0.0123
NP_441634.1_8 Forward -191 -177 25.2707 0.00156
NP_440376.1_1 Forward -189 -180 19.4693 0.000692
NP_440376.1_1 Reverse -180 -189 19.4693 0.000692
NP_440376.1_1 Reverse -245 -254 1.86802 0.238
NP_441588.1_4 Reverse -182 -192 6.46988 0.193
NP_442687.1_7 Reverse -179 -189 15.8113 0.0125
NP_442687.1_7 Forward -190 -180 8.92815 0.0994
NP_442191.1_4 Reverse -171 -185 11.8657 0.238
NP_441077.1_6 Forward -61 -45 5.69407 0.247
NP_442485.1_3 Forward -191 -172 -1.08219 0.255
NP_442485.1_3 Reverse -166 -185 -5.70374 0.295
NP_442958.1_3 Reverse -169 -188 5.89931 0.197
NP_441422.1_7 Forward -191 -174 5.34871 0.102
NP_440691.1_10 Reverse -299 -318 8.35759 0.269
NP_442658.1_1 Reverse -178 -188 18.7607 0.00222
NP_442658.1_1 Forward -191 -181 7.94438 0.199
NP_442198.1_3 Forward -273 -254 4.916 0.268
NP_442198.1_3 Reverse -246 -265 2.16274 0.3
NP_440141.1_8 Reverse -171 -190 7.37428 0.24
NP_442205.1_9 Reverse -174 -190 -3.48138 0.283
NP_441414.1_9 Reverse -180 -199 7.07928 0.0358
NP_441487.1_9 Reverse -179 -198 5.89931 0.131
NP_442937.1_5 Forward -194 -175 17.2074 0.0332
NP_442937.1_5 Reverse -247 -266 8.25926 0.229
NP_442937.1_5 Reverse -175 -194 7.47261 0.251
NP_441958.1_5 Forward -190 -180 12.2714 0.00183
NP_441958.1_5 Reverse -179 -189 12.2714 0.00183
NP_442836.1_5 Reverse -174 -193 5.30933 0.188
NP_439905.1_1 Forward -179 -166 6.90245 0.272
NP_440984.1_7 Forward -194 -180 7.86607 0.161
NP_441097.1_2 Reverse -153 -170 5.34871 0.259
NP_442911.1_2 Reverse -170 -189 6.78429 0.0277
NP_441580.1_6 Reverse -169 -188 2.94938 0.117
NP_440153.1_5 Forward -188 -174 19.1741 0.0435
NP_440153.1_5 Reverse -181 -195 7.86607 0.15
NP_440858.1_1 Forward -73 -54 0.982764 0.212
NP_443055.1_3 Forward -198 -179 10.7406 0.28
NP_443055.1_3 Reverse -171 -190 10.5496 0.288
NP_443055.1_6 Forward -394 -376 -2.53818 0.296
NP_440993.1_2 Forward -194 -178 2.12349 0.269
NP_442995.1_5 Forward -194 -175 20.2556 0.0609
NP_441348.1_3 Reverse -240 -259 6.58763 0.277
NP_441099.1_5 Forward -199 -180 -11.9969 0.294
NP_442002.1_9 Reverse -179 -186 10.7572 0.185
NP_441294.1_7 Reverse -176 -190 17.1217 0.0101
NP_441646.1_1 Reverse -173 -192 2.26107 0.219
NP_441646.1_1 Forward -196 -177 1.27776 0.232
NP_441646.1_7 Forward -179 -165 13.5693 0.28
NP_442438.1_10 Reverse -175 -189 11.5043 0.0463
NP_442438.1_10 Reverse -315 -329 -0.983719 0.287
NP_442885.1_5 Forward -187 -168 23.2047 0.0051
NP_441000.1_6 Reverse -179 -193 4.52282 0.0953
NP_441000.1_6 Forward -190 -176 -4.13031 0.227
NP_440147.1_4 Forward -191 -178 16.8339 0.00906
NP_440147.1_4 Reverse -178 -191 11.0324 0.0341
NP_441550.1_8 Forward -191 -181 15.1225 0.0132
NP_441550.1_8 Reverse -178 -188 10.501 0.066
NP_441916.1_7 Forward -189 -179 18.4663 0.00144
NP_441916.1_7 Reverse -180 -190 10.3048 0.0261
NP_441916.1_10 Forward -63 -44 1.37609 0.264
NP_440345.1_3 Reverse -55 -69 16.8182 0.165
NP_441041.1_7 Reverse -177 -189 10.2357 0.1
NP_440569.1_10 Reverse -189 -208 2.33913 0.293
NP_441725.1_4 Forward -194 -180 2.35894 0.287
NP_441725.1_5 Forward -188 -178 9.02648 0.0553
NP_441725.1_5 Reverse -181 -191 2.04498 0.115
NP_439966.1_7 Reverse -178 -188 17.4824 0.00636
NP_439966.1_7 Forward -191 -181 15.3192 0.0152
NP_439966.1_9 Reverse -178 -187 10.7178 0.0863
NP_442941.1_3 Reverse -181 -191 19.2529 0.00262
NP_442941.1_3 Forward -188 -178 2.53664 0.14
NP_440289.1_2 Reverse -177 -190 10.2457 0.0272
NP_440289.1_2 Forward -192 -179 -3.61896 0.267
NP_440983.1_5 Forward -329 -310 -6.88371 0.28
NP_441076.1_1 Forward -145 -126 10.4872 0.25
NP_442281.1_1 Reverse -175 -189 9.83206 0.0661
NP_442281.1_1 Forward -194 -180 8.84875 0.075
NP_440437.1_1 Reverse -93 -112 -0.197208 0.176
NP_442012.1_1 Reverse -174 -193 -0.0988766 0.251
NP_441644.1_6 Reverse -180 -190 17.3841 0.00127
NP_441644.1_6 Forward -189 -179 10.1076 0.0628
NP_441644.1_6 Reverse -252 -262 7.0594 0.137
NP_442215.1_2 Reverse -376 -392 -6.62797 0.277
NP_442247.1_8 Forward -191 -177 9.73436 0.247
NP_440253.1_2 Forward -189 -171 4.14905 0.106
NP_440253.1_2 Reverse -180 -198 4.05072 0.107
NP_440929.1_8 Forward -189 -180 19.2726 0.000701
NP_440929.1_8 Reverse -180 -189 19.2726 0.000701
NP_442933.1_10 Forward -189 -180 17.601 0.00325
NP_442933.1_10 Reverse -180 -189 17.601 0.00325
NP_440891.1_8 Forward -75 -56 15.2267 0.233
NP_442648.1_1 Forward -33 -14 10.0292 0.248
NP_441751.2_8 Reverse -181 -195 -3.04867 0.134
NP_442554.1_8 Reverse -181 -191 16.2046 0.0065
NP_442554.1_8 Forward -188 -178 16.008 0.0065
NP_441586.1_3 Forward -347 -328 10.1275 0.172
NP_441762.1_7 Forward -190 -178 12.4287 0.0142
NP_441762.1_7 Reverse -179 -191 2.39892 0.0676
NP_442142.1_4 Forward -192 -179 6.80355 0.154
NP_442142.1_4 Reverse -177 -190 6.0169 0.175
NP_442292.1_1 Reverse -181 -190 18.486 0.00229
NP_442292.1_1 Forward -188 -179 9.63616 0.0183
NP_442292.1_5 Reverse -241 -260 6.98095 0.157
NP_442476.1_6 Forward -188 -174 11.406 0.056
NP_442476.1_6 Reverse -181 -195 6.58777 0.123
NP_442381.1_8 Reverse -177 -196 3.24438 0.0733
NP_443009.1_5 Forward -190 -179 18.3477 0.00265
NP_441715.1_4 Reverse -181 -191 17.3846 0.0106
NP_441715.1_4 Forward -188 -178 9.32148 0.097
NP_441448.1_1 Reverse -160 -179 7.47261 0.221
NP_442076.1_5 Forward -267 -248 12.0942 0.186
NP_440183.1_9 Reverse -206 -225 -16.3235 0.276
NP_441198.1_8 Reverse -268 -278 10.4392 0.271
NP_440379.1_5 Reverse -91 -110 -9.047 0.259
NP_441468.1_1 Forward -188 -181 15.8704 0.0124
NP_441468.1_1 Reverse -181 -188 15.8704 0.0124
NP_441468.1_5 Forward -350 -332 15.7521 0.229
NP_441020.2_6 Reverse -178 -195 8.88863 0.185
NP_441015.1_10 Forward -227 -208 -11.6036 0.298
NP_441673.1_1 Forward -189 -180 20.8459 0.000698
NP_441673.1_1 Reverse -180 -189 20.8459 0.000698
NP_441731.1_1 Forward -34 -16 13.3709 0.281
NP_441876.1_9 Reverse -301 -311 12.1726 0.267
NP_441826.1_2 Reverse -174 -188 16.8142 0.018
NP_441826.1_5 Forward -114 -95 2.26107 0.276
NP_441330.1_1 Forward -194 -175 -11.5053 0.183
NP_442490.1_9 Reverse -168 -187 -7.37537 0.278
NP_442081.1_1 Forward -291 -272 15.2287 0.283
NP_442868.1_6 Forward -191 -181 19.2529 0.00563
NP_442868.1_6 Reverse -178 -188 8.53483 0.0555
NP_440051.1_5 Reverse -124 -138 16.6816 0.189
NP_441612.1_2 Reverse -180 -190 8.54929 0.21
NP_442227.1_2 Reverse -304 -323 0.294447 0.252
NP_442808.1_1 Reverse -179 -189 18.4657 0.00201
NP_442808.1_1 Forward -190 -180 8.63269 0.0481
NP_442808.1_1 Forward -256 -246 1.25791 0.289
NP_441101.1_10 Forward -193 -174 -6.39206 0.29
NP_441849.1_2 Reverse -119 -138 8.16414 0.226
NP_440145.1_3 Forward -199 -180 17.0107 0.00972
NP_442542.1_2 Reverse -178 -191 19.0955 0.0177
NP_442050.1_5 Forward -191 -181 14.3359 0.0206
NP_442050.1_5 Reverse -178 -188 8.23937 0.234
NP_440342.1_1 Forward -391 -372 17.8957 0.164
NP_440558.1_1 Reverse -155 -174 16.8141 0.138
NP_441518.1_4 Forward -196 -177 10.0284 0.217
NP_441878.1_6 Forward -190 -180 10.4031 0.0176
NP_441878.1_6 Reverse -179 -189 10.4031 0.0176
NP_441878.1_6 Forward -313 -303 -7.88644 0.278
NP_441036.1_8 Reverse -179 -189 17.7779 0.000554
NP_441036.1_8 Forward -190 -180 8.33817 0.174
NP_441557.1_5 Forward -189 -180 19.9609 0.000699
NP_441557.1_5 Reverse -180 -189 19.9609 0.000699
NP_441445.1_1 Reverse -171 -190 3.34271 0.215
NP_442066.2_9 Forward -193 -180 10.639 0.154
NP_441433.1_8 Forward -108 -89 -4.13045 0.289
NP_441308.1_8 Reverse -178 -188 9.22315 0.226
NP_442183.1_1 Forward -189 -175 18.5841 0.00743
NP_442183.1_1 Reverse -180 -194 8.25939 0.119
NP_442347.1_2 Reverse -181 -190 12.4878 0.056
NP_442347.1_2 Forward -188 -179 11.1111 0.056
NP_442645.1_2 Forward -197 -178 -2.85214 0.0487
NP_442645.1_2 Reverse -243 -262 -18.3884 0.272
NP_441037.1_4 Reverse -178 -188 16.2838 0.0168
NP_441633.1_3 Forward -191 -178 20.5705 0.00512
NP_441633.1_3 Reverse -178 -191 -3.71729 0.177
NP_440136.1_2 Forward -188 -181 15.9687 0.0123
NP_440136.1_2 Reverse -181 -188 15.9687 0.0123
NP_442998.1_5 Reverse -73 -83 12.2714 0.175
NP_442998.1_5 Forward -63 -53 10.9931 0.199
NP_442998.1_5 Forward -201 -191 10.7964 0.204
NP_442998.1_5 Forward -64 -54 9.61647 0.238
NP_442998.1_5 Reverse -363 -373 8.92815 0.26
NP_442998.1_10 Forward -187 -180 15.5754 0.0102
NP_442998.1_10 Reverse -182 -189 15.5754 0.0102
NP_440299.1_1 Reverse -176 -189 17.3249 0.0065
NP_440299.1_1 Forward -193 -180 11.0318 0.0529
NP_440299.1_1 Forward -82 -69 4.24695 0.213
NP_440299.1_6 Reverse -12 -31 5.89931 0.268
NP_441799.1_1 Forward -193 -179 13.8636 0.0293
NP_441799.1_1 Reverse -176 -190 6.19383 0.179
NP_441007.1_10 Reverse -175 -188 1.88757 0.203
NP_442201.1_10 Forward -200 -181 -4.42544 0.152
NP_442201.1_10 Reverse -169 -188 -12.5869 0.268
NP_440256.1_1 Forward -192 -173 11.2092 0.0156
NP_440087.1_1 Forward -198 -179 -9.24366 0.292
NP_441559.1_8 Forward -259 -245 5.60446 0.0879
NP_441559.1_8 Forward -184 -170 4.03116 0.133
NP_441559.1_8 Reverse -175 -189 2.5562 0.143
NP_441559.1_8 Reverse -240 -254 -7.47356 0.294
NP_440915.1_6 Reverse -176 -190 7.47274 0.0689
NP_440915.1_6 Forward -193 -179 0.786239 0.153
NP_440915.1_6 Forward -324 -310 0.392915 0.165
NP_442031.1_5 Reverse -166 -185 4.22769 0.298
NP_440306.1_8 Forward -28 -9 5.40686 0.204
NP_441494.1_6 Reverse -166 -179 9.2624 0.227
NP_442386.1_9 Reverse -179 -188 15.7322 0.0144
NP_442386.1_9 Forward -190 -181 13.8639 0.0289
NP_440570.1_5 Reverse -3 -22 -1.08219 0.266
NP_441750.1_1 Reverse -156 -175 -12.4886 0.3
NP_441340.1_5 Forward -188 -181 15.6737 0.0124
NP_441340.1_5 Reverse -181 -188 15.6737 0.0124
NP_440168.1_8 Reverse -174 -193 5.30933 0.216
NP_440168.1_9 Reverse -169 -188 -1.08219 0.273
NP_440168.1_9 Forward -191 -172 -4.22878 0.296
NP_440194.1_3 Forward -199 -180 3.93269 0.271
NP_442240.1_2 Forward -188 -169 -16.5201 0.247
NP_442240.1_2 Reverse -181 -200 -19.6667 0.295
NP_440161.1_3 Reverse -178 -197 7.47261 0.299
NP_440586.1_8 Forward -188 -181 13.2151 0.026
NP_440586.1_8 Reverse -181 -188 13.2151 0.026
NP_442251.1_6 Forward -188 -181 15.2804 0.0124
NP_442251.1_6 Reverse -181 -188 15.2804 0.0124
NP_441262.1_3 Reverse -180 -187 14.7888 0.0223
NP_441262.1_3 Forward -189 -182 14.7888 0.0223
NP_440027.1_3 Reverse -170 -188 9.35981 0.184
NP_443051.1_1 Reverse -179 -188 10.4228 0.00754
NP_443051.1_1 Forward -190 -181 10.4228 0.00754
NP_439984.1_3 Forward -196 -182 15.5352 0.149
NP_439937.1_8 Reverse -166 -185 1.27776 0.229
NP_439937.1_8 Forward -158 -139 -2.85214 0.262
NP_439937.1_9 Forward -190 -173 -8.12328 0.176
NP_440439.1_1 Reverse -177 -190 11.9173 0.0288
NP_440439.1_1 Forward -192 -179 1.88757 0.139
NP_440372.1_2 Forward -188 -181 16.3621 0.0124
NP_440372.1_2 Reverse -181 -188 16.3621 0.0124
NP_442783.1_8 Reverse -56 -75 14.4533 0.266
NP_440819.1_5 Reverse -11 -19 7.98423 0.228
NP_440819.1_5 Forward -64 -56 7.68924 0.266
NP_439977.1_7 Forward -200 -181 10.52 0.281
NP_442384.1_10 Reverse -180 -193 12.2123 0.0296
NP_442384.1_10 Forward -189 -176 11.229 0.0372
NP_442035.1_7 Forward -280 -261 15.4008 0.298
NP_442114.1_4 Forward -189 -178 12.1534 0.107
NP_441877.1_7 Forward -194 -175 5.99684 0.218
NP_442790.1_4 Reverse -171 -190 -6.39206 0.144
NP_442790.1_4 Forward -198 -179 -7.57203 0.156
NP_442262.1_10 Forward -188 -181 14.1988 0.0123
NP_442262.1_10 Reverse -181 -188 14.1988 0.0123
NP_441689.1_5 Forward -191 -181 5.78111 0.197
NP_440163.1_10 Reverse -174 -184 12.5664 0.159
NP_440344.1_10 Reverse -173 -190 8.49531 0.0106
NP_440344.1_10 Forward -184 -167 -11.4659 0.215
NP_440531.1_6 Reverse -172 -191 -4.6221 0.284
NP_440189.1_10 Forward -232 -213 3.44104 0.279
NP_441965.1_10 Reverse -177 -193 3.50012 0.263
NP_440297.1_9 Reverse -181 -191 -0.118297 0.282
NP_440297.1_9 Forward -188 -178 -0.216628 0.282
NP_440350.1_5 Reverse -124 -143 -7.27704 0.299
NP_441896.1_3 Reverse -171 -190 3.73603 0.164
NP_440999.1_9 Reverse -176 -190 21.7307 0.0083
NP_440888.1_2 Forward -189 -175 17.9935 0.00283
NP_440888.1_2 Reverse -180 -194 15.1419 0.0122
NP_440600.1_4 Forward -197 -179 1.39578 0.128
NP_440600.1_4 Reverse -172 -190 -8.24065 0.3
NP_439969.1_3 Reverse -175 -194 -1.7705 0.283
NP_442948.1_2 Forward -190 -171 13.3725 0.113
NP_442033.1_10 Reverse -178 -197 -5.21209 0.179
NP_442033.1_10 Reverse -168 -187 -7.37537 0.186
NP_442033.1_10 Forward -179 -160 -12.5869 0.273
NP_442033.1_10 Forward -191 -172 -14.5535 0.299
NP_441543.1_2 Forward -188 -179 18.486 0.00236
NP_441543.1_2 Reverse -181 -190 16.9127 0.00359
NP_441918.1_7 Forward -190 -171 5.40766 0.262
NP_441469.1_8 Reverse -179 -188 16.126 0.00797
NP_441469.1_8 Forward -190 -181 6.48957 0.227
NP_443064.1_6 Reverse -180 -190 12.5669 0.0796
NP_442337.1_8 Reverse -138 -157 4.71934 0.21
NP_442578.1_5 Forward -169 -150 8.94757 0.227
NP_442578.1_7 Forward -188 -181 14.5921 0.026
NP_442578.1_7 Reverse -181 -188 14.5921 0.026
NP_440710.1_1 Forward -197 -179 -1.55415 0.182
NP_441462.1_2 Forward -189 -179 11.5831 0.00406
NP_441462.1_2 Reverse -180 -190 11.5831 0.00406
NP_441621.1_7 Reverse -178 -192 -3.147 0.188
NP_441621.1_7 Forward -191 -177 -3.44199 0.188
NP_441621.1_7 Reverse -169 -183 -4.03198 0.203
NP_441621.1_7 Reverse -166 -180 -4.81863 0.246
NP_443062.1_1 Reverse -180 -198 12.7387 0.0744
NP_443062.1_6 Reverse -172 -191 2.55606 0.253
NP_442204.1_1 Reverse -176 -187 0.648657 0.281
NP_442204.1_5 Reverse -170 -189 1.96607 0.221
NP_440516.1_2 Reverse -174 -192 1.98577 0.183
NP_440516.1_8 Forward -189 -180 16.9127 0.00442
NP_440516.1_8 Reverse -180 -189 16.9127 0.00442
NP_442428.1_5 Forward -188 -181 15.8704 0.0124
NP_442428.1_5 Reverse -181 -188 15.8704 0.0124
NP_441443.1_7 Forward -348 -329 -2.55715 0.27
NP_442823.1_9 Reverse -235 -254 21.5821 0.0574
NP_441867.1_2 Reverse -66 -85 -10.522 0.202
NP_441867.1_2 Reverse -162 -181 -20.7484 0.297
NP_440673.1_2 Reverse -170 -189 18.5839 0.0423
NP_440673.1_3 Forward -187 -180 12.4288 0.0426
NP_440673.1_3 Reverse -182 -189 12.4288 0.0426
NP_440865.1_9 Forward -231 -212 -6.1954 0.222
NP_441052.1_2 Reverse -180 -190 19.9412 0.00106
NP_441052.1_2 Forward -189 -179 10.5014 0.0285
NP_441052.1_2 Forward -177 -167 3.71661 0.175
NP_442219.1_9 Reverse -181 -190 17.7976 0.00718
NP_442219.1_9 Forward -188 -179 8.35786 0.0681
NP_440436.1_4 Forward -188 -179 18.1905 0.00233
NP_440436.1_4 Reverse -181 -190 17.2072 0.00233
NP_441884.1_8 Forward -190 -171 -7.86702 0.254
NP_441884.1_9 Forward -192 -173 -13.9635 0.138
NP_441884.1_9 Reverse -177 -196 -23.895 0.284
NP_442086.1_3 Reverse -181 -200 6.68596 0.285
NP_440314.1_9 Reverse -181 -200 8.75091 0.0355
NP_442414.1_2 Forward -345 -326 14.7491 0.134
NP_441719.1_4 Forward -188 -181 16.3621 0.0124
NP_441719.1_4 Reverse -181 -188 16.3621 0.0124
NP_441733.1_10 Forward -192 -179 7.09911 0.156
NP_441004.1_1 Reverse -165 -184 3.6377 0.106
NP_441004.1_2 Reverse -160 -179 -2.0655 0.263
NP_441034.1_2 Forward -395 -376 15.7849 0.237
NP_442873.1_5 Reverse -329 -348 12.88 0.202
NP_442206.1_1 Forward -180 -161 -13.2752 0.25
NP_442206.1_10 Forward -189 -174 -0.216765 0.287
NP_442854.1_6 Reverse -180 -199 8.94757 0.218
NP_443054.1_2 Forward -191 -177 10.226 0.0761
NP_441851.1_10 Reverse -179 -189 16.008 0.00552
NP_441851.1_10 Forward -190 -180 15.8113 0.00552
NP_442622.1_8 Reverse -180 -198 -19.1554 0.296
NP_442515.1_1 Reverse -179 -193 10.3243 0.0533
NP_442515.1_1 Forward -190 -176 4.71948 0.107
NP_442515.1_1 Reverse -254 -268 1.86788 0.147
NP_441982.1_6 Forward -65 -56 12.1989 0.288
NP_440165.1_5 Reverse -179 -198 -6.58872 0.238
NP_442689.1_8 Reverse -358 -375 -3.40274 0.251
NP_440940.1_7 Reverse -170 -188 11.4247 0.112
NP_440940.1_7 Forward -339 -321 5.03327 0.234
NP_441349.1_10 Forward -199 -180 0.687771 0.0867
NP_440432.1_9 Reverse -181 -196 13.3529 0.0197
NP_440432.1_9 Forward -188 -173 -1.10174 0.167
NP_442843.1_1 Reverse -181 -200 -2.45882 0.203
NP_441124.1_5 Reverse -363 -373 15.2045 0.198
NP_440195.1_4 Reverse -168 -187 5.60432 0.284
NP_442006.1_2 Reverse -171 -188 -16.7758 0.264
NP_442006.1_3 Forward -326 -308 6.41066 0.132
NP_442243.1_1 Forward -267 -249 -2.9315 0.298
NP_441570.1_1 Forward -189 -171 1.49411 0.0304
NP_441570.1_1 Reverse -180 -198 1.00246 0.034
NP_440078.1_10 Reverse -180 -199 4.03102 0.254
NP_441078.1_4 Forward -189 -180 19.6659 0.0007
NP_441078.1_4 Reverse -180 -189 19.6659 0.0007
NP_442729.1_8 Reverse -176 -189 8.47575 0.125
NP_441663.1_8 Forward -326 -307 4.12936 0.169
NP_440707.1_9 Reverse -8 -27 0.294447 0.293
NP_440526.1_3 Forward -188 -177 2.41814 0.267
NP_440526.1_3 Reverse -181 -192 1.04151 0.267
NP_441432.1_8 Forward -190 -181 16.8143 0.00595
NP_441432.1_8 Reverse -179 -188 8.25953 0.0755
NP_442320.1_8 Reverse -174 -188 6.09611 0.0304
NP_442320.1_8 Forward -195 -181 3.73617 0.0578
NP_441732.1_2 Reverse -176 -192 -6.43131 0.0495
NP_441732.1_2 Forward -193 -177 -15.0844 0.145
NP_440760.1_1 Reverse -180 -199 -12.6852 0.0945
NP_440461.1_3 Forward -388 -369 19.174 0.12
NP_440461.1_3 Reverse -319 -338 14.2574 0.288
NP_439900.1_1 Forward -358 -339 11.6025 0.251
NP_440913.1_1 Forward -191 -173 3.95239 0.285
NP_442400.1_10 Forward -373 -360 9.13351 0.271
NP_442489.1_7 Forward -189 -180 20.1576 0.000695
NP_442489.1_7 Reverse -180 -189 20.1576 0.000695
NP_442079.1_7 Forward -188 -169 6.19431 0.162
NP_440559.1_1 Reverse -181 -190 17.4043 0.00658
NP_440559.1_1 Forward -188 -179 8.75118 0.0586
NP_441659.2_8 Reverse -180 -190 18.1713 0.00133
NP_441659.2_8 Forward -189 -179 11.9764 0.0147
NP_439956.1_7 Reverse -89 -108 4.52268 0.257
NP_440708.1_6 Reverse -92 -111 -9.44032 0.266
NP_442346.1_5 Forward -190 -180 16.6963 0.00248
NP_442346.1_5 Reverse -179 -189 9.02648 0.118
NP_440545.1_3 Forward -193 -176 5.54538 0.0608
NP_440545.1_3 Forward -333 -316 -6.05768 0.268
NP_441856.1_8 Reverse -303 -322 11.1109 0.274
NP_440025.1_1 Forward -193 -174 9.53756 0.192
NP_440459.1_2 Forward -321 -304 8.59364 0.254
NP_441653.1_2 Reverse -169 -188 16.7684 0.053
NP_441653.1_2 Forward -200 -181 3.62625 0.264
NP_440010.1_4 Reverse -170 -189 0.490334 0.248
NP_440010.1_4 Forward -193 -174 -0.492971 0.255
NP_442875.1_2 Forward -160 -141 17.2074 0.0858
NP_442603.1_7 Forward -189 -175 9.6354 0.144
NP_442603.1_7 Reverse -180 -194 7.86545 0.193
NP_441888.1_7 Reverse -175 -189 13.6676 0.0743
NP_441888.1_7 Reverse -304 -318 6.6861 0.225
NP_441888.1_7 Forward -194 -180 2.85119 0.225
NP_441948.1_4 Forward -196 -178 -2.24246 0.163
NP_441833.1_4 Forward -188 -181 15.9687 0.0124
NP_441833.1_4 Reverse -181 -188 15.9687 0.0124
NP_441329.1_6 Forward -153 -134 -2.72194 0.294
NP_442162.1_9 Forward -188 -181 16.2637 0.0124
NP_442162.1_9 Reverse -181 -188 16.2637 0.0124
NP_440671.1_4 Forward -109 -95 5.99778 0.266
NP_442943.1_1 Forward -373 -358 2.7228 0.298
NP_441915.1_4 Reverse -341 -360 5.30853 0.3
NP_442140.1_3 Forward -188 -178 17.4829 0.0159
NP_442140.1_3 Reverse -181 -191 10.3048 0.0902
NP_442140.1_3 Reverse -312 -322 4.10993 0.261
NP_440875.1_9 Forward -187 -177 15.2829 0.0295
NP_441813.1_5 Forward -191 -181 18.1713 0.00743
NP_441813.1_5 Reverse -178 -188 10.0098 0.0208
NP_441259.1_8 Reverse -96 -115 10.815 0.264
NP_440590.1_4 Forward -188 -175 14.9656 0.0106
NP_440590.1_4 Reverse -181 -194 2.57589 0.0845
NP_440590.1_4 Reverse -171 -184 -4.89726 0.269
NP_440567.1_1 Forward -188 -174 9.63603 0.0422
NP_440567.1_4 Reverse -82 -101 1.67108 0.261
NP_442497.1_10 Forward -188 -179 10.4228 0.0087
NP_442497.1_10 Reverse -181 -190 10.4228 0.0087
NP_440821.1_4 Reverse -178 -188 18.7612 0.00422
NP_440821.1_4 Forward -191 -181 9.41981 0.0286
NP_441239.1_9 Reverse -178 -190 16.0669 0.0175
NP_441239.1_9 Reverse -98 -110 9.67541 0.0987
NP_441239.1_9 Forward -191 -179 7.80712 0.148
NP_441892.1_1 Reverse -171 -188 4.56207 0.11
NP_440949.1_7 Reverse -172 -191 9.83173 0.257
NP_442138.1_10 Reverse -180 -199 -6.78538 0.286
NP_442138.1_10 Forward -189 -170 -7.67036 0.29
NP_441782.1_3 Forward -325 -306 22.7139 0.0404
NP_442809.1_6 Reverse -168 -187 1.17943 0.276
NP_440546.1_4 Forward -189 -179 11.8882 0.0679
NP_440546.1_4 Reverse -180 -190 10.046 0.109
NP_440546.1_6 Reverse -170 -189 10.0292 0.247
NP_439974.1_4 Reverse -169 -188 12.3892 0.227
NP_440462.1_6 Reverse -178 -188 17.9746 0.00578
NP_440462.1_6 Forward -191 -181 9.61647 0.0429
NP_442592.1_3 Forward -185 -166 11.5042 0.219
NP_440868.1_4 Reverse -176 -188 12.527 0.0235
NP_440868.1_4 Forward -193 -181 7.70879 0.0648
NP_442479.1_9 Forward -375 -356 -11.0136 0.273
NP_442402.1_2 Forward -23 -9 11.897 0.272
NP_442402.1_4 Forward -185 -166 -1.8696 0.194
NP_442402.1_4 Forward -90 -71 -6.29447 0.255
NP_441084.1_6 Forward -57 -43 11.865 0.185
NP_440696.1_3 Forward -189 -171 3.95239 0.203
NP_440696.1_3 Reverse -180 -198 3.3624 0.207
NP_442039.1_4 Forward -188 -181 15.1821 0.0124
NP_442039.1_4 Reverse -181 -188 15.1821 0.0124
NP_441926.1_3 Reverse -180 -196 5.46674 0.17
NP_442837.1_3 Forward -188 -181 15.7721 0.0124
NP_442837.1_3 Reverse -181 -188 15.7721 0.0124
NP_442053.1_1 Forward -189 -180 18.3876 0.0007
NP_442053.1_1 Reverse -180 -189 18.3876 0.0007
NP_440505.1_3 Forward -191 -181 18.3679 0.00213
NP_440505.1_3 Reverse -178 -188 14.1397 0.0235
NP_441536.1_1 Reverse -20 -39 12.7825 0.249
NP_441252.1_6 Reverse -72 -79 11.9372 0.25
NP_442532.1_7 Forward -189 -175 15.5359 0.0587
NP_440914.1_1 Reverse -180 -190 17.5935 0.000537
NP_440914.1_1 Forward -189 -179 8.6151 0.186
NP_440914.1_1 Reverse -270 -280 6.17532 0.293
NP_441011.1_8 Forward -188 -179 16.9127 0.00602
NP_441011.1_8 Reverse -181 -190 8.25953 0.144
NP_442533.1_6 Forward -189 -180 17.2076 0.00137
NP_442533.1_6 Reverse -180 -189 17.2076 0.00137
NP_442533.1_6 Forward -312 -303 1.37636 0.3
NP_442541.1_10 Forward -115 -101 1.27731 0.287
NP_440263.1_5 Reverse -359 -373 9.63603 0.294
NP_442232.1_3 Reverse -162 -181 -14.3569 0.288
NP_441482.1_7 Forward -195 -181 4.81781 0.0442
NP_441482.1_7 Reverse -174 -188 -0.688726 0.0612
NP_439944.1_9 Reverse -181 -191 10.5014 0.0887
NP_439944.1_9 Forward -188 -178 10.4031 0.0887
NP_441028.1_6 Forward -81 -71 7.74772 0.218
NP_441028.1_6 Reverse -56 -66 4.89613 0.275
NP_442202.1_4 Forward -191 -177 16.0349 0.159
NP_441527.1_4 Forward -140 -121 -4.82277 0.189
NP_441527.1_4 Forward -150 -131 -7.40105 0.232
NP_440115.1_6 Reverse -177 -187 9.61647 0.115
NP_440115.1_6 Forward -192 -182 6.76487 0.167
NP_441680.1_4 Forward -243 -224 2.45773 0.242
NP_441602.1_3 Forward -194 -175 7.37428 0.12
NP_441972.1_5 Forward -188 -169 5.70265 0.091
NP_441106.1_1 Reverse -179 -188 18.191 0.0028
NP_441106.1_1 Forward -190 -181 9.63616 0.0311
NP_442306.1_10 Forward -184 -165 -12.4886 0.178
NP_442306.1_10 Forward -89 -70 -20.2567 0.202
NP_441286.1_1 Forward -190 -178 14.7886 0.00418
NP_441286.1_1 Reverse -179 -191 3.38223 0.0467
NP_440670.1_8 Forward -189 -180 18.3876 0.000699
NP_440670.1_8 Reverse -180 -189 18.3876 0.000699
NP_440886.1_7 Reverse -179 -189 17.7774 0.0011
NP_440886.1_7 Forward -190 -180 7.94438 0.0805
NP_440886.1_7 Reverse -377 -387 4.99446 0.205
NP_440828.1_1 Forward -187 -168 0.0970122 0.269
NP_442717.1_8 Forward -149 -130 12.29 0.299
NP_442072.1_9 Forward -190 -172 -5.58572 0.0658
NP_440907.2_8 Forward -188 -178 17.4824 0.00685
NP_441021.1_1 Forward -188 -169 -8.85033 0.201
NP_441021.1_1 Reverse -181 -200 -10.227 0.232
NP_441021.1_1 Forward -179 -160 -11.8986 0.275
NP_441463.1_3 Forward -199 -180 -0.983855 0.135
NP_441463.1_3 Reverse -170 -189 -7.76869 0.261
NP_441463.1_6 Forward -191 -177 6.02939 0.283
NP_441626.1_2 Forward -188 -181 15.7721 0.0124
NP_441626.1_2 Reverse -181 -188 15.7721 0.0124
NP_442365.1_7 Reverse -176 -195 0.294447 0.177
NP_442365.1_7 Forward -193 -174 -1.27885 0.191
NP_442238.1_3 Reverse -95 -114 7.86593 0.197
NP_442209.1_4 Reverse -375 -394 7.66927 0.299
NP_440107.1_5 Forward -190 -171 -3.63879 0.18
NP_442794.1_1 Forward -193 -181 7.4138 0.138
NP_441962.1_4 Reverse -166 -185 -1.47551 0.123
NP_441962.1_4 Reverse -175 -194 -7.27704 0.187
NP_441962.1_4 Forward -194 -175 -8.752 0.206
NP_441742.1_7 Forward -183 -164 14.0608 0.245
NP_440387.1_1 Forward -189 -173 15.2015 0.00558
NP_440387.1_1 Reverse -180 -196 5.6634 0.0311
NP_441431.1_2 Reverse -177 -191 10.717 0.155
NP_442084.1_6 Reverse -147 -165 5.23069 0.267
NP_440467.1_3 Forward -114 -95 11.8422 0.265
NP_440114.1_10 Reverse -180 -194 6.3911 0.273
NP_442437.1_8 Forward -188 -169 4.32602 0.261
NP_440766.1_4 Reverse -176 -190 8.16106 0.0871
NP_442743.1_4 Forward -188 -169 -6.09707 0.278
NP_440457.1_1 Reverse -176 -188 7.21714 0.105
NP_440457.1_1 Forward -193 -181 -0.649339 0.271
NP_440798.1_6 Forward -188 -175 3.5592 0.15
NP_442130.1_8 Reverse -251 -270 7.4718 0.235
NP_440473.1_9 Reverse -169 -188 -12.3902 0.297
NP_442509.1_9 Forward -189 -179 16.2041 0.00739
NP_442509.1_9 Reverse -180 -190 8.14104 0.192
NP_440554.1_4 Forward -188 -178 13.943 0.0218
NP_440554.1_4 Reverse -181 -191 8.92815 0.0646
NP_441885.1_5 Reverse -180 -190 20.9245 0.000538
NP_441885.1_5 Forward -189 -179 11.4848 0.00668
NP_440478.1_10 Reverse -178 -192 17.9942 0.107
NP_442341.1_7 Forward -190 -176 21.6324 0.00413
NP_441173.1_9 Reverse -193 -201 9.85212 0.275
NP_440191.1_4 Reverse -194 -204 13.342 0.282
NP_440423.1_6 Forward -324 -305 -21.24 0.284
NP_443000.1_7 Forward -191 -181 19.9412 0.00223
NP_443000.1_7 Reverse -178 -188 2.04498 0.226
NP_441842.1_10 Reverse -173 -187 8.94771 0.203
NP_440275.1_3 Reverse -178 -188 17.9746 0.0082
NP_440275.1_3 Forward -191 -181 15.123 0.0182
NP_440091.1_1 Reverse -176 -188 10.1671 0.0498
NP_440091.1_1 Forward -193 -181 -0.452677 0.273
NP_442275.1_1 Forward -189 -170 1.76941 0.284
NP_441902.1_3 Forward -66 -56 12.1071 0.274
NP_440679.1_10 Reverse -164 -183 -20.65 0.286
NP_443010.1_10 Reverse -177 -194 7.02268 0.179
NP_442451.1_2 Reverse -172 -191 -6.68705 0.232
NP_442451.1_2 Forward -102 -83 -7.17871 0.232
NP_441122.1_1 Reverse -247 -262 3.42148 0.281
NP_440175.1_7 Reverse -228 -246 10.1438 0.267
NP_442495.1_5 Reverse -246 -265 6.19431 0.291
NP_440149.1_8 Forward -189 -170 1.27776 0.127
NP_440216.1_1 Reverse -180 -194 6.98109 0.0111
NP_440216.1_1 Forward -189 -175 -1.27871 0.0303
NP_440172.1_1 Reverse -180 -190 15.0247 0.00945
NP_440172.1_1 Forward -189 -179 8.73149 0.0586
NP_442015.1_10 Reverse -176 -189 12.9006 0.0365
NP_442015.1_10 Forward -193 -180 2.77255 0.187
NP_441045.1_4 Reverse -10 -29 18.879 0.264
NP_441226.1_7 Forward -188 -181 14.4934 0.0123
NP_441226.1_7 Reverse -181 -188 14.4934 0.0123
NP_441111.1_7 Forward -188 -180 18.7023 0.00294
NP_441111.1_7 Reverse -181 -189 18.7023 0.00294
NP_439971.2_5 Reverse -332 -351 12.0942 0.288
NP_441766.1_2 Forward -189 -180 17.5026 0.00297
NP_441766.1_2 Reverse -180 -189 17.5026 0.00297
NP_442417.1_5 Forward -357 -343 5.99778 0.241
NP_442417.1_5 Forward -354 -340 5.70279 0.252
NP_443052.1_8 Reverse -170 -189 0.491109 0.0662
NP_443052.1_8 Forward -199 -180 -7.27704 0.156
NP_440820.2_4 Reverse -264 -283 4.22769 0.252
NP_441135.1_3 Reverse -243 -262 7.86593 0.283
NP_442403.1_9 Forward -192 -173 8.75091 0.191
NP_442154.1_1 Forward -347 -329 -15.8121 0.225
NP_442154.1_1 Forward -350 -332 -17.3854 0.254
NP_441430.1_2 Forward -262 -243 -5.21209 0.298
NP_440261.1_5 Forward -188 -175 -2.63565 0.0924
NP_440261.1_5 Reverse -181 -194 -12.0754 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGAAGAACAAATGCAGGTGGCCGAGCAAATTTACACAGAATTCCAGGCCGCCGAGGTAGATGTGCTGCTGGATGACCGCAACGAACGGGCCGGGGTCAAATTTAAAGACTCTGAACTTATTGGCATTCCTTATCGGGTTGTCACCGGCAAATCCCTCAAACAAGGACAGCTAGAAGTGGTCAAGCGGGCCGATAAAAGTGTGCAAAATCTGGCGATCGCCGCCGTTGTCCCCACCTTAACTGCCTGGATCAAAGCAGAGAAAAAGACTAGTTAAAACTACTTAGTCCTAGGGCCAGTCCAGTTGCAGAAATAGCACCCTTTTGCCCCAGCTTTTTAGGGAAAAATGCTATGGTCAATGTGTCTTGAATATCTTGAATCACTTTTTCCAGAGGGTAAGTT

CDS

GTGATGAAATCTTTACTGCGGGGAATTGCCCTATCCGTGTCGGTGTTGATGGCCACAGGGGGCTATGGATTAACCACTTCAGCCCAGGTAGCTCCAGGGGATGACATACCCACCGTGCAAGAGGCTTTGGATACCCCCGATGTAGATGACATCACCGACCAACCCGACCAGTTGATCACTTGGATATGTAAAAACGGTAGTAAAAGTGTTGCTGTAGAAGTTAAGGAGCTGAAAGGTTGGCAGGAAACCGTTAACCCAGACCAGACTTGGGCATGCGAACAAAATATTCCCTCCGTTGATCCAGGGGATGCCACTTTTTCTTGTGAAACTAACGCCACCATGGGCTTAATCACTGTCTTTTGGCTAGAAGGGGAAGGCGGTAAAGCAGAGATGACAAGCTGGATGAATAACTTAGCTAATAATCAAAATATGGTCTGCACCCACGGCCAGAGTAATCCCTTTTGGGAATAG

Protein

MMKSLLRGIALSVSVLMATGGYGLTTSAQVAPGDDIPTVQEALDTPDVDDITDQPDQLITWICKNGSKSVAVEVKELKGWQETVNPDQTWACEQNIPSVDPGDATFSCETNATMGLITVFWLEGEGGKAEMTSWMNNLANNQNMVCTHGQSNPFWE