Your browser is old and dusty. Try Google Chrome!

Details for sll1423

ORF sll1423
Accession NP_441331.1
Symbol ntcA, ycf28
Category global nitrogen regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -79 -93 11.2093 0.0531
NP_441418.1_6 Forward -130 -111 -30.2865 0.267
NP_440897.1_6 Forward -282 -263 -4.22953 0.27
NP_441453.1_4 Reverse -121 -129 7.29591 0.0589
NP_441453.1_4 Forward -130 -122 6.70593 0.121
NP_441453.1_4 Forward -276 -268 3.85433 0.284
NP_442151.1_6 Reverse -267 -281 7.37441 0.2
NP_440561.1_4 Forward -145 -126 18.6573 0.112
NP_440226.1_1 Forward -130 -111 11.2092 0.0558
NP_441465.1_8 Reverse -117 -135 10.2456 0.193
NP_442169.1_1 Forward -94 -75 -2.65548 0.279
NP_440120.1_4 Reverse -378 -392 13.4709 0.29
NP_442744.1_8 Reverse -121 -140 -6.68705 0.297
NP_442173.1_1 Forward -129 -121 7.59091 0.163
NP_442173.1_1 Reverse -122 -130 5.82095 0.2
NP_442752.1_3 Reverse -282 -292 14.8879 0.288
NP_442752.1_4 Forward -130 -123 13.8055 0.0199
NP_442752.1_4 Reverse -192 -199 5.34899 0.221
NP_443027.1_4 Forward -278 -268 6.46988 0.275
NP_440784.1_7 Reverse -122 -129 6.23397 0.241
NP_440784.1_7 Forward -129 -122 6.13563 0.241
NP_442062.1_8 Forward -130 -120 9.61647 0.0587
NP_442062.1_8 Reverse -121 -131 7.25653 0.104
NP_442062.1_8 Forward -276 -266 3.32329 0.275
NP_442062.1_8 Reverse -273 -283 3.22496 0.279
NP_442242.1_4 Forward -129 -122 12.4288 0.0393
NP_441594.1_6 Reverse -115 -134 2.16274 0.255
NP_440370.1_10 Reverse -112 -131 11.5042 0.181
NP_441925.1_4 Reverse -129 -148 -17.5041 0.296
NP_440273.1_1 Forward -354 -335 13.3207 0.243
NP_441083.1_5 Reverse -267 -277 -0.0199663 0.251
NP_441083.1_5 Forward -282 -272 -0.41329 0.267
NP_441434.1_7 Reverse -123 -137 2.35953 0.288
NP_441738.1_2 Reverse -123 -130 15.28 0.0102
NP_440209.1_1 Forward -130 -122 14.8674 0.012
NP_440209.1_1 Reverse -267 -275 2.1827 0.254
NP_442889.1_1 Reverse -186 -205 -12.6852 0.238
NP_440447.1_1 Forward -135 -117 15.4571 0.104
NP_442570.1_3 Reverse -265 -284 -6.78538 0.259
NP_442570.1_3 Reverse -190 -209 -8.06369 0.279
NP_440331.1_6 Reverse -26 -45 -8.06369 0.296
NP_441716.1_1 Forward -331 -317 5.21113 0.239
NP_441716.1_1 Forward -282 -268 4.81781 0.248
NP_441163.1_1 Forward -326 -309 7.90458 0.235
NP_440906.1_5 Forward -129 -122 12.0355 0.0724
NP_440906.1_5 Reverse -122 -129 12.0355 0.0724
NP_440747.1_10 Reverse -264 -276 -2.81262 0.0713
NP_440747.1_10 Forward -133 -121 -4.48425 0.101
NP_440747.1_10 Reverse -189 -201 -12.4491 0.282
NP_441486.1_1 Reverse -118 -132 1.86788 0.0969
NP_441486.1_1 Reverse -270 -284 1.57289 0.106
NP_441486.1_1 Forward -304 -290 -1.77037 0.175
NP_441486.1_1 Forward -133 -119 -5.31028 0.231
NP_441486.1_1 Forward -279 -265 -5.9986 0.272
NP_441880.2_7 Forward -327 -308 17.8957 0.153
NP_440403.1_10 Forward -385 -366 4.81767 0.251
NP_440842.1_10 Reverse -197 -211 3.53951 0.255
NP_441014.1_5 Forward -287 -269 14.0805 0.2
NP_441014.1_10 Forward -39 -20 -3.24622 0.297
NP_442848.1_1 Reverse -115 -129 -4.22864 0.282
NP_443018.1_3 Forward -275 -268 11.3472 0.0846
NP_443018.1_3 Forward -129 -122 5.34899 0.212
NP_443018.1_3 Reverse -122 -129 5.34899 0.212
NP_443018.1_3 Reverse -268 -275 4.16902 0.278
NP_440376.1_1 Reverse -273 -282 2.458 0.221
NP_440376.1_1 Reverse -121 -130 -0.000272808 0.285
NP_440376.1_1 Forward -130 -121 -0.0986038 0.285
NP_441588.1_4 Reverse -269 -279 7.64985 0.178
NP_441588.1_4 Reverse -123 -133 7.35486 0.178
NP_442687.1_7 Forward -131 -121 13.2547 0.0562
NP_442958.1_3 Reverse -110 -129 -0.885524 0.268
NP_440042.1_2 Forward -292 -273 -2.45882 0.261
NP_442658.1_1 Reverse -119 -129 14.5325 0.0229
NP_442658.1_1 Forward -132 -122 6.0761 0.238
NP_442198.1_3 Reverse -310 -329 6.39097 0.251
NP_440141.1_8 Reverse -2 -21 7.27595 0.243
NP_442782.1_2 Forward -312 -298 0.294584 0.291
NP_442937.1_5 Forward -98 -79 7.27595 0.258
NP_441958.1_5 Forward -131 -121 1.455 0.0956
NP_441127.1_1 Forward -217 -203 9.2427 0.278
NP_441127.1_1 Forward -93 -79 8.45605 0.295
NP_441127.1_1 Reverse -373 -387 7.57108 0.3
NP_441097.1_2 Forward -274 -257 2.89044 0.293
NP_439990.1_5 Reverse -187 -200 5.52582 0.289
NP_442064.1_1 Reverse -262 -281 -12.4886 0.277
NP_442064.1_4 Reverse -263 -282 13.6666 0.147
NP_442064.1_4 Forward -386 -367 7.86512 0.237
NP_442064.1_10 Reverse -223 -242 16.2241 0.127
NP_443055.1_6 Forward -145 -127 -1.25988 0.276
NP_440138.1_6 Forward -281 -262 5.01354 0.23
NP_441099.1_5 Reverse -257 -276 -8.06369 0.187
NP_442002.1_9 Forward -131 -124 10.7572 0.185
NP_441938.1_1 Forward -22 -3 2.3594 0.272
NP_440411.1_10 Forward -45 -26 8.8954 0.293
NP_442438.1_10 Forward -135 -121 1.37622 0.197
NP_440879.1_6 Reverse -116 -135 16.1257 0.0206
NP_441110.1_10 Forward -297 -278 18.6823 0.0948
NP_440147.1_4 Forward -132 -119 9.2624 0.0423
NP_441331.1_5 Forward -21 -2 13.8633 0.294
NP_441916.1_7 Reverse -121 -131 9.61647 0.0333
NP_441916.1_7 Forward -130 -120 6.56821 0.0919
NP_441916.1_10 Reverse -27 -46 1.76941 0.262
NP_440206.1_4 Forward -131 -112 0.293673 0.289
NP_441041.1_4 Reverse -292 -311 -1.08219 0.1
NP_441041.1_4 Forward -282 -263 -2.16383 0.108
NP_441041.1_4 Reverse -121 -140 -5.01543 0.146
NP_441041.1_7 Reverse -118 -130 5.47405 0.255
NP_439966.1_7 Reverse -265 -275 4.01116 0.295
NP_439966.1_9 Reverse -119 -128 0.983037 0.253
NP_439966.1_9 Forward -132 -123 0.884706 0.253
NP_442941.1_3 Reverse -268 -278 0.373358 0.212
NP_440983.1_5 Forward -325 -306 2.85105 0.199
NP_442281.1_1 Forward -135 -121 6.88214 0.113
NP_441334.1_7 Reverse -119 -138 -13.3736 0.208
NP_440437.1_1 Forward -136 -117 3.34271 0.123
NP_442012.1_1 Forward -136 -117 6.39097 0.13
NP_442012.1_1 Reverse -115 -134 -0.787193 0.267
NP_443030.1_4 Reverse -105 -124 0.58944 0.222
NP_441644.1_6 Forward -282 -272 6.0761 0.167
NP_441644.1_6 Reverse -267 -277 4.10949 0.249
NP_443049.1_6 Forward -366 -356 12.812 0.231
NP_442215.1_2 Forward -285 -269 12.6449 0.0289
NP_442215.1_2 Forward -129 -113 -2.89139 0.206
NP_442215.1_2 Reverse -119 -135 -3.57971 0.218
NP_442247.1_8 Forward -132 -118 8.55439 0.272
NP_442933.1_10 Forward -130 -121 13.9627 0.0192
NP_442933.1_10 Reverse -121 -130 8.1612 0.0885
NP_441751.2_8 Reverse -268 -282 -5.31028 0.202
NP_442554.1_8 Reverse -268 -278 4.99491 0.163
NP_442554.1_8 Reverse -122 -132 3.51995 0.222
NP_442167.1_6 Forward -211 -195 13.7258 0.228
NP_441762.1_7 Reverse -120 -132 11.347 0.0142
NP_441762.1_7 Forward -131 -119 4.26721 0.0518
NP_442142.1_4 Forward -279 -266 6.70522 0.158
NP_442142.1_4 Reverse -264 -277 6.31189 0.169
NP_442142.1_4 Reverse -139 -152 5.42692 0.192
NP_442142.1_4 Forward -133 -120 5.13193 0.201
NP_442142.1_4 Forward -204 -191 3.55864 0.251
NP_442292.1_1 Reverse -122 -131 -0.0986038 0.239
NP_442476.1_6 Forward -129 -115 10.521 0.0692
NP_443009.1_5 Reverse -120 -131 4.67974 0.234
NP_441448.1_2 Forward -206 -187 -0.886293 0.266
NP_440379.1_5 Forward -385 -366 -11.0136 0.288
NP_441468.1_1 Reverse -122 -129 6.13563 0.209
NP_441468.1_1 Forward -129 -122 6.0373 0.223
NP_441468.1_1 Reverse -268 -275 3.97235 0.277
NP_441020.2_6 Reverse -119 -136 7.90532 0.215
NP_441015.1_10 Forward -156 -137 -2.55715 0.178
NP_441673.1_1 Reverse -121 -130 1.37636 0.114
NP_441673.1_1 Forward -130 -121 1.1797 0.163
NP_441826.1_2 Forward -282 -268 15.3392 0.0196
NP_441826.1_2 Forward -136 -122 2.75286 0.12
NP_441330.1_5 Reverse -101 -120 10.6192 0.227
NP_441764.1_8 Reverse -94 -104 11.0236 0.287
NP_441612.1_2 Reverse -280 -290 13.1963 0.21
NP_442559.1_3 Reverse -87 -106 6.88262 0.297
NP_442361.1_3 Forward -136 -123 13.9823 0.129
NP_442427.1_3 Forward -312 -294 1.00246 0.232
NP_442808.1_1 Reverse -120 -130 8.63269 0.0481
NP_442808.1_1 Reverse -355 -365 2.73286 0.256
NP_440145.1_3 Forward -140 -121 -2.45882 0.17
NP_442542.1_2 Forward -284 -271 6.1158 0.234
NP_440601.1_3 Reverse -110 -129 18.7807 0.0925
NP_441114.1_3 Forward -281 -272 7.66954 0.231
NP_441114.1_3 Reverse -275 -284 7.66954 0.231
NP_441878.1_6 Forward -283 -273 2.24165 0.0462
NP_441878.1_6 Forward -332 -322 0.0783647 0.152
NP_441878.1_6 Reverse -273 -283 -6.70647 0.194
NP_441036.1_8 Reverse -120 -130 15.9097 0.00724
NP_441557.1_5 Forward -130 -121 8.84951 0.0343
NP_441557.1_5 Reverse -121 -130 0.786375 0.106
NP_441445.1_1 Reverse -264 -283 3.34271 0.215
NP_442267.1_4 Reverse -315 -334 12.1925 0.088
NP_440101.1_3 Reverse -116 -135 2.0644 0.259
NP_440547.1_1 Forward -387 -368 9.7334 0.237
NP_441037.1_4 Forward -132 -122 13.6524 0.0561
NP_441037.1_4 Forward -142 -132 12.4829 0.0993
NP_441633.1_3 Forward -132 -119 0.904263 0.112
NP_441633.1_3 Reverse -145 -158 -5.29059 0.234
NP_440136.1_2 Reverse -122 -129 6.23397 0.171
NP_440136.1_2 Forward -129 -122 6.13563 0.193
NP_442590.1_10 Reverse -121 -140 6.4893 0.244
NP_442998.1_5 Reverse -32 -42 9.51814 0.238
NP_442998.1_10 Reverse -123 -130 15.5754 0.0102
NP_442998.1_10 Reverse -269 -276 6.23397 0.157
NP_440299.1_1 Forward -134 -121 16.4399 0.0101
NP_440299.1_1 Forward -389 -376 2.96866 0.265
NP_440299.1_2 Reverse -290 -309 16.6174 0.293
NP_440299.1_6 Reverse -233 -252 5.99764 0.268
NP_441799.1_1 Reverse -117 -131 7.07881 0.153
NP_442201.1_10 Forward -141 -122 -11.1119 0.266
NP_441559.1_8 Forward -195 -181 -4.52363 0.227
NP_441559.1_8 Reverse -126 -140 -6.19526 0.275
NP_441270.1_5 Forward -100 -81 15.6292 0.191
NP_441395.1_8 Reverse -282 -301 12.7825 0.163
NP_440134.1_2 Reverse -271 -290 -0.000545616 0.298
NP_442866.1_1 Reverse -116 -135 -1.37718 0.203
NP_440695.1_5 Forward -276 -257 4.32602 0.203
NP_442386.1_9 Reverse -120 -129 7.07914 0.219
NP_442386.1_9 Reverse -111 -120 6.48915 0.219
NP_442386.1_9 Forward -131 -122 5.89917 0.233
NP_441340.1_5 Forward -129 -122 6.13563 0.175
NP_441340.1_5 Reverse -122 -129 5.93897 0.198
NP_441340.1_5 Forward -275 -268 4.07068 0.239
NP_440168.1_4 Reverse -263 -282 -7.4737 0.283
NP_440168.1_8 Forward -382 -363 16.2241 0.081
NP_442240.1_2 Reverse -122 -141 -10.817 0.137
NP_440161.1_3 Reverse -271 -290 8.75091 0.264
NP_440586.1_8 Forward -275 -268 12.8218 0.0395
NP_440586.1_8 Forward -129 -122 11.4451 0.0645
NP_442251.1_6 Reverse -122 -129 12.0355 0.0627
NP_442959.1_5 Reverse -298 -317 4.71934 0.3
NP_441262.1_3 Forward -130 -123 14.7888 0.0223
NP_440027.1_3 Reverse -111 -129 14.178 0.12
NP_440027.1_3 Reverse -121 -139 6.40989 0.225
NP_443051.1_1 Forward -131 -122 0.786375 0.125
NP_439937.1_9 Forward -283 -266 -16.8747 0.289
NP_442374.1_3 Forward -390 -373 15.4768 0.185
NP_440439.1_1 Reverse -118 -131 -0.0790467 0.207
NP_440439.1_1 Forward -133 -120 -0.275709 0.211
NP_440372.1_2 Forward -129 -122 6.72562 0.0929
NP_440372.1_2 Reverse -122 -129 6.62729 0.151
NP_440171.1_3 Reverse -16 -35 2.85105 0.285
NP_441789.1_7 Reverse -138 -157 -3.63955 0.277
NP_439977.1_5 Reverse -261 -280 -3.04881 0.295
NP_439977.1_5 Reverse -361 -380 -3.14714 0.296
NP_440267.1_2 Reverse -142 -156 7.17714 0.207
NP_442887.1_5 Forward -314 -295 -12.6852 0.281
NP_442384.1_10 Reverse -121 -134 11.819 0.0326
NP_442384.1_10 Forward -282 -269 5.32916 0.131
NP_442114.1_4 Forward -130 -119 9.00679 0.176
NP_442114.1_4 Reverse -121 -132 7.23683 0.291
NP_440364.1_10 Reverse -187 -206 15.6341 0.256
NP_441018.1_7 Reverse -188 -207 11.3075 0.188
NP_441018.1_7 Forward -97 -78 8.45592 0.246
NP_441018.1_7 Reverse -306 -325 7.17762 0.276
NP_442262.1_10 Forward -275 -268 10.3639 0.153
NP_442262.1_10 Reverse -289 -296 7.21728 0.281
NP_442244.1_6 Reverse -78 -97 7.37428 0.225
NP_440163.1_10 Forward -279 -269 11.5831 0.169
NP_440344.1_10 Forward -208 -191 -11.0726 0.2
NP_440531.1_6 Reverse -113 -132 -1.96717 0.241
NP_442123.1_10 Forward -100 -81 6.19431 0.288
NP_440189.1_10 Forward -293 -274 5.70265 0.279
NP_440487.1_1 Reverse -118 -137 0.687771 0.214
NP_441965.1_10 Forward -279 -263 3.50012 0.263
NP_441965.1_10 Reverse -118 -134 2.41848 0.288
NP_441640.1_8 Forward -281 -262 -4.91709 0.269
NP_440297.1_9 Reverse -268 -278 -0.806614 0.297
NP_442280.1_10 Forward -311 -293 6.13623 0.28
NP_441592.1_4 Reverse -267 -286 -1.96717 0.26
NP_440937.1_5 Forward -127 -108 7.86593 0.287
NP_442078.1_3 Forward -329 -310 5.01354 0.186
NP_440999.1_9 Reverse -117 -131 0.196253 0.191
NP_442033.1_10 Forward -142 -123 -5.70374 0.18
NP_442033.1_10 Reverse -119 -138 -11.8003 0.258
NP_442077.1_9 Forward -111 -92 -3.83545 0.22
NP_441543.1_2 Reverse -122 -131 8.75118 0.0968
NP_441543.1_2 Forward -129 -120 5.99792 0.159
NP_442845.1_2 Forward -282 -268 5.89945 0.22
NP_441469.1_8 Forward -131 -122 6.29291 0.227
NP_442337.1_6 Reverse -191 -210 13.8369 0.245
NP_442337.1_8 Reverse -262 -281 7.47261 0.191
NP_442578.1_7 Forward -129 -122 5.93897 0.183
NP_440220.1_4 Forward -314 -295 9.93006 0.151
NP_441462.1_2 Forward -130 -120 1.16001 0.0976
NP_441462.1_2 Reverse -273 -283 -1.29827 0.299
NP_441462.1_5 Reverse -16 -35 0.392778 0.296
NP_441621.1_7 Reverse -119 -133 -1.5737 0.182
NP_442204.1_1 Forward -134 -123 8.7118 0.0852
NP_442204.1_5 Forward -140 -121 1.17943 0.241
NP_442204.1_6 Reverse -264 -283 6.98095 0.24
NP_442204.1_6 Reverse -118 -137 4.12936 0.297
NP_440516.1_8 Forward -130 -121 8.1612 0.0417
NP_440516.1_8 Forward -276 -267 0.688044 0.136
NP_442428.1_5 Reverse -122 -129 6.13563 0.209
NP_442428.1_5 Forward -129 -122 6.0373 0.212
NP_442428.1_5 Reverse -268 -275 4.36568 0.271
NP_442120.1_10 Reverse -304 -323 -9.14533 0.242
NP_440603.1_6 Reverse -282 -300 14.4738 0.269
NP_440673.1_3 Reverse -123 -130 12.4288 0.0426
NP_440673.1_3 Forward -380 -373 7.80726 0.244
NP_440673.1_3 Reverse -215 -222 5.54565 0.288
NP_441052.1_2 Reverse -267 -277 7.55152 0.0685
NP_441052.1_2 Forward -276 -266 3.81494 0.173
NP_441052.1_2 Forward -201 -191 -0.708283 0.294
NP_440436.1_4 Reverse -122 -131 14.9456 0.0103
NP_440436.1_4 Forward -129 -120 13.6673 0.0225
NP_440436.1_4 Forward -200 -191 7.76745 0.124
NP_441884.1_8 Forward -131 -112 3.73603 0.0952
NP_441719.1_4 Forward -129 -122 6.72562 0.093
NP_441719.1_4 Reverse -122 -129 6.62729 0.151
NP_441004.1_1 Reverse -310 -329 -17.3068 0.29
NP_441004.1_4 Forward -285 -275 14.533 0.175
NP_441004.1_5 Forward -286 -272 6.88276 0.296
NP_442813.1_5 Forward -48 -29 9.14423 0.166
NP_442366.1_3 Reverse -120 -138 -2.53746 0.229
NP_442366.1_5 Forward -133 -123 11.9759 0.148
NP_442694.1_4 Reverse -309 -318 14.1594 0.2
NP_442206.1_10 Forward -130 -115 1.15987 0.236
NP_440328.1_4 Forward -136 -117 9.83255 0.092
NP_443054.1_2 Reverse -32 -46 5.40779 0.236
NP_441851.1_10 Forward -131 -121 7.45319 0.14
NP_442011.1_1 Forward -131 -112 -2.16383 0.272
NP_441982.1_6 Reverse -279 -288 12.5809 0.274
NP_440463.1_8 Forward -383 -364 6.43495 0.269
NP_440463.1_8 Forward -299 -280 5.17639 0.292
NP_441409.1_6 Forward -162 -143 -7.08038 0.142
NP_440389.1_1 Forward -205 -186 13.5683 0.142
NP_440431.1_4 Forward -361 -342 -2.62645 0.224
NP_440588.1_2 Forward -285 -266 -3.54046 0.189
NP_440023.1_7 Forward -103 -84 8.84924 0.265
NP_441570.1_1 Forward -282 -264 -17.8771 0.295
NP_440078.1_10 Reverse -121 -140 2.75272 0.269
NP_441078.1_4 Reverse -121 -130 0.196389 0.205
NP_441078.1_4 Forward -130 -121 -0.000272808 0.205
NP_441078.1_4 Forward -282 -273 -1.6719 0.266
NP_440707.1_6 Reverse -139 -158 13.6666 0.173
NP_440526.1_3 Reverse -79 -90 0.844851 0.267
NP_442344.1_7 Reverse -122 -141 -6.39206 0.171
NP_441732.1_2 Forward -134 -118 -7.61128 0.0861
NP_442797.1_6 Reverse -306 -325 10.9398 0.238
NP_442274.1_8 Forward -383 -365 13.856 0.286
NP_440199.1_10 Forward -279 -269 18.3679 0.0381
NP_440199.1_10 Reverse -244 -254 11.4848 0.158
NP_440199.1_10 Reverse -270 -280 7.45319 0.231
NP_440578.1_2 Forward -99 -81 11.0322 0.3
NP_441057.1_3 Forward -223 -204 -11.2103 0.223
NP_440913.1_1 Reverse -190 -208 9.45892 0.178
NP_442407.1_1 Forward -153 -134 23.0089 0.014
NP_442407.1_2 Forward -186 -167 11.405 0.206
NP_440713.1_4 Reverse -263 -282 1.96607 0.273
NP_442489.1_7 Reverse -267 -276 5.21127 0.077
NP_442489.1_7 Reverse -121 -130 0.884706 0.145
NP_442489.1_7 Forward -130 -121 0.491382 0.178
NP_442489.1_7 Forward -282 -273 -1.47524 0.203
NP_442489.1_7 Reverse -273 -282 -1.96689 0.28
NP_440559.1_1 Reverse -122 -131 5.50626 0.14
NP_441659.2_8 Reverse -121 -131 0.176696 0.271
NP_441040.1_5 Forward -287 -268 3.24438 0.275
NP_442346.1_5 Forward -131 -121 7.15819 0.178
NP_442346.1_5 Forward -283 -273 4.60159 0.281
NP_442346.1_5 Reverse -117 -127 4.60159 0.281
NP_440545.1_3 Forward -134 -117 -4.68105 0.23
NP_440545.1_3 Reverse -363 -380 -7.04099 0.295
NP_440459.1_2 Reverse -265 -282 14.0018 0.119
NP_440459.1_2 Reverse -119 -136 11.7402 0.166
NP_442551.1_4 Reverse -271 -286 -1.39674 0.245
NP_440847.1_3 Reverse -354 -368 11.2087 0.271
NP_441833.1_4 Reverse -122 -129 14.1004 0.0258
NP_441833.1_4 Forward -129 -122 6.13563 0.198
NP_440751.1_3 Forward -29 -10 5.89851 0.29
NP_441895.1_10 Forward -240 -221 -19.1751 0.282
NP_442162.1_9 Reverse -122 -129 6.62729 0.142
NP_442162.1_9 Forward -129 -122 6.52896 0.178
NP_440671.1_4 Forward -282 -268 5.21113 0.289
NP_442140.1_3 Forward -129 -119 15.713 0.0367
NP_442140.1_3 Reverse -122 -132 6.76487 0.159
NP_442140.1_3 Reverse -129 -139 3.51995 0.294
NP_440875.1_2 Reverse -351 -370 8.65258 0.203
NP_440875.1_9 Reverse -123 -133 9.15072 0.233
NP_441813.1_5 Forward -132 -122 0.0783647 0.222
NP_441813.1_5 Reverse -119 -129 -0.314959 0.239
NP_440590.1_4 Reverse -122 -135 8.77074 0.042
NP_440590.1_4 Forward -139 -126 -4.40561 0.261
NP_440567.1_1 Forward -129 -115 -0.0987402 0.264
NP_442497.1_10 Reverse -122 -131 0.688044 0.141
NP_440821.1_4 Forward -132 -122 0.373358 0.18
NP_440821.1_4 Reverse -119 -129 0.275027 0.19
NP_441239.1_9 Reverse -119 -131 7.80712 0.148
NP_441239.1_9 Forward -284 -272 7.11881 0.169
NP_441239.1_9 Reverse -145 -157 4.07055 0.264
NP_441892.1_1 Forward -139 -122 -4.09106 0.255
NP_442399.1_3 Forward -241 -222 12.3827 0.17
NP_442044.1_1 Reverse -128 -147 6.09597 0.119
NP_442193.1_1 Forward -157 -139 11.7205 0.224
NP_441017.1_6 Forward -280 -266 15.5352 0.102
NP_441567.1_4 Reverse -300 -319 3.53937 0.281
NP_440354.1_7 Reverse -267 -285 11.0322 0.224
NP_440546.1_4 Forward -130 -120 11.5004 0.0806
NP_441230.1_5 Forward -25 -6 2.55606 0.212
NP_440462.1_6 Reverse -119 -129 7.74818 0.0699
NP_440462.1_6 Forward -367 -357 3.02829 0.264
NP_440868.1_4 Reverse -263 -275 7.02048 0.0787
NP_440868.1_4 Reverse -117 -129 4.36554 0.121
NP_440868.1_4 Forward -134 -122 -0.944332 0.284
NP_440374.1_6 Forward -102 -83 8.35759 0.299
NP_442402.1_4 Reverse -49 -68 -6.09781 0.25
NP_440696.1_3 Reverse -117 -135 -0.964162 0.249
NP_440696.1_3 Reverse -263 -281 -2.83245 0.279
NP_440696.1_6 Forward -294 -275 7.47261 0.255
NP_442837.1_3 Reverse -122 -129 6.13563 0.25
NP_442837.1_3 Forward -129 -122 5.93897 0.265
NP_442053.1_1 Reverse -267 -276 4.42462 0.249
NP_440505.1_3 Reverse -190 -200 14.6313 0.019
NP_440505.1_3 Forward -132 -122 5.48657 0.227
NP_441203.1_1 Reverse -122 -141 -11.8986 0.139
NP_442532.1_7 Forward -130 -116 4.42448 0.171
NP_440914.1_1 Forward -282 -272 12.5188 0.0569
NP_441011.1_8 Forward -129 -120 8.45619 0.144
NP_441011.1_8 Reverse -122 -131 7.17789 0.179
NP_442101.1_10 Reverse -139 -158 -6.1954 0.183
NP_442533.1_6 Forward -130 -121 5.3096 0.145
NP_442533.1_6 Forward -282 -273 4.71961 0.177
NP_442229.1_1 Reverse -119 -133 11.7987 0.18
NP_441482.1_7 Forward -136 -122 -8.8502 0.193
NP_439944.1_9 Reverse -268 -278 6.76487 0.168
NP_439944.1_9 Forward -129 -119 6.76487 0.168
NP_441028.1_6 Reverse -351 -361 7.45273 0.229
NP_441602.1_3 Reverse -186 -205 -5.80207 0.298
NP_441106.1_1 Reverse -120 -129 13.9627 0.0279
NP_441106.1_1 Forward -131 -122 8.35786 0.0585
NP_001035870.1_3 Forward -294 -275 -5.40875 0.28
NP_440797.1_8 Forward -193 -174 15.4476 0.268
NP_441286.1_1 Reverse -191 -203 0.923956 0.102
NP_441286.1_1 Forward -131 -119 -6.5492 0.267
NP_440670.1_8 Reverse -121 -130 6.98123 0.0882
NP_440670.1_8 Reverse -273 -282 5.01461 0.175
NP_440886.1_7 Forward -21 -11 5.78111 0.163
NP_440886.1_7 Forward -131 -121 4.50281 0.232
NP_440886.1_7 Reverse -355 -365 4.20782 0.249
NP_442614.1_2 Forward -276 -262 7.66941 0.268
NP_440205.1_3 Forward -373 -354 10.4225 0.174
NP_441403.1_4 Forward -99 -81 12.2122 0.282
NP_442963.1_3 Forward -142 -124 14.4738 0.273
NP_440907.2_8 Forward -129 -119 4.99446 0.228
NP_440907.2_8 Reverse -122 -132 4.89613 0.235
NP_442264.1_2 Reverse -263 -280 7.11867 0.247
NP_441463.1_3 Forward -30 -11 1.96607 0.123
NP_441463.1_3 Reverse -263 -282 -6.98204 0.253
NP_441626.1_2 Forward -129 -122 6.0373 0.212
NP_441626.1_2 Reverse -122 -129 6.0373 0.212
NP_442211.1_3 Reverse -292 -311 8.05558 0.275
NP_442794.1_1 Forward -134 -122 2.59558 0.287
NP_441401.1_4 Forward -352 -339 13.294 0.28
NP_442615.1_1 Forward -139 -121 -5.19239 0.206
NP_441962.1_4 Reverse -362 -381 -12.5869 0.26
NP_440387.1_1 Forward -130 -114 3.10679 0.0651
NP_440387.1_1 Reverse -121 -137 -6.13632 0.268
NP_441431.1_2 Reverse -118 -132 12.192 0.126
NP_441431.1_2 Reverse -108 -122 5.99717 0.281
NP_440358.1_8 Reverse -229 -248 -0.983855 0.274
NP_440114.1_10 Forward -50 -36 6.98109 0.25
NP_441858.1_10 Reverse -181 -200 11.5042 0.16
NP_441272.1_4 Forward -285 -266 2.26107 0.233
NP_441272.1_7 Forward -289 -279 13.648 0.257
NP_440766.1_4 Forward -134 -120 3.24451 0.151
NP_440766.1_5 Reverse -203 -215 16.2501 0.158
NP_439988.1_3 Reverse -269 -283 3.53951 0.298
NP_441237.1_9 Reverse -274 -284 11.2881 0.189
NP_442867.1_8 Forward -98 -79 9.93088 0.214
NP_440798.1_6 Reverse -122 -135 3.95252 0.147
NP_440473.1_9 Reverse -110 -129 -4.32711 0.18
NP_442509.1_9 Reverse -121 -131 6.56775 0.263
NP_442514.1_5 Forward -183 -164 5.30853 0.138
NP_441440.1_1 Forward -99 -80 8.16093 0.284
NP_440554.1_4 Forward -129 -119 6.17489 0.126
NP_441885.1_5 Forward -130 -120 0.668351 0.133
NP_442341.1_7 Forward -283 -269 4.22782 0.198
NP_440275.1_3 Reverse -119 -129 6.56821 0.101
NP_440091.1_1 Reverse -117 -129 10.5604 0.0458
NP_440091.1_1 Reverse -372 -384 0.23564 0.259
NP_440679.1_2 Reverse -114 -132 10.7372 0.281
NP_440679.1_10 Reverse -4 -23 3.14605 0.092
NP_441122.1_1 Reverse -269 -284 5.09311 0.28
NP_441122.1_1 Forward -287 -272 4.89645 0.28
NP_442373.1_2 Reverse -292 -311 -9.63698 0.265
NP_440216.1_1 Reverse -121 -135 -11.5051 0.192
NP_440216.1_9 Reverse -92 -101 6.39124 0.289
NP_440216.1_9 Forward -323 -314 6.09625 0.289
NP_440172.1_1 Forward -282 -272 6.07655 0.115
NP_442015.1_10 Forward -134 -121 7.49244 0.0855
NP_441111.1_7 Reverse -122 -130 8.96754 0.0463
NP_441766.1_2 Forward -130 -121 8.06287 0.0691
NP_442417.1_5 Reverse -121 -135 8.75105 0.147
NP_440416.1_9 Forward -137 -118 -9.24366 0.129
NP_440416.1_9 Reverse -266 -285 -17.8968 0.248
NP_440416.1_9 Forward -308 -289 -20.65 0.287
NP_443052.1_8 Reverse -366 -385 -11.1119 0.223
NP_442116.1_7 Forward -121 -104 25.2116 0.00559
NP_440591.1_9 Forward -94 -76 4.6407 0.273
NP_440261.1_5 Reverse -122 -135 -10.6988 0.203
NP_440988.1_10 Forward -278 -264 6.15739 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTAGGCTGGACCTTTTGTCACCGTTGCTCTGTCCACGGGATGGAGGATAATCTAAACGAAATCATTAGGGACCCTGACCATGCAAAAAGCCGACGAATTTGCCATCCATCTGTTTTTGGCCAATGGCCATCGAGAGGAAGTCCGTTTCATGACCATTCAAGATTTCCAAAAATGGTATAGCAACGAAGTTGTGCCCAAGCACGATTCCCAGGAATTTATCAGTGTGCCTATCAGAAATATTCAGGGCGAGTACATGGTGGTGCGACCCTCGGCGATCGTTGCCATTCGGGTGGAACCAATTTTCTTTGGCAGTGTGGAGCGCATGTAATCCGTTGTGTATAATCTTGATACAGAATGGGGTTTTGCACTTCCCTTGATGCCCCCATTACCGTGAACGTGC

CDS

ATGGATCAGTCCCTAACCCAAGATCGTCCCCTAGCGGCAGTGTTTCGACGCTTAGGCAGTGAGTTGATGCCCCCGGTGGTGGAAACGTTTGATCGGAGTAAAACAATTTTTTTTCCTGGGGATCCGGCGGAACGGGTTTATTTTTTGCTCAAGGGGGCTGTTAAGTTATCTAGGGTTTACGAAGCCGGGGAAGAAATTACCGTCGCTCTGTTGAGGGAGAACAGTGTTTTTGGGGTGTTATCATTAGTTACCGGGCAACGTTCTGACCGTTTTTACCACGCAGTGGCTTTTACCCCGGTGGAGTTACTGTCTGCCCCCATTGAACAGGTGGAACAGGCTCTCAAGGAGCATCCCGACCTGTCATTGTTGATGTTACAGGGGCTTTCTTCCCGCATTCTCCAGACGGAAATGATGATTGAAACCCTAGCCCACCGGGATATGGGTTCTCGTTTGGTTAGTTTTTTGCTGATTCTCTGTCGAGATTTTGGTGTACCTGCCCCGGACGGCATTCGCATTGACCTCAAGTTATCCCATCAGGCGATCGCCGAAGCCATTGGTTCCACCAGGGTAACGGTGACTAGGCTCCTAGGAGATCTGCGGGAGGGTAATATGATCTCCATCACGAAAAAGAAAATTACCGTCCATAACCCCGTTGCTCTCAGTCAACAGTTTACCTAA

Protein

MDQSLTQDRPLAAVFRRLGSELMPPVVETFDRSKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLVTGQRSDRFYHAVAFTPVELLSAPIEQVEQALKEHPDLSLLMLQGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPAPDGIRIDLKLSHQAIAEAIGSTRVTVTRLLGDLREGNMISITKKKITVHNPVALSQQFT