Your browser is old and dusty. Try Google Chrome!

Details for sll1399

ORF sll1399
Accession NP_439937.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -136 -117 -11.1119 0.0445
NP_441453.1_4 Forward -136 -128 6.80426 0.121
NP_441453.1_7 Reverse -170 -177 11.9372 0.298
NP_441623.1_1 Reverse -171 -189 8.47561 0.108
NP_440226.1_1 Forward -136 -117 2.55606 0.259
NP_441465.1_8 Reverse -123 -141 11.2289 0.188
NP_440996.1_2 Reverse -18 -27 13.9627 0.293
NP_442173.1_1 Reverse -128 -136 5.72262 0.203
NP_442752.1_4 Forward -136 -129 13.8055 0.0199
NP_442752.1_4 Forward -121 -114 10.5605 0.1
NP_443027.1_4 Forward -138 -128 10.9931 0.109
NP_439997.1_2 Reverse -368 -387 16.9256 0.202
NP_441812.1_3 Forward -137 -123 10.226 0.227
NP_442975.1_10 Reverse -83 -97 9.53707 0.068
NP_442975.1_10 Forward -329 -315 2.45727 0.274
NP_440784.1_7 Forward -135 -128 6.23397 0.241
NP_440784.1_7 Reverse -128 -135 6.13563 0.241
NP_441476.1_9 Reverse -57 -76 21.828 0.0459
NP_442062.1_3 Reverse -8 -27 -3.04881 0.274
NP_442062.1_8 Reverse -144 -154 9.61647 0.0587
NP_442062.1_8 Forward -136 -126 8.73149 0.0721
NP_441859.1_3 Forward -137 -118 13.47 0.0814
NP_441802.1_1 Forward -243 -224 4.81767 0.286
NP_442242.1_1 Reverse -115 -134 15.2389 0.296
NP_442242.1_4 Reverse -128 -135 10.8555 0.127
NP_441083.1_5 Reverse -127 -137 0.766681 0.218
NP_442827.1_8 Reverse -119 -138 13.8633 0.0402
NP_441434.1_1 Reverse -21 -35 7.65097 0.267
NP_441434.1_3 Reverse -35 -54 -0.197208 0.227
NP_441738.1_2 Reverse -129 -136 15.28 0.0102
NP_441955.1_8 Forward -142 -125 9.67528 0.255
NP_440209.1_1 Reverse -127 -135 11.9175 0.0184
NP_440209.1_1 Forward -136 -128 8.57422 0.0425
NP_442889.1_10 Reverse -12 -31 14.9399 0.149
NP_440447.1_1 Forward -141 -123 6.41066 0.194
NP_441716.1_1 Forward -127 -113 5.89945 0.211
NP_441562.1_5 Forward -302 -283 14.2574 0.279
NP_440906.1_5 Forward -135 -128 6.23397 0.234
NP_440906.1_5 Reverse -128 -135 6.13563 0.241
NP_441486.1_1 Reverse -141 -155 1.27789 0.114
NP_440403.1_10 Forward -136 -117 2.65439 0.279
NP_441012.1_4 Forward -151 -138 14.4739 0.202
NP_443018.1_3 Forward -135 -128 12.6255 0.0471
NP_443018.1_3 Reverse -145 -152 8.49558 0.141
NP_443018.1_3 Reverse -128 -135 5.25066 0.214
NP_441634.1_8 Forward -138 -124 10.0294 0.0922
NP_441634.1_8 Reverse -269 -283 0.88457 0.215
NP_440376.1_1 Forward -136 -127 0.0980582 0.285
NP_440376.1_1 Reverse -127 -136 -0.196935 0.285
NP_441077.1_6 Reverse -10 -26 2.99468 0.272
NP_440642.1_10 Reverse -183 -197 2.8506 0.277
NP_440642.1_10 Reverse -158 -172 1.76896 0.289
NP_440533.1_9 Reverse -127 -146 5.30933 0.207
NP_442296.1_5 Reverse -129 -148 0.0977854 0.291
NP_442658.1_1 Reverse -125 -135 6.96107 0.214
NP_442658.1_1 Forward -138 -128 6.17443 0.235
NP_442205.1_9 Forward -190 -174 -0.138127 0.264
NP_440656.1_8 Reverse -133 -152 -9.24366 0.28
NP_441414.1_9 Reverse -127 -146 -1.86883 0.106
NP_441958.1_5 Forward -137 -127 -6.31315 0.28
NP_439905.1_1 Forward -135 -122 9.16406 0.221
NP_442911.1_2 Reverse -117 -136 -10.9153 0.292
NP_441580.1_6 Forward -147 -128 1.67108 0.117
NP_441591.1_10 Forward -138 -119 4.12936 0.297
NP_443055.1_6 Reverse -178 -196 5.03327 0.181
NP_443055.1_6 Reverse -119 -137 2.77167 0.203
NP_440993.1_2 Forward -141 -125 8.02334 0.157
NP_440827.1_2 Forward -99 -80 7.66927 0.117
NP_440827.1_10 Forward -78 -64 22.714 0.0531
NP_441913.1_1 Reverse -338 -354 14.2071 0.246
NP_441099.1_6 Forward -165 -146 12.2908 0.282
NP_442002.1_9 Forward -163 -156 11.1505 0.185
NP_442002.1_9 Forward -137 -130 10.7572 0.185
NP_442438.1_10 Forward -126 -112 8.65272 0.0749
NP_440377.1_1 Forward -29 -12 10.404 0.298
NP_441916.1_7 Reverse -127 -137 6.96153 0.0784
NP_441916.1_7 Forward -153 -143 3.42162 0.216
NP_441916.1_10 Forward -129 -110 5.99764 0.208
NP_441041.1_4 Reverse -112 -131 2.16274 0.0752
NP_441041.1_7 Forward -290 -278 9.45833 0.111
NP_440715.1_1 Forward -57 -38 14.4541 0.131
NP_442996.1_8 Forward -333 -314 16.1257 0.0928
NP_442004.1_6 Forward -75 -61 4.12949 0.224
NP_441725.1_5 Reverse -128 -138 1.455 0.135
NP_439966.1_7 Reverse -125 -135 15.9091 0.0124
NP_439966.1_7 Forward -138 -128 8.73102 0.13
NP_439966.1_9 Reverse -125 -134 9.83282 0.215
NP_439966.1_9 Forward -138 -129 0.983037 0.253
NP_442941.1_3 Reverse -128 -138 1.65166 0.147
NP_440260.1_7 Reverse -172 -191 0.0977854 0.241
NP_440479.1_9 Reverse -222 -240 12.7038 0.297
NP_442500.1_8 Forward -237 -223 15.4807 0.146
NP_441087.1_6 Reverse -171 -189 -1.35821 0.264
NP_441556.1_10 Reverse -122 -136 13.8233 0.178
NP_440498.1_1 Reverse -118 -136 4.54237 0.121
NP_441644.1_6 Forward -228 -218 4.69947 0.228
NP_443049.1_6 Forward -137 -127 13.6904 0.149
NP_440780.1_1 Reverse -8 -27 6.92274 0.289
NP_442933.1_1 Forward -33 -14 12.3658 0.242
NP_442933.1_10 Reverse -127 -136 6.48957 0.119
NP_442554.1_8 Reverse -128 -138 4.0116 0.2
NP_441762.1_7 Forward -137 -125 13.9036 0.0142
NP_441762.1_7 Reverse -126 -138 -5.27089 0.195
NP_442142.1_4 Forward -139 -126 3.16532 0.265
NP_442142.1_4 Reverse -124 -137 2.67367 0.281
NP_442292.1_1 Reverse -128 -137 -0.196935 0.239
NP_442999.1_3 Reverse -345 -359 14.9023 0.299
NP_443009.1_5 Reverse -111 -122 4.28642 0.254
NP_442301.1_5 Forward -334 -315 11.8967 0.278
NP_441715.1_4 Reverse -128 -138 6.46988 0.143
NP_441715.1_4 Forward -222 -212 5.19158 0.224
NP_441448.1_1 Reverse -116 -135 4.62101 0.275
NP_442076.1_5 Forward -175 -156 10.6192 0.186
NP_440464.1_10 Forward -120 -110 15.8729 0.169
NP_441468.1_1 Forward -135 -128 6.13563 0.209
NP_441468.1_1 Reverse -128 -135 6.0373 0.223
NP_439939.1_1 Reverse -194 -213 20.8447 0.0689
NP_439939.1_2 Reverse -305 -324 19.4681 0.11
NP_439939.1_3 Reverse -344 -363 34.4153 0.0000157
NP_439939.1_4 Reverse -149 -168 30.8754 0.000142
NP_441020.2_6 Forward -138 -121 10.4619 0.142
NP_441015.1_10 Reverse -122 -141 -4.91709 0.214
NP_441673.1_1 Forward -136 -127 1.37636 0.114
NP_441673.1_1 Reverse -127 -136 1.1797 0.163
NP_441826.1_2 Forward -142 -128 -4.62196 0.298
NP_442719.1_2 Reverse -145 -163 -11.3879 0.291
NP_442808.1_1 Reverse -126 -136 17.5808 0.00507
NP_442820.1_8 Reverse -133 -147 20.4524 0.15
NP_442342.1_9 Reverse -125 -141 2.71347 0.283
NP_440558.1_2 Forward -130 -111 -7.4737 0.294
NP_440111.2_2 Reverse -116 -135 0.294447 0.212
NP_441048.1_6 Reverse -153 -167 15.7678 0.296
NP_442792.1_5 Forward -345 -328 7.90532 0.296
NP_441036.1_8 Forward -316 -306 7.74818 0.187
NP_441036.1_8 Forward -137 -127 7.05986 0.21
NP_441036.1_8 Reverse -126 -136 6.07655 0.242
NP_441557.1_4 Reverse -33 -47 9.83269 0.291
NP_441557.1_5 Forward -136 -127 1.08137 0.0794
NP_441557.1_5 Reverse -127 -136 0.589713 0.134
NP_441520.1_5 Forward -240 -221 11.9958 0.198
NP_442419.1_2 Reverse -122 -141 -1.96717 0.246
NP_442419.1_2 Forward -141 -122 -5.31042 0.295
NP_440084.1_8 Forward -26 -12 17.0092 0.161
NP_440084.1_8 Reverse -23 -37 14.4309 0.206
NP_440101.1_3 Reverse -122 -141 4.42435 0.218
NP_442183.1_1 Forward -136 -122 13.4709 0.0423
NP_442347.1_2 Reverse -128 -137 10.9145 0.0571
NP_442347.1_2 Forward -120 -111 8.1612 0.108
NP_442508.1_8 Reverse -91 -108 9.87194 0.277
NP_441633.1_3 Forward -138 -125 -6.07724 0.236
NP_440136.1_2 Forward -135 -128 6.23397 0.171
NP_440136.1_2 Reverse -128 -135 6.13563 0.193
NP_442998.1_5 Forward -164 -154 12.9597 0.158
NP_442998.1_5 Forward -275 -265 10.6981 0.206
NP_442998.1_10 Reverse -129 -136 15.5754 0.0102
NP_440899.1_8 Forward -25 -6 -8.85033 0.258
NP_440299.1_1 Forward -140 -127 8.18017 0.0964
NP_441799.1_1 Reverse -123 -137 4.71887 0.238
NP_441007.1_10 Reverse -122 -135 2.2809 0.193
NP_442201.1_10 Forward -147 -128 -11.0136 0.266
NP_440256.1_1 Reverse -45 -64 -8.65367 0.264
NP_441559.1_8 Forward -320 -306 -6.49025 0.279
NP_441559.1_8 Forward -126 -112 -6.88358 0.281
NP_441559.1_8 Forward -345 -331 -7.67023 0.297
NP_441704.1_8 Reverse -116 -135 5.80018 0.277
NP_442866.1_1 Reverse -122 -141 -2.36049 0.21
NP_440748.1_5 Reverse -45 -64 3.53937 0.21
NP_440748.1_5 Forward -151 -132 -3.54046 0.298
NP_440695.1_5 Forward -136 -117 -0.885524 0.284
NP_441939.1_3 Forward -135 -116 9.83255 0.133
NP_442993.1_1 Reverse -358 -374 -10.6595 0.224
NP_442386.1_9 Forward -281 -272 12.5856 0.058
NP_442386.1_9 Reverse -126 -135 7.96411 0.213
NP_442386.1_9 Reverse -270 -279 6.29249 0.226
NP_442386.1_9 Forward -137 -128 5.9975 0.23
NP_441340.1_5 Forward -135 -128 6.23397 0.132
NP_441340.1_5 Reverse -128 -135 5.84064 0.208
NP_442791.1_5 Reverse -126 -145 -8.85033 0.279
NP_440168.1_9 Reverse -116 -135 -5.31042 0.296
NP_441952.1_9 Reverse -7 -26 14.9613 0.278
NP_440327.1_6 Reverse -94 -113 5.40766 0.26
NP_442240.1_2 Reverse -128 -147 -16.4218 0.246
NP_441027.1_1 Forward -356 -342 10.3237 0.291
NP_440586.1_1 Forward -137 -118 -2.85214 0.259
NP_440586.1_8 Forward -135 -128 14.69 0.026
NP_442251.1_6 Reverse -128 -135 12.0355 0.0627
NP_442959.1_5 Reverse -11 -30 7.66927 0.23
NP_441262.1_3 Forward -136 -129 14.7888 0.0223
NP_443051.1_1 Forward -137 -128 0.884706 0.125
NP_443051.1_5 Forward -197 -178 6.19431 0.256
NP_439937.1_8 Forward -138 -119 21.9273 0.0156
NP_440439.1_1 Reverse -124 -137 -0.275709 0.211
NP_440372.1_2 Forward -135 -128 6.82395 0.0854
NP_440372.1_2 Reverse -128 -135 6.52896 0.188
NP_441803.1_2 Forward -141 -122 1.37609 0.232
NP_439977.1_5 Reverse -121 -140 0.982764 0.197
NP_442384.1_10 Forward -184 -171 2.77255 0.213
NP_442262.1_10 Forward -135 -128 12.9205 0.0422
NP_442262.1_10 Reverse -145 -152 8.59391 0.22
NP_442244.1_6 Forward -334 -315 2.26107 0.291
NP_440163.1_10 Forward -139 -129 14.238 0.102
NP_440163.1_10 Reverse -141 -151 7.94484 0.297
NP_442165.1_3 Forward -376 -362 17.2002 0.187
NP_440344.1_10 Reverse -120 -137 -3.69774 0.0862
NP_440282.1_10 Forward -137 -118 -10.227 0.295
NP_440487.1_1 Reverse -124 -143 1.86774 0.192
NP_440297.1_9 Reverse -128 -138 -0.511621 0.289
NP_441896.1_3 Reverse -118 -137 7.27595 0.0973
NP_441896.1_3 Reverse -65 -84 -0.0988766 0.234
NP_441896.1_3 Reverse -128 -147 -0.197208 0.234
NP_440999.1_9 Reverse -123 -137 -0.197071 0.201
NP_440888.1_2 Reverse -127 -141 8.75042 0.149
NP_442225.1_10 Reverse -182 -201 7.17681 0.281
NP_442033.1_10 Reverse -125 -144 -11.8986 0.26
NP_440105.1_7 Forward -167 -148 12.1925 0.241
NP_441543.1_2 Reverse -128 -137 8.65285 0.0968
NP_441543.1_2 Forward -135 -126 7.07956 0.131
NP_441304.1_10 Forward -190 -181 14.7494 0.164
NP_441469.1_8 Forward -137 -128 6.39124 0.227
NP_441469.1_8 Reverse -126 -135 5.60459 0.258
NP_442578.1_7 Forward -135 -128 14.6904 0.026
NP_441462.1_2 Forward -136 -126 -0.0199663 0.177
NP_441621.1_7 Forward -138 -124 -2.06536 0.188
NP_441621.1_7 Reverse -125 -139 -3.73699 0.193
NP_443062.1_1 Reverse -127 -145 10.106 0.121
NP_440889.1_4 Forward -105 -86 15.5357 0.0526
NP_442204.1_1 Forward -140 -129 0.255333 0.282
NP_440454.1_2 Forward -377 -363 11.6616 0.272
NP_440516.1_6 Reverse -118 -132 11.5037 0.202
NP_440516.1_8 Forward -136 -127 10.5211 0.00816
NP_442428.1_5 Forward -135 -128 6.13563 0.209
NP_442428.1_5 Reverse -128 -135 6.0373 0.212
NP_441032.1_3 Reverse -318 -337 14.0608 0.259
NP_442120.1_10 Reverse -325 -344 -10.817 0.261
NP_440673.1_3 Reverse -129 -136 12.4288 0.0426
NP_441052.1_2 Forward -121 -111 6.17489 0.0916
NP_441052.1_2 Reverse -127 -137 1.25834 0.249
NP_442219.1_8 Forward -164 -145 12.3223 0.158
NP_442219.1_9 Forward -120 -111 1.76968 0.298
NP_440436.1_4 Reverse -128 -137 8.55409 0.0997
NP_441884.1_9 Forward -139 -120 -12.7836 0.138
NP_441884.1_9 Forward -190 -171 -14.3569 0.138
NP_441719.1_4 Forward -135 -128 13.5105 0.026
NP_441719.1_4 Reverse -128 -135 6.52896 0.188
NP_441733.1_10 Forward -139 -126 6.90245 0.166
NP_441004.1_3 Forward -54 -35 2.0644 0.275
NP_441004.1_4 Reverse -316 -326 9.51814 0.259
NP_442366.1_3 Forward -122 -104 1.59244 0.146
NP_439949.1_7 Forward -164 -150 14.3559 0.226
NP_442873.1_3 Reverse -117 -136 13.3716 0.143
NP_441851.1_10 Forward -137 -127 4.60159 0.259
NP_442856.1_7 Forward -130 -111 -6.39206 0.297
NP_441683.1_5 Reverse -170 -189 13.6675 0.165
NP_440593.1_3 Reverse -61 -80 -5.31042 0.259
NP_440463.1_8 Reverse -117 -136 13.0182 0.199
NP_440338.1_4 Reverse -12 -31 4.12856 0.298
NP_441349.1_10 Reverse -102 -121 -6.49039 0.23
NP_441409.1_8 Reverse -70 -89 11.8368 0.209
NP_442843.1_1 Forward -100 -81 -9.14533 0.264
NP_442843.1_1 Reverse -145 -164 -11.8003 0.293
NP_440474.1_8 Forward -152 -138 5.50552 0.25
NP_440431.1_3 Forward -329 -310 -7.27704 0.202
NP_440431.1_3 Forward -185 -166 -11.9969 0.295
NP_442450.1_5 Forward -138 -128 6.07655 0.204
NP_440588.1_2 Forward -145 -126 -3.73712 0.195
NP_441031.1_1 Forward -29 -10 4.7982 0.288
NP_440954.1_3 Forward -64 -45 13.1758 0.0306
NP_441570.1_1 Forward -136 -118 -15.4188 0.23
NP_441078.1_4 Forward -136 -127 0.196389 0.205
NP_441078.1_4 Reverse -127 -136 -0.000272808 0.205
NP_442443.1_1 Forward -324 -305 0.786102 0.215
NP_441432.1_9 Forward -25 -12 7.91967 0.298
NP_442320.1_8 Forward -142 -128 13.2743 0.0144
NP_441732.1_2 Forward -140 -124 -16.2644 0.165
NP_442797.1_7 Reverse -126 -144 2.77242 0.238
NP_441131.1_10 Reverse -265 -284 14.5524 0.15
NP_442298.1_10 Reverse -61 -80 13.8641 0.219
NP_442489.1_7 Reverse -127 -136 7.47288 0.0613
NP_442489.1_7 Forward -136 -127 0.688044 0.152
NP_442079.1_7 Reverse -128 -147 2.85105 0.222
NP_442079.1_7 Forward -68 -49 0.687771 0.275
NP_442913.1_10 Reverse -129 -148 2.45773 0.125
NP_441040.1_2 Reverse -110 -129 -16.0285 0.292
NP_440352.1_5 Forward -199 -180 13.0451 0.208
NP_440459.1_2 Reverse -125 -142 12.0352 0.163
NP_440459.1_2 Forward -109 -92 7.31533 0.296
NP_440010.1_4 Reverse -108 -127 -3.14789 0.294
NP_440010.1_4 Forward -128 -109 -3.14789 0.294
NP_442603.1_7 Reverse -127 -141 7.57046 0.202
NP_441833.1_4 Reverse -128 -135 6.52896 0.0924
NP_441833.1_4 Forward -135 -128 6.23397 0.163
NP_443040.1_1 Reverse -10 -24 13.1796 0.276
NP_442162.1_8 Reverse -121 -140 0.491109 0.278
NP_442162.1_9 Forward -135 -128 6.62729 0.142
NP_442162.1_9 Reverse -128 -135 6.52896 0.178
NP_440671.1_4 Reverse -92 -106 12.586 0.105
NP_440671.1_4 Forward -142 -128 6.98109 0.23
NP_441973.1_1 Reverse -183 -198 0.864876 0.235
NP_441973.1_1 Reverse -157 -172 -0.216765 0.271
NP_442140.1_3 Forward -135 -125 10.0098 0.0949
NP_441813.1_5 Forward -138 -128 7.45319 0.0746
NP_441813.1_5 Reverse -125 -135 0.373358 0.203
NP_440590.1_4 Reverse -128 -141 1.88757 0.108
NP_440567.1_1 Forward -135 -121 11.406 0.0286
NP_440567.1_1 Reverse -128 -142 11.3077 0.0292
NP_440567.1_4 Reverse -307 -326 -0.0988766 0.281
NP_442497.1_10 Reverse -128 -137 0.589713 0.153
NP_440821.1_4 Forward -138 -128 9.32148 0.03
NP_440821.1_4 Reverse -125 -135 6.56821 0.0853
NP_441239.1_9 Reverse -125 -137 8.9871 0.117
NP_441239.1_9 Forward -282 -270 4.16888 0.26
NP_442270.1_9 Reverse -101 -120 -11.1119 0.266
NP_441017.1_6 Forward -140 -126 11.5037 0.262
NP_441541.1_1 Reverse -25 -43 7.25937 0.136
NP_443035.1_10 Reverse -120 -137 13.3135 0.179
NP_440212.1_9 Reverse -39 -58 1.23399 0.277
NP_440354.1_7 Reverse -121 -139 16.8337 0.167
NP_441617.1_6 Reverse -351 -370 -6.09707 0.278
NP_442809.1_6 Forward -148 -129 0.0977854 0.295
NP_440546.1_4 Reverse -358 -368 8.10685 0.203
NP_440462.1_6 Forward -138 -128 12.1731 0.0371
NP_440462.1_6 Reverse -125 -135 7.35486 0.0803
NP_442899.1_4 Reverse -20 -36 7.53099 0.232
NP_440868.1_4 Reverse -123 -135 21.2785 0.00736
NP_440401.1_7 Reverse -6 -19 19.2267 0.0667
NP_442479.1_5 Reverse -41 -60 6.32778 0.26
NP_441084.1_6 Forward -171 -157 10.4106 0.241
NP_440696.1_3 Reverse -123 -141 5.72234 0.19
NP_440696.1_3 Reverse -134 -152 -0.865831 0.249
NP_442679.1_1 Reverse -3 -22 -3.3438 0.254
NP_442679.1_1 Reverse -6 -25 -4.03212 0.269
NP_442696.1_6 Forward -241 -222 -13.7669 0.291
NP_442837.1_3 Reverse -128 -135 12.1338 0.0702
NP_442837.1_3 Forward -135 -128 6.0373 0.25
NP_440805.1_8 Forward -39 -20 13.6675 0.221
NP_442053.1_1 Reverse -127 -136 14.1594 0.0136
NP_442053.1_1 Forward -136 -127 7.86621 0.0863
NP_440505.1_3 Forward -342 -332 6.56821 0.176
NP_440505.1_3 Forward -138 -128 4.99491 0.252
NP_441203.1_1 Reverse -128 -147 5.80098 0.0297
NP_442532.1_7 Forward -136 -122 14.1593 0.0644
NP_440914.1_1 Forward -195 -185 6.27291 0.288
NP_441011.1_8 Reverse -128 -137 7.07956 0.179
NP_441011.1_8 Forward -135 -126 5.70292 0.237
NP_443016.1_1 Reverse -265 -284 -8.45701 0.298
NP_441482.1_7 Forward -142 -128 -11.0135 0.229
NP_442597.1_6 Forward -27 -8 14.2756 0.292
NP_442203.1_1 Forward -377 -363 17.2957 0.15
NP_441697.1_5 Reverse -11 -30 0.524783 0.194
NP_441697.1_5 Forward -38 -19 -1.67153 0.206
NP_440816.1_2 Forward -396 -377 8.37121 0.246
NP_442202.1_4 Reverse -125 -139 16.3258 0.159
NP_440115.1_6 Reverse -63 -73 6.56821 0.178
NP_440007.1_9 Forward -343 -329 0.392915 0.298
NP_441602.1_3 Reverse -122 -141 -0.0988766 0.219
NP_441972.1_5 Reverse -128 -147 -3.44213 0.2
NP_441106.1_1 Forward -137 -128 8.45619 0.0548
NP_441286.1_1 Forward -137 -125 -5.17256 0.192
NP_441930.1_2 Reverse -105 -115 13.1564 0.248
NP_440886.1_7 Reverse -126 -136 8.43603 0.0805
NP_440886.1_7 Forward -137 -127 6.86274 0.113
NP_440907.2_8 Forward -135 -125 5.09279 0.222
NP_441021.1_1 Reverse -49 -68 -8.45701 0.195
NP_441463.1_3 Reverse -117 -136 0.982764 0.128
NP_441463.1_3 Reverse -134 -153 -9.93197 0.287
NP_441626.1_2 Forward -135 -128 6.13563 0.177
NP_441626.1_2 Reverse -128 -135 5.93897 0.231
NP_441460.1_5 Reverse -149 -163 13.1753 0.3
NP_441401.1_2 Forward -186 -167 12.9791 0.298
NP_441742.1_7 Forward -319 -300 14.0608 0.245
NP_440387.1_1 Forward -136 -120 2.32015 0.0827
NP_440387.1_1 Reverse -112 -128 -6.33298 0.279
NP_441836.1_2 Forward -139 -120 -4.32711 0.255
NP_441836.1_2 Forward -190 -171 -6.09707 0.291
NP_441836.1_8 Reverse -211 -230 17.2074 0.0721
NP_441174.1_2 Forward -343 -329 11.5043 0.296
NP_442324.1_7 Forward -305 -286 14.4388 0.218
NP_440287.1_6 Reverse -217 -236 11.4058 0.129
NP_440766.1_4 Reverse -123 -137 5.01447 0.117
NP_440766.1_4 Forward -140 -126 4.32615 0.131
NP_439988.1_7 Forward -226 -212 12.2903 0.292
NP_441979.1_5 Forward -142 -123 -10.227 0.228
NP_442635.1_8 Reverse -18 -36 19.4887 0.242
NP_440457.1_1 Forward -140 -128 6.72548 0.113
NP_440213.1_6 Forward -393 -375 19.5916 0.163
NP_441801.1_4 Reverse -334 -344 3.02829 0.231
NP_442680.1_5 Reverse -5 -24 12.2835 0.121
NP_440554.1_4 Reverse -128 -138 4.99491 0.167
NP_441845.1_6 Forward -148 -130 5.52568 0.182
NP_441885.1_5 Forward -121 -111 -0.708283 0.222
NP_441428.1_8 Reverse -323 -342 7.7676 0.206
NP_441428.1_8 Reverse -119 -138 7.07928 0.206
NP_442341.1_7 Reverse -126 -140 10.9143 0.0591
NP_442341.1_7 Reverse -111 -125 8.16106 0.0926
NP_441173.1_9 Forward -42 -34 12.1137 0.21
NP_442395.2_4 Reverse -126 -145 14.9449 0.0507
NP_440750.1_4 Forward -164 -145 17.8957 0.0549
NP_443000.1_3 Forward -288 -269 18.0187 0.151
NP_441842.1_10 Forward -143 -129 12.291 0.107
NP_443060.1_5 Reverse -104 -123 10.9134 0.175
NP_442638.1_3 Forward -34 -15 14.8486 0.274
NP_439962.1_4 Reverse -119 -138 -7.67036 0.29
NP_440149.1_6 Forward -135 -116 5.50599 0.294
NP_440149.1_8 Reverse -127 -146 -5.31042 0.223
NP_441105.1_3 Reverse -295 -314 -8.26035 0.269
NP_440216.1_1 Reverse -127 -141 -12.0951 0.24
NP_440216.1_9 Forward -278 -269 13.9627 0.184
NP_440216.1_9 Reverse -338 -347 10.1278 0.286
NP_440216.1_9 Reverse -339 -348 6.5879 0.289
NP_442015.1_10 Forward -125 -112 4.14919 0.178
NP_441485.1_8 Forward -150 -131 19.5673 0.125
NP_441111.1_7 Reverse -128 -136 8.86921 0.0589
NP_441766.1_2 Reverse -127 -136 8.55452 0.054
NP_442417.1_5 Reverse -127 -141 12.291 0.0981
NP_440416.1_9 Reverse -158 -177 -21.0434 0.29
NP_443052.1_8 Reverse -117 -136 -13.7669 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGAGTTAACGAAATTAATGTCATTAAGGTAAAAAAACATGGCTGAAATTCAATTTTCCAAGGGAGTTGCAGAAACCGTTGTCCCAGAAGTGCGCCTCAGCAAGTCGAAGAATGGGCAGTCCGGCATGGCAAAATTCTATTTCTTGGAACCGACAATTCTAGCGAAAGAAAGCACCGATGATATTACCGGCATGTATTTAATCGACGACGAAGGGGAAATTATCACCAGGGAAGTAAAGGGCAAATTTATCAATGGCCGTCCTACGGCGATCGAGGCCACGGTGATCCTCAATTCCCAACCGGAATGGGACCGTTTTATGCGCTTTATGGAGCGCTACGGCGCAGAAAATGGCTTAGGTTTTTCCAAATCTGAATAATTTTTCAATTTTTCATCCTCCTCG

CDS

GTGACGATGCGGCAGTCCCTTTCCCGATCTTCCCAGCCCAGTCAGACCTGGCCCTACTGGTATCTGGTGCCCATTTATCCCTACAGTCAAAGGCAAACTTTGGTGCGGGAAGTGGTACCGGACACTATCTGGGTGTTGGAGCAGGTACAGGGAATTTTTTATGTGGTAGTACCCATCCGCATGACGGTGGTGCGCCTGAACACGGGGGGATTGCTAATTTACTCTCCCATTGCCCCCACGGCAGAATGTTTGCAATTGTTGGGGCAACTAACGGCCAAATATGGCCCAGTGAAGTATATTATCCTACCCACCATTTCCGGGTTGGAACATAAGGCTAATGTACCGTCTCTAGCTCGCCATTGTCCAGAAGCAACGGTCTATGTAGCCCCAGGCCAATGGAGTTTTCCCCTTAATTTACCTCTCAGTTGGTTGGGATTTCCAGGCGATCGAACGAAAATTTTGCCCGCTGATAGTAGCGAAACTCCCTTTGCCGGGGAATTTGATTACGCTTACCTCGGGCCGTTGGATTTACGCCTGGGCAAGTTTGGCGAAGTGGCTTTTTTCCATTGGTCTAGTCATACTTTACTGGTGACGGATACCCTGTTGGTTTTGTCGGAAAATCCCCCCCCGGTCTTGGAACTAGACCCCACTCCCCTAATGTTCCATGCCAGGGATAAGGCTGGCGATCGCCCGGAAGATAATCTCGCCAATCGAGCCAAGGGGTGGCAACGCATTTGTTTATTTGCTCTCTATTTCCAAGCTAGTACCCTAGAAGTACCTAATTGGAACCAGGTGTGGCAAGAAGCAAAACAAGTTGGCGATCGCCGTCGGGAAAATTATTTTGGTTTGTACCCATTTCGGTGGCGCAGGGATTGGCAGAACACTTTTCAAACCCTGTGGGGCGGCGGCAAAGTACGGGTGGCTCCCATTTTGCAAGAGCTAATTCTCAACCGGGAACCGGAAGCCGTATGGCAATGGGTAGAAAAAATTACTAGCTGGCCGGTGGAAACCCTCATTCCCTGTCACTTTTCTGCCCCAGTGGCTACCAATGGAGAGCAAATCCGCCAAGCCTTTAGCTTTTTACAAAAGTCTTTCTCTGACAATGAAGAGTCATTACCCCAAGAAGATCGGCAAATTCTGCAACGCATTGACCAATTCCTGGTACGTTGGCGCATCACCCCACCACCGACTAGTAAACGTGAATAA

Protein

MTMRQSLSRSSQPSQTWPYWYLVPIYPYSQRQTLVREVVPDTIWVLEQVQGIFYVVVPIRMTVVRLNTGGLLIYSPIAPTAECLQLLGQLTAKYGPVKYIILPTISGLEHKANVPSLARHCPEATVYVAPGQWSFPLNLPLSWLGFPGDRTKILPADSSETPFAGEFDYAYLGPLDLRLGKFGEVAFFHWSSHTLLVTDTLLVLSENPPPVLELDPTPLMFHARDKAGDRPEDNLANRAKGWQRICLFALYFQASTLEVPNWNQVWQEAKQVGDRRRENYFGLYPFRWRRDWQNTFQTLWGGGKVRVAPILQELILNREPEAVWQWVEKITSWPVETLIPCHFSAPVATNGEQIRQAFSFLQKSFSDNEESLPQEDRQILQRIDQFLVRWRITPPPTSKRE