Your browser is old and dusty. Try Google Chrome!

Details for sll1398

ORF sll1398
Accession NP_439938.1
Symbol psb28, psbW, psb13, ycf79
Category Photosystem II
Definition photosystem II reaction center 13 kDa protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -210 -196 7.9644 0.0955
NP_441061.1_2 Reverse -285 -299 -1.18038 0.252
NP_441061.1_2 Forward -358 -344 -2.06536 0.281
NP_441418.1_6 Forward -211 -192 -10.0303 0.031
NP_441418.1_6 Reverse -48 -67 -19.3717 0.0876
NP_441453.1_4 Forward -211 -203 14.7691 0.0119
NP_441453.1_4 Reverse -202 -210 6.80426 0.121
NP_441623.1_1 Forward -85 -67 -2.14413 0.241
NP_442151.1_6 Reverse -202 -216 12.4876 0.0722
NP_442151.1_6 Forward -392 -378 9.73436 0.141
NP_442838.1_3 Forward -54 -36 16.4404 0.223
NP_441818.1_9 Forward -147 -128 -6.68705 0.264
NP_441818.1_9 Forward -56 -37 -6.78538 0.265
NP_441818.1_9 Reverse -45 -64 -10.1286 0.292
NP_442287.1_3 Reverse -36 -53 14.1977 0.287
NP_442173.1_1 Forward -210 -202 12.0158 0.0316
NP_442173.1_1 Reverse -203 -211 12.0158 0.0316
NP_442752.1_4 Reverse -202 -209 13.8055 0.0199
NP_439997.1_2 Reverse -5 -24 16.9256 0.202
NP_439997.1_4 Forward -83 -64 8.75091 0.223
NP_442975.1_10 Reverse -198 -212 3.34225 0.259
NP_440784.1_7 Reverse -203 -210 6.23397 0.241
NP_440784.1_7 Forward -210 -203 6.13563 0.241
NP_440784.1_7 Reverse -384 -391 5.84064 0.248
NP_441054.1_2 Forward -132 -113 10.6192 0.284
NP_439979.1_9 Forward -304 -286 15.6538 0.22
NP_442062.1_8 Forward -211 -201 9.61647 0.0587
NP_442062.1_8 Reverse -202 -212 8.23984 0.0793
NP_441900.1_2 Reverse -98 -116 -6.17641 0.293
NP_440304.1_4 Forward -213 -203 9.12481 0.0626
NP_441035.1_3 Reverse -133 -152 6.39097 0.209
NP_442602.1_3 Reverse -341 -360 -0.983855 0.226
NP_439918.1_2 Forward -105 -86 -3.73712 0.261
NP_441208.1_9 Forward -214 -200 5.40779 0.267
NP_440370.1_10 Forward -220 -201 8.94757 0.239
NP_442110.1_7 Reverse -202 -216 -0.197071 0.276
NP_441925.1_4 Reverse -58 -77 -11.8993 0.253
NP_441925.1_4 Reverse -113 -132 -16.4225 0.282
NP_441925.1_4 Reverse -286 -305 -16.5208 0.284
NP_440856.1_7 Forward -57 -38 -6.58872 0.246
NP_441083.1_5 Reverse -202 -212 16.7946 0.00546
NP_441083.1_5 Forward -211 -201 10.1081 0.0208
NP_442827.1_8 Reverse -194 -213 2.26028 0.164
NP_441738.1_2 Forward -209 -202 15.28 0.0102
NP_441738.1_2 Reverse -287 -294 10.2652 0.101
NP_441738.1_2 Reverse -140 -147 6.72528 0.236
NP_440209.1_1 Reverse -202 -210 8.57422 0.0425
NP_440209.1_1 Forward -211 -203 8.47588 0.0457
NP_442889.1_1 Forward -129 -110 -6.49039 0.191
NP_442889.1_8 Forward -214 -200 5.70218 0.217
NP_440178.1_7 Reverse -201 -220 -22.8133 0.279
NP_442570.1_3 Reverse -375 -394 -6.39206 0.257
NP_441716.1_1 Reverse -226 -240 4.32615 0.256
NP_441716.1_1 Reverse -202 -216 3.53951 0.261
NP_442111.1_4 Forward -212 -198 15.2409 0.0237
NP_441163.1_1 Forward -203 -186 4.75801 0.285
NP_440906.1_5 Reverse -203 -210 6.23397 0.234
NP_440906.1_5 Forward -210 -203 6.13563 0.241
NP_440747.1_10 Forward -214 -202 -11.7607 0.142
NP_440747.1_10 Reverse -199 -211 -11.8591 0.161
NP_440747.1_10 Forward -395 -383 -12.1541 0.227
NP_440747.1_10 Reverse -293 -305 -12.3507 0.27
NP_441486.1_1 Reverse -199 -213 1.76955 0.0999
NP_441486.1_1 Forward -214 -200 0.88457 0.124
NP_442634.1_4 Forward -113 -99 -5.60527 0.264
NP_440403.1_4 Reverse -193 -212 -6.49039 0.234
NP_440403.1_10 Reverse -193 -212 2.75272 0.279
NP_441014.1_8 Reverse -107 -126 -3.3438 0.242
NP_442848.1_1 Forward -217 -203 -2.75368 0.263
NP_443018.1_3 Forward -210 -203 11.7405 0.0655
NP_443018.1_3 Reverse -203 -210 5.44732 0.193
NP_440376.1_1 Reverse -202 -211 15.7327 0.00625
NP_440376.1_1 Forward -211 -202 9.63616 0.0385
NP_442687.1_7 Reverse -201 -211 13.5497 0.0466
NP_442687.1_7 Forward -212 -202 8.73149 0.101
NP_442687.1_7 Forward -266 -256 5.5849 0.194
NP_442485.1_3 Reverse -191 -210 2.85105 0.207
NP_441846.1_10 Forward -157 -138 -21.9284 0.257
NP_441846.1_10 Forward -251 -232 -22.715 0.264
NP_440892.1_1 Reverse -80 -99 3.6377 0.118
NP_441013.1_2 Reverse -235 -253 -4.70074 0.299
NP_441422.1_7 Reverse -291 -308 -7.04099 0.256
NP_442296.1_2 Forward -352 -333 13.6675 0.274
NP_440360.1_10 Reverse -123 -137 6.88276 0.227
NP_442658.1_1 Reverse -200 -210 6.17443 0.235
NP_442658.1_1 Forward -213 -203 5.19112 0.28
NP_440141.1_8 Forward -54 -35 3.83436 0.298
NP_441971.1_4 Forward -124 -105 17.1082 0.256
NP_442782.1_2 Forward -146 -132 2.5562 0.275
NP_440656.1_8 Reverse -191 -210 -8.85033 0.273
NP_440656.1_8 Reverse -127 -146 -8.85033 0.273
NP_442544.1_2 Reverse -342 -356 0.491246 0.217
NP_442937.1_5 Reverse -378 -397 12.4875 0.108
NP_441165.1_10 Forward -353 -335 14.3755 0.212
NP_441958.1_5 Forward -212 -202 10.6981 0.0112
NP_441958.1_5 Reverse -201 -211 10.0098 0.0167
NP_440610.1_3 Reverse -184 -203 18.0924 0.0866
NP_439990.1_5 Forward -86 -73 7.78743 0.186
NP_441580.1_6 Reverse -191 -210 -7.67036 0.246
NP_443055.1_6 Reverse -137 -155 0.215075 0.248
NP_440993.1_4 Forward -359 -342 3.97208 0.277
NP_441099.1_5 Forward -221 -202 -1.08219 0.102
NP_441099.1_5 Reverse -192 -211 -3.54046 0.136
NP_442002.1_9 Forward -236 -229 12.2322 0.185
NP_442002.1_9 Reverse -201 -208 10.7572 0.185
NP_441646.1_1 Forward -129 -110 -1.96717 0.298
NP_442431.1_10 Forward -144 -126 8.37728 0.149
NP_440377.1_1 Reverse -366 -383 10.6939 0.293
NP_441000.1_6 Forward -212 -198 -5.31028 0.273
NP_442771.1_1 Forward -213 -195 -2.53746 0.161
NP_440147.1_4 Reverse -274 -287 4.34585 0.164
NP_440147.1_4 Reverse -381 -394 3.26421 0.191
NP_440147.1_4 Reverse -200 -213 1.88757 0.216
NP_441550.1_8 Forward -213 -203 14.4342 0.0151
NP_441550.1_8 Forward -287 -277 11.1893 0.0536
NP_441550.1_8 Reverse -200 -210 4.7978 0.283
NP_441916.1_7 Forward -211 -201 8.82982 0.0409
NP_441916.1_7 Reverse -202 -212 7.15819 0.0745
NP_441041.1_4 Reverse -202 -221 -4.91709 0.145
NP_441725.1_5 Reverse -203 -213 11.2881 0.0247
NP_441725.1_5 Forward -210 -200 1.455 0.135
NP_441725.1_5 Reverse -257 -267 -0.0199663 0.223
NP_439966.1_7 Reverse -200 -210 8.73102 0.13
NP_439966.1_7 Forward -213 -203 8.14104 0.14
NP_439966.1_9 Reverse -200 -209 0.983037 0.253
NP_442941.1_3 Forward -210 -200 1.65166 0.147
NP_442941.1_3 Reverse -203 -213 1.65166 0.147
NP_440289.1_2 Forward -214 -201 6.1158 0.0605
NP_440289.1_2 Reverse -199 -212 4.93583 0.0636
NP_440260.1_8 Reverse -341 -359 3.06741 0.175
NP_440260.1_8 Reverse -374 -392 1.29745 0.189
NP_440260.1_8 Reverse -340 -358 -2.63579 0.245
NP_442281.1_1 Forward -216 -202 10.5204 0.0576
NP_442281.1_1 Reverse -197 -211 2.06395 0.278
NP_441087.1_6 Reverse -232 -250 -0.76823 0.26
NP_441556.1_10 Reverse -173 -187 11.8765 0.208
NP_441644.1_6 Forward -211 -201 9.81266 0.0678
NP_441644.1_6 Reverse -202 -212 6.0761 0.167
NP_441644.1_6 Reverse -383 -393 4.20782 0.245
NP_442215.1_2 Reverse -200 -216 -1.71142 0.187
NP_442029.1_1 Forward -134 -115 -19.9617 0.297
NP_442029.1_6 Reverse -378 -397 4.32602 0.271
NP_442029.1_10 Reverse -380 -399 15.2408 0.145
NP_442029.1_10 Forward -253 -234 9.83255 0.22
NP_440253.1_2 Forward -211 -193 11.8189 0.0302
NP_440253.1_2 Reverse -202 -220 1.78911 0.152
NP_440929.1_8 Forward -211 -202 16.5193 0.00413
NP_440929.1_8 Reverse -202 -211 9.53783 0.0296
NP_442933.1_10 Forward -211 -202 8.06287 0.0885
NP_442933.1_10 Reverse -202 -211 7.96454 0.0937
NP_441751.2_8 Reverse -203 -217 -6.49025 0.269
NP_442554.1_8 Reverse -203 -213 12.4681 0.0263
NP_442554.1_8 Forward -210 -200 4.0116 0.2
NP_441762.1_7 Forward -212 -200 1.61227 0.0736
NP_441762.1_7 Reverse -201 -213 -7.53251 0.293
NP_442142.1_4 Forward -214 -201 7.88518 0.127
NP_442142.1_9 Forward -209 -190 11.2092 0.176
NP_442292.1_1 Forward -210 -201 -0.196935 0.239
NP_442292.1_1 Reverse -203 -212 -0.196935 0.239
NP_440895.1_6 Reverse -270 -283 13.4906 0.202
NP_443009.1_5 Forward -212 -201 10.9729 0.0699
NP_441715.1_4 Forward -210 -200 6.46988 0.143
NP_441448.1_1 Forward -116 -97 4.03102 0.28
NP_440183.1_9 Reverse -139 -158 -14.0619 0.263
NP_440379.1_5 Forward -309 -290 -8.26035 0.25
NP_441468.1_1 Reverse -203 -210 6.13563 0.209
NP_441468.1_1 Forward -210 -203 6.0373 0.223
NP_441020.2_6 Forward -149 -132 6.23369 0.27
NP_441020.2_6 Reverse -200 -217 5.74204 0.291
NP_441015.1_10 Forward -304 -285 -2.36049 0.178
NP_441015.1_10 Forward -310 -291 -3.73712 0.191
NP_441015.1_10 Forward -247 -228 -9.44032 0.282
NP_441015.1_10 Forward -254 -235 -9.63698 0.282
NP_441015.1_10 Forward -159 -140 -9.93197 0.282
NP_441673.1_1 Reverse -202 -211 11.1111 0.0121
NP_441673.1_1 Forward -211 -202 11.0128 0.018
NP_441731.1_7 Forward -210 -191 2.45773 0.281
NP_441876.1_9 Reverse -142 -152 12.5659 0.267
NP_441826.1_2 Forward -217 -203 2.75286 0.12
NP_441826.1_2 Reverse -196 -210 1.76955 0.142
NP_441251.1_8 Forward -351 -338 11.4253 0.27
NP_441056.1_1 Reverse -202 -221 -0.885524 0.166
NP_442427.1_8 Forward -393 -374 8.25926 0.203
NP_442427.1_8 Forward -367 -348 4.71934 0.298
NP_442808.1_1 Forward -212 -202 9.321 0.0481
NP_442808.1_1 Reverse -201 -211 8.73102 0.0481
NP_442808.1_1 Forward -188 -178 2.43787 0.266
NP_442808.1_1 Reverse -89 -99 2.43787 0.266
NP_440145.1_3 Forward -221 -202 -2.16383 0.163
NP_440145.1_3 Forward -304 -285 -3.3438 0.195
NP_442542.1_2 Forward -132 -119 13.294 0.114
NP_442542.1_2 Reverse -200 -213 10.2457 0.127
NP_442050.1_5 Forward -213 -203 13.6475 0.0295
NP_442789.1_4 Forward -391 -372 -7.4737 0.297
NP_441878.1_6 Forward -212 -202 10.4031 0.0176
NP_441878.1_6 Reverse -201 -211 0.668351 0.139
NP_441878.1_6 Forward -306 -296 -7.19813 0.21
NP_441878.1_10 Forward -345 -331 11.6026 0.289
NP_441036.1_8 Reverse -201 -211 16.4996 0.00407
NP_441557.1_5 Reverse -202 -211 10.2261 0.0144
NP_441557.1_5 Forward -211 -202 10.1278 0.0188
NP_441308.1_8 Reverse -200 -210 8.4365 0.254
NP_442183.1_1 Forward -211 -197 11.8976 0.0663
NP_442183.1_1 Reverse -202 -216 7.27608 0.145
NP_442183.1_1 Reverse -48 -62 5.40779 0.218
NP_442183.1_9 Forward -311 -301 14.7297 0.206
NP_442183.1_9 Forward -135 -125 9.41981 0.296
NP_441870.1_6 Reverse -327 -346 18.289 0.145
NP_441549.1_9 Reverse -178 -196 -10.1089 0.269
NP_442347.1_2 Forward -210 -201 8.94785 0.0718
NP_442645.1_2 Forward -219 -200 -14.3569 0.173
NP_442594.1_8 Forward -310 -291 4.71934 0.259
NP_442508.1_8 Forward -315 -298 12.1336 0.256
NP_442047.1_2 Forward -298 -284 13.2743 0.224
NP_441633.1_3 Reverse -294 -307 -0.570702 0.148
NP_441633.1_3 Reverse -274 -287 -1.25902 0.154
NP_441633.1_3 Reverse -200 -213 -4.11062 0.181
NP_441633.1_3 Reverse -191 -204 -6.76555 0.271
NP_440136.1_2 Reverse -203 -210 6.23397 0.171
NP_440136.1_2 Forward -210 -203 6.13563 0.193
NP_442590.1_9 Forward -139 -120 5.60432 0.273
NP_442590.1_10 Forward -135 -116 8.65258 0.206
NP_442590.1_10 Reverse -196 -215 7.07928 0.232
NP_442998.1_10 Forward -209 -202 15.5754 0.0102
NP_442998.1_10 Reverse -258 -265 10.4622 0.0819
NP_442998.1_10 Reverse -204 -211 5.84064 0.235
NP_440299.1_1 Reverse -198 -211 11.0318 0.0529
NP_441799.1_1 Reverse -281 -295 4.03056 0.269
NP_440256.1_1 Forward -214 -195 -1.47551 0.104
NP_440087.1_1 Forward -132 -113 -6.68705 0.256
NP_440087.1_1 Reverse -193 -212 -9.34199 0.296
NP_441559.1_8 Forward -397 -383 -1.8687 0.186
NP_440915.1_6 Reverse -198 -212 13.1759 0.0194
NP_440915.1_6 Forward -215 -201 -3.44199 0.296
NP_442855.1_3 Forward -254 -235 13.1758 0.228
NP_441179.1_9 Reverse -37 -47 15.2208 0.246
NP_440717.1_3 Reverse -140 -154 11.012 0.23
NP_442452.1_3 Forward -304 -285 1.0811 0.282
NP_442866.1_1 Reverse -197 -216 -4.32711 0.226
NP_441464.1_8 Reverse -296 -310 6.6861 0.226
NP_441464.1_10 Forward -141 -127 9.43936 0.262
NP_439985.1_10 Forward -223 -210 21.8488 0.107
NP_442993.1_1 Reverse -202 -218 -9.38124 0.185
NP_442386.1_9 Reverse -201 -210 5.9975 0.23
NP_442386.1_10 Forward -156 -143 4.54251 0.262
NP_441750.1_4 Forward -185 -166 4.12936 0.221
NP_441340.1_5 Reverse -203 -210 13.5105 0.0314
NP_441340.1_5 Forward -210 -203 5.84064 0.208
NP_442791.1_5 Forward -203 -184 -11.5053 0.29
NP_440168.1_9 Forward -213 -194 10.6192 0.209
NP_440586.1_1 Reverse -186 -205 -0.39387 0.237
NP_440586.1_8 Forward -210 -203 9.47853 0.146
NP_440586.1_8 Reverse -130 -137 7.1186 0.272
NP_440586.1_8 Reverse -203 -210 5.74197 0.283
NP_440586.1_9 Reverse -144 -163 5.70265 0.288
NP_440969.1_3 Reverse -139 -157 8.08151 0.278
NP_440684.1_9 Reverse -196 -210 8.65272 0.225
NP_440684.1_9 Forward -291 -277 6.6861 0.294
NP_441262.1_3 Reverse -202 -209 14.7888 0.0223
NP_440027.1_3 Reverse -137 -155 4.04996 0.262
NP_440027.1_3 Reverse -114 -132 4.04996 0.262
NP_443051.1_1 Forward -212 -203 8.25953 0.0414
NP_443051.1_1 Reverse -201 -210 7.47288 0.0571
NP_439937.1_8 Reverse -191 -210 3.14605 0.207
NP_439937.1_8 Forward -59 -40 1.57275 0.226
NP_439937.1_9 Reverse -225 -242 -15.7931 0.287
NP_442294.1_3 Reverse -330 -344 14.2569 0.248
NP_441665.1_2 Reverse -327 -346 10.5209 0.215
NP_440439.1_1 Reverse -199 -212 7.98409 0.0577
NP_440439.1_1 Forward -214 -201 -2.04567 0.293
NP_439943.1_7 Reverse -378 -397 7.7676 0.199
NP_440372.1_2 Reverse -203 -210 13.8055 0.0214
NP_440372.1_2 Forward -210 -203 6.52896 0.188
NP_440770.1_3 Forward -80 -66 14.9459 0.257
NP_441181.1_6 Forward -210 -192 8.18062 0.219
NP_441789.1_7 Reverse -232 -251 -1.57461 0.251
NP_441789.1_9 Forward -308 -289 9.83255 0.249
NP_440819.1_5 Forward -345 -337 7.8859 0.266
NP_440316.1_10 Forward -155 -145 8.4365 0.239
NP_440139.1_1 Reverse -196 -215 16.4199 0.0474
NP_441572.1_7 Forward -208 -189 -3.63879 0.217
NP_440267.1_2 Reverse -132 -146 7.96378 0.182
NP_442384.1_10 Forward -211 -198 12.9006 0.0241
NP_442384.1_10 Forward -305 -292 5.32916 0.131
NP_442384.1_10 Reverse -383 -396 3.75586 0.179
NP_442384.1_10 Forward -392 -379 3.65753 0.183
NP_442384.1_10 Reverse -202 -215 0.904263 0.275
NP_441877.1_7 Reverse -52 -71 5.11187 0.218
NP_442790.1_4 Reverse -193 -212 -3.24547 0.124
NP_442262.1_10 Forward -210 -203 13.2155 0.0213
NP_441689.1_5 Forward -213 -203 6.37109 0.197
NP_441689.1_5 Reverse -200 -210 5.97777 0.197
NP_440163.1_10 Reverse -199 -209 14.238 0.102
NP_440344.1_10 Forward -218 -201 -0.747806 0.0454
NP_440344.1_10 Reverse -195 -212 -9.20427 0.141
NP_440189.1_2 Forward -219 -200 -0.885524 0.293
NP_441335.1_8 Forward -133 -114 13.3725 0.197
NP_441965.1_3 Forward -312 -293 1.17943 0.224
NP_441965.1_7 Reverse -97 -116 22.6147 0.0367
NP_441965.1_7 Forward -358 -339 11.7 0.285
NP_441640.1_8 Forward -172 -153 -5.31042 0.281
NP_440297.1_9 Reverse -203 -213 9.32148 0.0917
NP_440297.1_9 Reverse -257 -267 4.40493 0.231
NP_440297.1_9 Reverse -78 -88 -0.216628 0.282
NP_440297.1_9 Forward -210 -200 -0.511621 0.289
NP_442280.1_10 Reverse -373 -391 6.13623 0.28
NP_441896.1_3 Reverse -193 -212 0.196116 0.23
NP_441896.1_3 Forward -220 -201 -2.36049 0.281
NP_440894.1_10 Forward -216 -197 10.3242 0.155
NP_440999.1_1 Reverse -112 -131 2.16195 0.249
NP_440888.1_2 Forward -211 -197 15.6336 0.00976
NP_442225.1_4 Reverse -169 -188 9.63589 0.28
NP_441123.1_8 Forward -133 -114 14.6508 0.243
NP_441543.1_2 Forward -210 -201 8.65285 0.0968
NP_442845.1_2 Reverse -196 -210 6.58777 0.207
NP_441551.1_5 Reverse -178 -194 7.72766 0.241
NP_441918.1_7 Forward -87 -68 -3.44213 0.297
NP_440982.1_1 Reverse -138 -157 3.73524 0.294
NP_440982.1_2 Forward -252 -233 19.1773 0.168
NP_441469.1_8 Reverse -201 -210 6.39124 0.227
NP_443064.1_6 Reverse -202 -212 12.6639 0.0796
NP_442578.1_7 Reverse -203 -210 6.0373 0.18
NP_440220.1_4 Forward -61 -42 2.06362 0.235
NP_441462.1_2 Reverse -202 -212 18.3679 0.0036
NP_441462.1_2 Forward -211 -201 1.74999 0.0811
NP_441462.1_5 Forward -157 -138 5.60432 0.252
NP_441462.1_5 Forward -252 -233 1.67108 0.291
NP_441621.1_7 Reverse -191 -205 -2.36035 0.188
NP_443062.1_6 Forward -219 -200 2.75272 0.25
NP_440519.1_1 Reverse -106 -125 17.404 0.177
NP_442204.1_1 Forward -246 -235 3.50026 0.266
NP_442204.1_1 Forward -396 -385 0.746988 0.281
NP_442204.1_1 Reverse -198 -209 0.255333 0.282
NP_440516.1_6 Reverse -145 -159 10.422 0.226
NP_440516.1_8 Reverse -202 -211 16.9127 0.00442
NP_440516.1_8 Forward -211 -202 14.8477 0.00685
NP_440516.1_8 Forward -294 -285 -0.295266 0.232
NP_442768.1_5 Forward -84 -65 15.9291 0.268
NP_442428.1_4 Reverse -201 -220 4.71934 0.222
NP_442428.1_5 Reverse -203 -210 6.13563 0.209
NP_442428.1_5 Forward -210 -203 6.0373 0.212
NP_442428.1_8 Forward -206 -187 0.884433 0.238
NP_441443.1_2 Reverse -137 -156 12.6841 0.0626
NP_442859.1_2 Reverse -280 -299 4.62101 0.212
NP_442120.1_10 Reverse -326 -345 -7.27704 0.217
NP_440673.1_2 Reverse -192 -211 7.65814 0.296
NP_440673.1_3 Forward -209 -202 12.4288 0.0426
NP_440865.1_9 Reverse -326 -345 -7.37537 0.244
NP_441052.1_2 Forward -392 -382 11.4848 0.0285
NP_441052.1_2 Reverse -383 -393 2.04498 0.22
NP_441052.1_2 Forward -305 -295 2.04498 0.22
NP_441052.1_2 Reverse -202 -212 0.865012 0.256
NP_441052.1_2 Forward -211 -201 0.668351 0.256
NP_442219.1_9 Reverse -370 -379 2.458 0.27
NP_440436.1_4 Forward -210 -201 8.55409 0.0997
NP_440436.1_4 Reverse -203 -212 6.39082 0.162
NP_441884.1_9 Forward -214 -195 -25.4683 0.29
NP_440314.1_9 Reverse -277 -296 -9.93197 0.281
NP_442907.1_9 Reverse -121 -140 4.22769 0.171
NP_441719.1_4 Reverse -203 -210 6.82395 0.0855
NP_441719.1_4 Forward -210 -203 6.52896 0.188
NP_441733.1_10 Reverse -199 -212 4.14919 0.273
NP_441004.1_1 Forward -254 -235 -17.8968 0.295
NP_442366.1_3 Reverse -201 -219 -2.53746 0.229
NP_443029.1_5 Forward -389 -370 15.8299 0.22
NP_442206.1_1 Reverse -187 -206 -12.1936 0.226
NP_443054.1_2 Forward -213 -199 3.93283 0.24
NP_443054.1_2 Reverse -200 -214 0.786239 0.254
NP_441851.1_10 Forward -212 -202 7.64985 0.135
NP_441851.1_10 Reverse -201 -211 6.37155 0.172
NP_442208.1_5 Forward -251 -232 -7.86702 0.275
NP_441668.1_4 Forward -275 -256 -1.27885 0.271
NP_442515.1_1 Reverse -295 -309 2.94952 0.128
NP_441396.1_5 Forward -244 -235 9.14451 0.21
NP_441982.1_6 Reverse -62 -71 11.4349 0.288
NP_441349.1_10 Forward -121 -102 -8.752 0.278
NP_441409.1_6 Reverse -279 -298 -12.9802 0.232
NP_442314.1_1 Forward -157 -139 -1.55415 0.231
NP_440432.1_9 Reverse -165 -180 -0.80675 0.167
NP_441477.1_10 Reverse -95 -113 -0.865831 0.294
NP_442450.1_5 Forward -213 -203 9.7148 0.115
NP_440588.1_2 Reverse -287 -306 -3.63879 0.191
NP_440588.1_2 Forward -311 -292 -5.60541 0.256
NP_440588.1_3 Forward -360 -341 18.3873 0.128
NP_440195.1_4 Reverse -190 -209 12.7825 0.127
NP_442335.1_7 Forward -210 -196 15.3386 0.182
NP_442006.1_2 Forward -155 -138 2.20212 0.105
NP_442006.1_2 Forward -154 -137 -18.1524 0.288
NP_441078.1_4 Reverse -202 -211 9.93116 0.0203
NP_441078.1_4 Forward -211 -202 9.83282 0.0226
NP_441078.1_4 Forward -392 -383 -1.96689 0.282
NP_442729.1_8 Reverse -198 -211 7.88576 0.132
NP_440539.1_9 Reverse -121 -140 -7.57203 0.299
NP_441663.1_8 Reverse -233 -252 -1.57384 0.243
NP_441663.1_8 Forward -300 -281 -3.83545 0.298
NP_442443.1_1 Reverse -49 -68 -4.42544 0.272
NP_442443.1_1 Forward -253 -234 -4.6221 0.275
NP_440526.1_3 Reverse -203 -214 1.6315 0.267
NP_441432.1_8 Reverse -201 -210 5.50626 0.151
NP_442320.1_8 Reverse -196 -210 3.53951 0.0594
NP_440313.1_1 Reverse -55 -74 14.2574 0.294
NP_440629.1_4 Reverse -121 -140 9.53756 0.248
NP_440760.1_1 Reverse -202 -221 -20.0601 0.22
NP_440760.1_1 Forward -211 -192 -22.2233 0.252
NP_440578.1_8 Forward -139 -120 12.0942 0.246
NP_441945.1_10 Forward -255 -236 6.78429 0.294
NP_442489.1_7 Forward -211 -202 10.5211 0.0102
NP_442489.1_7 Reverse -202 -211 10.4228 0.0151
NP_442489.1_7 Forward -392 -383 -1.6719 0.235
NP_440559.1_1 Reverse -203 -212 14.5527 0.0154
NP_441659.2_8 Reverse -202 -212 9.81313 0.0269
NP_441659.2_8 Forward -211 -201 8.82982 0.0393
NP_441040.1_2 Reverse -231 -250 -13.4719 0.281
NP_441185.1_9 Reverse -64 -82 16.2438 0.292
NP_442346.1_5 Forward -212 -202 8.1415 0.146
NP_442346.1_5 Forward -393 -383 7.74818 0.159
NP_442346.1_5 Reverse -382 -392 7.74818 0.159
NP_442346.1_10 Reverse -176 -195 0.491109 0.239
NP_440831.1_3 Reverse -341 -360 8.52284 0.223
NP_440831.1_3 Forward -360 -341 8.23161 0.232
NP_440831.1_3 Reverse -193 -212 7.16376 0.263
NP_440831.1_3 Forward -190 -171 5.12514 0.29
NP_440486.1_6 Forward -161 -142 5.211 0.3
NP_440010.1_10 Forward -126 -107 4.32602 0.246
NP_440010.1_10 Forward -166 -147 1.47442 0.299
NP_440847.1_3 Forward -180 -166 13.8636 0.209
NP_442603.1_7 Reverse -202 -216 10.6187 0.125
NP_442603.1_7 Forward -302 -288 7.07881 0.216
NP_442603.1_7 Reverse -296 -310 6.0955 0.259
NP_442603.1_7 Forward -211 -197 5.70218 0.277
NP_442603.1_9 Forward -399 -381 -0.0791831 0.3
NP_441888.1_7 Reverse -197 -211 2.94952 0.225
NP_441888.1_10 Forward -358 -339 19.9497 0.0904
NP_441050.1_5 Forward -150 -132 -0.865831 0.256
NP_441358.1_2 Forward -254 -235 5.211 0.277
NP_441833.1_4 Forward -210 -203 6.52896 0.0924
NP_441833.1_4 Reverse -203 -210 6.23397 0.163
NP_442162.1_9 Forward -210 -203 12.9205 0.0282
NP_442162.1_9 Reverse -203 -210 12.9205 0.0282
NP_440671.1_4 Forward -217 -203 13.3726 0.0834
NP_440671.1_4 Reverse -196 -210 12.6843 0.105
NP_440671.1_5 Reverse -140 -154 18.8785 0.0564
NP_442821.1_2 Reverse -130 -149 11.0125 0.154
NP_442140.1_3 Forward -210 -200 6.27322 0.176
NP_442140.1_3 Forward -172 -162 3.61828 0.288
NP_441609.1_1 Reverse -309 -328 -2.0655 0.278
NP_440875.1_9 Reverse -287 -297 8.76138 0.233
NP_441813.1_5 Forward -213 -203 12.9597 0.0182
NP_441813.1_5 Reverse -200 -210 7.45319 0.0746
NP_440073.1_6 Forward -149 -130 15.1424 0.228
NP_440590.1_4 Reverse -203 -216 5.62415 0.0585
NP_440590.1_4 Forward -210 -197 -5.19226 0.277
NP_440567.1_1 Forward -210 -196 0.687908 0.236
NP_442497.1_1 Reverse -350 -369 11.2084 0.221
NP_442497.1_10 Reverse -203 -212 10.1278 0.0166
NP_442497.1_10 Forward -210 -201 0.589713 0.153
NP_440821.1_4 Forward -213 -203 10.0098 0.0221
NP_440821.1_4 Reverse -200 -210 9.32148 0.03
NP_441239.1_9 Reverse -143 -155 13.412 0.037
NP_441239.1_9 Forward -213 -201 13.0187 0.0389
NP_441239.1_9 Reverse -386 -398 9.28209 0.11
NP_441239.1_9 Reverse -200 -212 7.11881 0.169
NP_441951.1_4 Forward -211 -192 4.81767 0.273
NP_441892.1_1 Reverse -120 -137 -5.27103 0.276
NP_441017.1_6 Forward -215 -201 12.782 0.217
NP_442216.1_4 Reverse -31 -39 8.08217 0.255
NP_440354.1_7 Reverse -196 -214 7.09898 0.278
NP_440546.1_4 Reverse -202 -212 13.8273 0.0459
NP_440546.1_4 Forward -211 -201 9.27034 0.146
NP_441230.1_5 Reverse -279 -298 7.07928 0.166
NP_440462.1_6 Reverse -200 -210 5.87989 0.135
NP_440462.1_6 Forward -213 -203 4.89658 0.18
NP_440868.1_4 Reverse -198 -210 -0.944332 0.284
NP_442479.1_8 Forward -162 -143 7.37428 0.248
NP_442402.1_4 Reverse -220 -239 -8.94939 0.285
NP_441084.1_6 Forward -394 -380 11.768 0.188
NP_441084.1_6 Forward -156 -142 9.44108 0.282
NP_442039.1_4 Reverse -203 -210 11.6422 0.0747
NP_440825.1_6 Forward -132 -113 7.7676 0.285
NP_442837.1_3 Forward -210 -203 6.0373 0.25
NP_442837.1_3 Reverse -203 -210 6.0373 0.25
NP_439994.1_1 Forward -146 -127 10.9142 0.174
NP_439994.1_1 Forward -80 -61 6.98095 0.293
NP_442053.1_1 Forward -211 -202 16.6177 0.00257
NP_442053.1_1 Reverse -202 -211 8.65285 0.0741
NP_440505.1_3 Reverse -200 -210 12.2714 0.0543
NP_441701.1_3 Forward -84 -67 5.9387 0.295
NP_440520.1_1 Reverse -186 -205 -4.32711 0.272
NP_440914.1_1 Forward -211 -201 6.66328 0.269
NP_441011.1_8 Reverse -203 -212 10.8161 0.094
NP_441011.1_8 Forward -210 -201 7.07956 0.179
NP_442533.1_1 Forward -114 -95 -9.047 0.218
NP_442533.1_1 Forward -254 -235 -12.9802 0.236
NP_442533.1_6 Forward -211 -202 14.2577 0.0132
NP_442533.1_6 Reverse -202 -211 7.47288 0.0898
NP_442533.1_6 Reverse -383 -392 5.11294 0.155
NP_442533.1_6 Forward -392 -383 3.83464 0.202
NP_440263.1_3 Forward -153 -134 6.68596 0.243
NP_442232.1_3 Reverse -185 -204 -12.4886 0.282
NP_442322.1_4 Reverse -233 -250 -0.256846 0.213
NP_442322.1_4 Reverse -99 -116 -10.0899 0.298
NP_441482.1_7 Forward -217 -203 8.65272 0.0162
NP_441482.1_7 Reverse -196 -210 -3.34366 0.118
NP_441482.1_7 Forward -271 -257 -11.8001 0.284
NP_439944.1_9 Reverse -203 -213 8.04317 0.121
NP_440816.1_2 Forward -33 -14 8.37121 0.246
NP_441028.1_6 Reverse -231 -241 6.27276 0.23
NP_440007.1_9 Forward -215 -201 3.44117 0.269
NP_441602.1_3 Forward -129 -110 1.67108 0.212
NP_441170.1_4 Reverse -374 -392 4.9357 0.228
NP_441972.1_5 Forward -391 -372 -8.55534 0.267
NP_441972.1_5 Reverse -46 -65 -9.73531 0.293
NP_441106.1_1 Reverse -201 -210 8.45619 0.0548
NP_439903.1_6 Forward -214 -195 4.32522 0.197
NP_442928.1_3 Reverse -233 -252 11.9368 0.277
NP_442306.1_10 Forward -397 -378 -21.535 0.277
NP_441286.1_1 Reverse -201 -213 4.95553 0.027
NP_441286.1_1 Forward -212 -200 -4.77924 0.175
NP_440670.1_8 Reverse -202 -211 18.0926 0.00136
NP_440670.1_8 Forward -211 -202 15.831 0.00494
NP_441479.1_9 Forward -129 -111 15.6538 0.271
NP_441930.1_2 Forward -123 -113 12.5664 0.258
NP_440886.1_7 Reverse -201 -211 8.14104 0.0805
NP_440886.1_7 Forward -212 -202 6.76441 0.114
NP_440886.1_7 Forward -67 -57 6.0761 0.147
NP_440886.1_7 Reverse -235 -245 3.71617 0.267
NP_440828.1_1 Reverse -104 -123 0.392004 0.269
NP_442614.1_2 Forward -308 -294 8.94771 0.242
NP_442614.1_2 Reverse -202 -216 6.48943 0.291
NP_442072.1_9 Reverse -201 -219 -15.1238 0.171
NP_442401.1_3 Forward -114 -95 13.1758 0.254
NP_440907.2_8 Forward -210 -200 6.0761 0.179
NP_442264.1_2 Reverse -178 -195 5.9387 0.267
NP_441626.1_2 Reverse -203 -210 12.2322 0.0511
NP_441626.1_2 Forward -210 -203 5.93897 0.231
NP_442365.1_7 Forward -215 -196 -3.54046 0.221
NP_442794.1_1 Reverse -346 -358 10.7571 0.0721
NP_441962.1_4 Forward -216 -197 -11.5053 0.241
NP_441796.1_8 Forward -93 -75 20.5703 0.062
NP_441742.1_7 Forward -396 -377 12.5858 0.29
NP_440387.1_1 Forward -211 -195 7.43336 0.0282
NP_441836.1_2 Forward -311 -292 -5.99873 0.29
NP_441993.1_1 Reverse -377 -396 0.777198 0.292
NP_441993.1_4 Forward -132 -113 8.25844 0.285
NP_439938.1_2 Forward -223 -204 21.4356 0.0279
NP_439938.1_4 Forward -272 -253 27.7288 0.00236
NP_439938.1_5 Forward -189 -170 22.9106 0.0426
NP_439938.1_10 Forward -301 -282 19.0757 0.16
NP_439938.1_10 Reverse -196 -215 17.7974 0.255
NP_441174.1_1 Forward -155 -140 15.7129 0.231
NP_440114.1_10 Forward -293 -279 7.47274 0.235
NP_440114.1_10 Reverse -202 -216 7.37441 0.236
NP_440114.1_10 Reverse -164 -178 6.78443 0.258
NP_441510.2_7 Reverse -299 -313 10.422 0.28
NP_441510.2_7 Reverse -71 -85 10.422 0.28
NP_440293.1_10 Forward -252 -233 -0.4922 0.251
NP_440766.1_4 Reverse -198 -212 9.73436 0.0871
NP_440766.1_4 Forward -215 -201 8.45605 0.0871
NP_439988.1_3 Forward -90 -76 5.89945 0.278
NP_441979.1_5 Reverse -196 -215 -2.45882 0.147
NP_442743.1_1 Reverse -340 -359 8.35677 0.264
NP_439910.1_2 Forward -219 -202 -13.9242 0.171
NP_440457.1_1 Reverse -198 -210 9.28209 0.0929
NP_440457.1_1 Forward -215 -203 7.02048 0.105
NP_440213.1_6 Forward -30 -12 19.5916 0.163
NP_440801.1_8 Forward -350 -331 -2.26216 0.298
NP_440801.1_8 Reverse -341 -360 -2.26216 0.298
NP_440942.1_4 Reverse -121 -140 18.3865 0.0354
NP_442509.1_9 Reverse -202 -212 14.6309 0.0263
NP_442509.1_9 Forward -211 -201 13.4509 0.0553
NP_442514.1_5 Reverse -106 -125 -5.99948 0.263
NP_440734.1_9 Reverse -62 -81 10.3242 0.281
NP_440554.1_4 Forward -210 -200 11.6814 0.0377
NP_441845.1_6 Reverse -190 -208 3.26407 0.233
NP_441885.1_5 Reverse -202 -212 9.12481 0.0238
NP_441885.1_5 Forward -211 -201 1.65166 0.106
NP_442341.1_7 Forward -212 -198 16.8142 0.0155
NP_442341.1_7 Reverse -201 -215 13.3726 0.0355
NP_442341.1_9 Reverse -200 -214 14.8469 0.0607
NP_442341.1_9 Forward -296 -282 9.93039 0.142
NP_442395.2_4 Forward -203 -184 1.86696 0.233
NP_440423.1_6 Reverse -194 -213 -13.4719 0.22
NP_440423.1_6 Forward -162 -143 -19.2734 0.237
NP_443000.1_7 Forward -394 -384 4.89658 0.158
NP_440275.1_3 Reverse -200 -210 5.87989 0.13
NP_440091.1_1 Reverse -365 -377 -0.74767 0.286
NP_440679.1_10 Forward -209 -190 -15.7335 0.25
NP_443010.1_10 Reverse -199 -216 6.73278 0.179
NP_442451.1_2 Reverse -194 -213 -9.14533 0.259
NP_439962.1_4 Reverse -232 -251 0.884433 0.197
NP_440149.1_8 Forward -211 -192 -3.93378 0.201
NP_440216.1_1 Forward -211 -197 -4.81863 0.115
NP_440216.1_1 Reverse -202 -216 -11.2101 0.169
NP_440172.1_1 Reverse -202 -212 6.56821 0.102
NP_440172.1_1 Forward -211 -201 5.78156 0.132
NP_442015.1_10 Forward -215 -202 8.67241 0.062
NP_442015.1_10 Reverse -198 -211 1.00259 0.216
NP_441226.1_7 Reverse -203 -210 12.7234 0.0312
NP_441226.1_7 Forward -210 -203 11.5435 0.0757
NP_441111.1_7 Reverse -203 -211 8.96754 0.0463
NP_441111.1_7 Forward -210 -202 8.86921 0.0589
NP_441766.1_2 Forward -211 -202 13.9627 0.0114
NP_441766.1_2 Reverse -202 -211 7.76787 0.0714
NP_442417.1_5 Forward -211 -197 20.2558 0.0165
NP_440416.1_9 Reverse -289 -308 -20.4534 0.285
NP_443052.1_9 Reverse -238 -257 -4.72043 0.26
NP_440820.2_8 Forward -205 -186 12.1925 0.261
NP_440072.1_5 Forward -155 -137 -1.65248 0.259
NP_441940.1_2 Forward -312 -293 10.0292 0.291
NP_442154.1_1 Forward -140 -122 1.69077 0.0831
NP_440261.1_5 Reverse -203 -216 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCGGCCAGGTGATGACCAAATCGGGATCATTACTTTGTAGGGCCATTTGCAAAGCGGGCAAAATAGCCGTTTCCAAATCTTGCTTACGTTTGGGGGTGGTGACCAGGCGAATGGGCTGATCACTAAGTAAACAGGGCAATAGATAACTGGGGCCGTAGGTGGGGGGCAAACAACCAGTTTGAATCAAGGCCGATCGCCGTAGTCGCAGGGCCCGGGATACCAAACGACCCATGGTTAACGAATGGGGCCAGGGGGGAATGGTTTGTTGGCGCTGTTGGGCTTTGAGCAGGTGGTGAACTTGGGTTTCGAGTAGTCCCATGGGGGTGTTTTTTCGGCCACTACCGGGATCTATGCCATGATGGGGAGTTAACGAAATTAATGTCATTAAGGTAAAAAAAC

CDS

ATGGCTGAAATTCAATTTTCCAAGGGAGTTGCAGAAACCGTTGTCCCAGAAGTGCGCCTCAGCAAGTCGAAGAATGGGCAGTCCGGCATGGCAAAATTCTATTTCTTGGAACCGACAATTCTAGCGAAAGAAAGCACCGATGATATTACCGGCATGTATTTAATCGACGACGAAGGGGAAATTATCACCAGGGAAGTAAAGGGCAAATTTATCAATGGCCGTCCTACGGCGATCGAGGCCACGGTGATCCTCAATTCCCAACCGGAATGGGACCGTTTTATGCGCTTTATGGAGCGCTACGGCGCAGAAAATGGCTTAGGTTTTTCCAAATCTGAATAA

Protein

MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEATVILNSQPEWDRFMRFMERYGAENGLGFSKSE