Your browser is old and dusty. Try Google Chrome!

Details for sll1396

ORF sll1396
Accession NP_439941.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Forward -368 -349 12.8432 0.146
NP_441453.1_4 Reverse -162 -170 4.24765 0.259
NP_442655.1_2 Reverse -187 -206 0.687771 0.291
NP_440061.1_9 Forward -208 -194 10.717 0.123
NP_440061.1_9 Forward -173 -159 9.73373 0.14
NP_441054.1_4 Forward -342 -324 -4.11075 0.297
NP_441499.1_1 Reverse -292 -311 13.1758 0.237
NP_442062.1_8 Reverse -162 -172 2.83163 0.293
NP_440761.1_4 Reverse -157 -176 -11.1119 0.165
NP_441859.1_3 Forward -172 -153 9.43841 0.129
NP_440304.1_4 Forward -173 -163 6.96153 0.137
NP_439918.1_2 Reverse -187 -206 -4.03212 0.265
NP_441620.1_3 Forward -135 -116 10.5209 0.298
NP_441619.1_8 Forward -110 -96 6.58715 0.295
NP_440132.1_6 Reverse -28 -47 10.5209 0.187
NP_442110.1_7 Reverse -162 -176 1.96621 0.222
NP_441925.1_4 Forward -213 -194 -13.5709 0.257
NP_440856.1_4 Forward -178 -159 1.37609 0.157
NP_441434.1_1 Reverse -81 -95 11.7571 0.233
NP_440109.1_5 Reverse -319 -338 11.3067 0.275
NP_441738.1_2 Reverse -387 -394 9.77352 0.143
NP_442889.1_1 Forward -272 -253 -14.8485 0.283
NP_440447.1_1 Forward -176 -158 4.83737 0.222
NP_440447.1_5 Forward -178 -168 13.1564 0.291
NP_441624.1_7 Forward -177 -163 6.58777 0.279
NP_441495.1_2 Reverse -194 -213 13.8641 0.186
NP_440747.1_10 Forward -174 -162 -12.1541 0.227
NP_442634.1_4 Forward -173 -159 -4.81863 0.22
NP_440470.1_5 Forward -371 -352 13.5117 0.158
NP_440470.1_5 Reverse -350 -369 9.21455 0.234
NP_440470.1_5 Reverse -362 -381 5.58586 0.294
NP_442848.1_1 Forward -134 -120 -2.45868 0.263
NP_443018.1_3 Reverse -163 -170 10.7572 0.0907
NP_443018.1_3 Forward -170 -163 4.56234 0.241
NP_440376.1_1 Reverse -197 -206 0.786375 0.26
NP_442485.1_3 Forward -208 -189 -5.9004 0.296
NP_441846.1_10 Reverse -186 -205 -5.21209 0.185
NP_440642.1_10 Forward -301 -287 9.43874 0.191
NP_441950.1_7 Forward -116 -97 -6.09707 0.243
NP_442658.1_1 Forward -173 -163 11.7793 0.0727
NP_440184.1_7 Forward -95 -76 15.6107 0.222
NP_439968.1_2 Forward -213 -194 17.6982 0.252
NP_441958.1_5 Forward -172 -162 0.471689 0.143
NP_441127.1_1 Forward -171 -157 9.14437 0.278
NP_441377.1_6 Reverse -252 -271 9.3409 0.298
NP_442690.1_1 Reverse -349 -368 -8.55534 0.189
NP_442690.1_1 Reverse -362 -381 -13.6686 0.264
NP_440153.1_8 Forward -206 -193 -2.63565 0.246
NP_443055.1_6 Forward -220 -202 7.09821 0.163
NP_440993.1_5 Forward -178 -160 18.0129 0.111
NP_439975.1_2 Reverse -193 -211 16.2438 0.0962
NP_442002.1_1 Reverse -185 -203 -10.6006 0.296
NP_441646.1_1 Reverse -197 -216 -1.18052 0.28
NP_441646.1_1 Forward -213 -194 -1.96717 0.298
NP_440484.1_1 Reverse -377 -396 12.1917 0.194
NP_440147.1_4 Forward -173 -160 5.62415 0.119
NP_441916.1_7 Forward -171 -161 2.33998 0.258
NP_442941.1_3 Reverse -163 -173 -0.41329 0.259
NP_442281.1_1 Forward -176 -162 6.88214 0.113
NP_442575.1_8 Reverse -192 -211 -1.27885 0.232
NP_441644.1_6 Reverse -162 -172 10.9926 0.058
NP_440652.1_10 Reverse -195 -214 2.65439 0.283
NP_442933.1_10 Forward -171 -162 4.52295 0.24
NP_442554.1_8 Reverse -163 -173 6.96153 0.102
NP_442292.1_1 Reverse -163 -172 4.71961 0.172
NP_441024.1_7 Forward -54 -36 18.8979 0.0793
NP_443009.1_5 Reverse -161 -172 6.74468 0.15
NP_443009.1_5 Forward -172 -161 5.36805 0.206
NP_441715.1_4 Reverse -163 -173 4.40493 0.281
NP_441198.1_8 Reverse -160 -170 11.0251 0.228
NP_441468.1_1 Forward -170 -163 4.07068 0.263
NP_441876.1_9 Forward -31 -21 10.1076 0.3
NP_441764.1_4 Reverse -74 -91 11.8915 0.204
NP_442719.1_2 Forward -314 -296 -7.84802 0.239
NP_442227.1_2 Forward -204 -185 0.786102 0.252
NP_442227.1_2 Forward -42 -23 0.196116 0.252
NP_442227.1_2 Forward -298 -279 -1.86883 0.268
NP_442050.1_5 Reverse -383 -393 8.73102 0.217
NP_440601.1_10 Forward -246 -227 9.14423 0.29
NP_440558.1_2 Reverse -159 -178 0.392778 0.191
NP_440558.1_2 Forward -210 -191 -5.01543 0.251
NP_441878.1_6 Reverse -161 -171 1.25834 0.108
NP_441878.1_6 Forward -172 -162 -7.49312 0.231
NP_441878.1_6 Reverse -256 -266 -7.68978 0.255
NP_441557.1_5 Forward -171 -162 -0.786921 0.239
NP_442962.1_1 Reverse -151 -170 7.86593 0.239
NP_441739.1_2 Forward -306 -290 5.46605 0.228
NP_442183.1_9 Reverse -194 -204 9.41981 0.296
NP_441574.1_2 Forward -212 -193 16.2232 0.226
NP_442347.1_2 Forward -388 -379 3.63797 0.284
NP_442594.1_8 Forward -116 -97 9.53756 0.187
NP_442047.1_2 Forward -258 -244 17.9942 0.161
NP_441633.1_3 Forward -173 -160 -4.9956 0.22
NP_440299.1_6 Reverse -380 -399 6.29264 0.268
NP_441799.1_1 Reverse -158 -172 4.03056 0.269
NP_441559.1_8 Forward -176 -162 0.196253 0.169
NP_440915.1_3 Reverse -282 -301 16.3224 0.137
NP_440915.1_6 Forward -175 -161 -1.47537 0.236
NP_442866.1_1 Reverse -157 -176 -2.75381 0.214
NP_440306.1_3 Reverse -290 -309 5.11266 0.295
NP_440695.1_6 Forward -371 -357 10.2174 0.269
NP_441340.1_5 Reverse -163 -170 3.97235 0.274
NP_442327.1_3 Forward -382 -363 6.44528 0.26
NP_440327.1_6 Reverse -186 -205 4.22769 0.274
NP_442950.1_1 Reverse -41 -60 -5.11376 0.244
NP_443051.1_1 Forward -172 -163 0.0980582 0.226
NP_439937.1_5 Reverse -362 -381 19.4926 0.253
NP_440439.1_1 Forward -174 -161 1.29759 0.157
NP_441138.1_5 Forward -189 -176 5.79129 0.272
NP_440316.1_10 Forward -172 -162 5.38824 0.299
NP_440693.1_8 Reverse -192 -211 12.0942 0.283
NP_442235.1_3 Reverse -86 -105 7.96426 0.172
NP_442262.1_10 Reverse -163 -170 9.87221 0.164
NP_440888.1_2 Reverse -162 -176 11.307 0.0705
NP_440888.1_2 Forward -206 -192 11.2087 0.0729
NP_440888.1_2 Forward -293 -279 8.16044 0.171
NP_442892.1_9 Forward -45 -31 11.897 0.296
NP_442033.1_10 Reverse -160 -179 -13.6686 0.287
NP_440575.1_1 Reverse -229 -248 -3.44288 0.294
NP_441543.1_2 Reverse -163 -172 4.0313 0.293
NP_441543.1_3 Forward -204 -190 14.0603 0.163
NP_442845.1_2 Reverse -191 -205 3.63784 0.282
NP_441462.1_2 Forward -171 -161 -0.314959 0.206
NP_441621.1_7 Reverse -160 -174 -6.29359 0.283
NP_442204.1_1 Forward -175 -164 12.35 0.0565
NP_442428.1_5 Forward -170 -163 4.46401 0.267
NP_441867.1_2 Reverse -288 -307 -16.4218 0.291
NP_440673.1_3 Reverse -164 -171 8.98723 0.203
NP_440436.1_4 Forward -293 -284 4.12922 0.288
NP_440314.1_9 Forward -78 -59 -5.01543 0.216
NP_441719.1_2 Reverse -137 -151 17.1928 0.191
NP_442366.1_3 Reverse -210 -228 -1.25915 0.208
NP_441115.1_4 Forward -172 -154 7.98318 0.266
NP_441115.1_4 Reverse -161 -179 7.3932 0.286
NP_442208.1_5 Reverse -282 -301 -6.98204 0.27
NP_441157.1_1 Forward -376 -362 5.30886 0.241
NP_442856.1_7 Reverse -254 -273 -0.000545616 0.203
NP_442515.1_1 Forward -172 -158 -4.32697 0.298
NP_441683.1_7 Reverse -17 -36 -2.26216 0.241
NP_441982.1_6 Reverse -37 -46 12.7718 0.274
NP_442689.1_8 Reverse -353 -370 -4.77938 0.267
NP_442314.1_8 Reverse -195 -212 4.85706 0.271
NP_439960.1_10 Reverse -274 -292 -4.40575 0.293
NP_440933.1_8 Reverse -158 -177 20.7473 0.135
NP_441124.1_5 Reverse -313 -323 13.1036 0.215
NP_440431.1_3 Reverse -161 -180 -7.27704 0.202
NP_440431.1_3 Reverse -284 -303 -10.6203 0.276
NP_440431.1_4 Reverse -43 -62 -5.20473 0.233
NP_442243.1_1 Reverse -191 -209 -2.14486 0.287
NP_442243.1_3 Forward -39 -20 12.88 0.254
NP_441078.1_4 Forward -171 -162 -1.6719 0.266
NP_441432.1_8 Forward -172 -163 15.0444 0.0182
NP_439935.1_1 Reverse -298 -317 11.7992 0.22
NP_442489.1_7 Forward -171 -162 -1.6719 0.235
NP_442489.1_7 Reverse -162 -171 -1.96689 0.28
NP_440559.1_1 Forward -170 -161 4.42462 0.277
NP_441659.2_8 Reverse -162 -172 6.76487 0.0678
NP_441659.2_8 Forward -206 -196 0.176696 0.271
NP_442749.1_5 Forward -380 -363 12.7548 0.159
NP_440860.1_8 Forward -110 -91 16.7157 0.203
NP_440363.1_8 Reverse -154 -173 10.1275 0.288
NP_439956.1_7 Reverse -156 -175 3.34271 0.257
NP_442346.1_5 Forward -172 -162 12.2714 0.0456
NP_442346.1_5 Reverse -161 -171 5.48657 0.243
NP_440352.1_5 Reverse -164 -183 11.7797 0.254
NP_440352.1_5 Reverse -16 -35 10.709 0.27
NP_440352.1_5 Reverse -37 -56 10.125 0.278
NP_440250.1_4 Forward -382 -363 4.62021 0.253
NP_440459.1_2 Reverse -242 -259 9.28195 0.23
NP_440847.1_3 Forward -204 -190 14.0603 0.206
NP_442603.1_10 Reverse -190 -207 15.5257 0.267
NP_442828.1_2 Reverse -78 -97 13.7027 0.242
NP_441888.1_7 Forward -176 -162 1.76955 0.239
NP_442199.1_5 Forward -179 -160 -7.08038 0.286
NP_442140.1_3 Forward -170 -160 3.91327 0.271
NP_440594.1_8 Forward -170 -157 9.85179 0.174
NP_440590.1_4 Reverse -198 -211 -1.25902 0.215
NP_440227.1_2 Forward -235 -219 8.80999 0.29
NP_441239.1_9 Forward -173 -161 10.0687 0.0888
NP_441239.1_9 Reverse -160 -172 4.46387 0.253
NP_440156.1_4 Reverse -118 -128 14.2375 0.176
NP_442669.1_1 Forward -338 -319 10.8159 0.0254
NP_440604.1_5 Reverse -375 -394 16.2594 0.235
NP_441508.1_4 Reverse -224 -238 15.6723 0.227
NP_442643.1_1 Reverse -278 -297 -6.58872 0.231
NP_441017.1_8 Reverse -208 -223 7.45305 0.27
NP_442216.1_4 Forward -181 -173 8.27883 0.255
NP_441617.1_6 Reverse -51 -70 -3.04881 0.263
NP_442465.1_7 Forward -318 -300 18.112 0.296
NP_442787.1_7 Reverse -158 -177 15.6919 0.227
NP_442479.1_9 Forward -335 -316 -10.4236 0.268
NP_442402.1_2 Forward -51 -37 11.7003 0.272
NP_442402.1_6 Reverse -170 -179 14.8477 0.241
NP_441848.1_4 Forward -244 -228 7.26419 0.292
NP_439942.1_2 Reverse -348 -367 14.2495 0.228
NP_439942.1_7 Reverse -160 -179 27.3355 0.000757
NP_442039.1_7 Forward -398 -388 10.6981 0.257
NP_442679.1_1 Forward -141 -122 -3.24547 0.25
NP_440160.1_9 Reverse -162 -181 9.83255 0.235
NP_440505.1_3 Forward -173 -163 6.46988 0.18
NP_442532.1_4 Forward -135 -117 12.2311 0.215
NP_442533.1_1 Reverse -188 -207 -16.6185 0.273
NP_442533.1_6 Forward -171 -162 5.60459 0.137
NP_442533.1_6 Forward -206 -197 4.52295 0.179
NP_442232.1_3 Reverse -154 -173 -7.76869 0.209
NP_442322.1_4 Forward -209 -192 -2.02679 0.228
NP_440854.1_6 Reverse -73 -92 14.6576 0.26
NP_441028.1_6 Forward -32 -22 7.64939 0.218
NP_441028.1_6 Forward -181 -171 5.48612 0.255
NP_441527.1_4 Reverse -29 -48 -5.68219 0.206
NP_441106.1_1 Forward -172 -163 5.60459 0.141
NP_441106.1_3 Reverse -73 -92 15.1424 0.148
NP_441869.1_9 Forward -150 -131 11.5042 0.293
NP_440670.1_8 Forward -394 -385 3.34298 0.275
NP_441930.1_3 Forward -325 -306 6.42485 0.263
NP_439899.1_1 Reverse -358 -376 6.42607 0.205
NP_442264.1_2 Reverse -158 -175 4.95539 0.288
NP_442794.1_1 Forward -175 -163 5.44718 0.221
NP_440467.1_3 Forward -182 -163 13.9907 0.179
NP_440114.1_10 Reverse -267 -281 7.37441 0.236
NP_440114.1_10 Forward -171 -157 5.60446 0.3
NP_442090.1_2 Reverse -67 -86 13.5117 0.214
NP_441500.1_2 Forward -107 -88 12.7825 0.228
NP_442087.1_2 Reverse -196 -215 12.8246 0.276
NP_441311.1_4 Reverse -240 -257 12.0352 0.298
NP_441531.1_6 Forward -203 -190 10.1474 0.254
NP_442930.1_1 Reverse -227 -237 14.1392 0.239
NP_442930.1_1 Forward -306 -296 9.321 0.287
NP_440457.1_1 Reverse -193 -205 4.66053 0.156
NP_440457.1_1 Reverse -287 -299 -0.846001 0.278
NP_441801.1_4 Forward -180 -170 2.53664 0.292
NP_442680.1_5 Reverse -173 -192 1.53759 0.241
NP_442680.1_5 Reverse -172 -191 -1.19775 0.299
NP_441984.1_3 Forward -182 -164 4.83737 0.3
NP_440554.1_4 Reverse -163 -173 5.19158 0.158
NP_440554.1_4 Reverse -305 -315 2.24165 0.271
NP_442703.1_2 Reverse -79 -98 14.2768 0.233
NP_441173.1_9 Forward -349 -341 10.2454 0.261
NP_440191.1_5 Reverse -163 -182 18.584 0.118
NP_443000.1_7 Forward -173 -163 0.865012 0.285
NP_440275.1_9 Reverse -224 -243 15.8299 0.179
NP_442275.1_1 Forward -206 -187 8.25926 0.245
NP_442275.1_1 Reverse -194 -213 -0.0988766 0.295
NP_442495.1_4 Reverse -166 -176 17.7779 0.0771
NP_441105.1_3 Forward -305 -286 -7.17871 0.248
NP_441105.1_3 Forward -182 -163 -8.35868 0.272
NP_440216.1_1 Reverse -162 -176 -12.2918 0.256
NP_440172.1_1 Forward -171 -161 12.5664 0.0277
NP_443052.1_3 Reverse -24 -43 18.2878 0.208
NP_440072.1_5 Reverse -186 -204 -2.24246 0.269
NP_440261.1_5 Forward -170 -157 -4.79893 0.17
NP_440988.1_10 Forward -208 -194 6.73827 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACTTGGCGAACTGATTCCAAGGTTAACGAAAATTTTCAGTAACAGTTCGTTTCGCCCAAATTAGAGGGTGTTGACAAAGTTTGAAAGTGATGTCAAATTTCCCTAGCCCTCCTCCATAAGAGGCCGATTCTTGACAAGTGCCCAGTCAAATGGGTAGTAAGGATAATTTTTTGAACTGAATAATGGCTCTTTGCCCACCCCCACCCTAGTTCGTTTTTTATTCCCCAGGCAATGGCTCCAAATAAGAAATTCAATTGCTAAAGTAGGAATGGAGAAATCTTATTTGAAGGGTTAGTTGGTGGCATCTTTAATATCTTTTTACGATAGAAAAATACCACGCTAAAATTCTCTCTTTTCCACTACCTTTTTCCTCCCATTCACCAGTTGGCTTAGTTAAA

CDS

ATGAACTTTGATCTTTCAAAGCTAAGTAGTATGAAAGTTGAGTCCTTGGTGCAGCAAGGGTTAGATACCATTCTTAACCGCCAAACCAAAGCCGAAGCTTCATCTGTAGACAAAGTTAGTTTGATCAAAAAATCCTTGGATCAAAAAGGGGAATTATACCGACTGCCTCCCAGCCATGAATTTACCATTGCCGCTTTCCAAGTACGCTATCAAACTTCCGTTGGTTCTATTCTTATTACCCTAGATAACCTGCGGGAATTCAATAAAATGTTAGACCAAGAAATTTTACAAGAAGCGAGCAAAGGTTATCTCCGCAAAGCAGACCGATATATTCGTCAAAAACGCAATGTTGATATCACCAAATACACCCACCGCATTAAAGCTTATCGGGTTAACCAAGCCAAAGCAAAAATTCTTACCTGGATTATTGACTGGGACTTTCATAAGCAATCATCGGACGAAAGTTCCTATGGGAGCGGCACTGCTAGGGCGTTAATGCAAGAATTGGCAGTTGCCTTCCTTGATCATCCCATCGCCAAGAATAGTAGGGGAGATTATTTAGACGCCATCATGACCCTCAACTGGGTCACGGAAATTTTACACGCAGCCAAACCCTTCTATAGCCACAGTCAAATTACCCACAAAATTATCTACCATCACAACTCGGATAGCTAG

Protein

MNFDLSKLSSMKVESLVQQGLDTILNRQTKAEASSVDKVSLIKKSLDQKGELYRLPPSHEFTIAAFQVRYQTSVGSILITLDNLREFNKMLDQEILQEASKGYLRKADRYIRQKRNVDITKYTHRIKAYRVNQAKAKILTWIIDWDFHKQSSDESSYGSGTARALMQELAVAFLDHPIAKNSRGDYLDAIMTLNWVTEILHAAKPFYSHSQITHKIIYHHNSDS