Your browser is old and dusty. Try Google Chrome!

Details for sll1394

ORF sll1394
Accession NP_439944.1
Symbol
Category Protein modification and translation factors
Definition peptide methionine sulfoxide reductase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -244 -237 14.6904 0.0123
NP_440795.1_7 Reverse -237 -244 14.6904 0.0123
NP_441418.1_6 Reverse -236 -255 -19.6667 0.093
NP_441418.1_6 Forward -389 -370 -28.9099 0.213
NP_441418.1_6 Forward -245 -226 -29.2048 0.219
NP_440897.1_6 Reverse -236 -255 -3.34455 0.241
NP_441453.1_4 Reverse -236 -244 16.539 0.00633
NP_441453.1_4 Forward -245 -237 16.539 0.00633
NP_442151.1_6 Forward -245 -231 13.3726 0.0528
NP_441818.1_1 Reverse -237 -248 13.8245 0.0623
NP_441818.1_9 Forward -391 -372 -10.0303 0.292
NP_440226.1_1 Forward -245 -226 12.9791 0.0397
NP_440226.1_1 Reverse -236 -255 3.53937 0.221
NP_441630.1_3 Forward -253 -234 4.42435 0.164
NP_442173.1_1 Forward -244 -236 15.4574 0.00633
NP_442173.1_1 Reverse -237 -245 15.4574 0.00633
NP_442752.1_4 Forward -245 -238 13.8055 0.0199
NP_442752.1_4 Reverse -236 -243 13.8055 0.0199
NP_442752.1_4 Reverse -313 -320 12.1338 0.0546
NP_443027.1_4 Reverse -234 -244 16.2046 0.0437
NP_441812.1_3 Forward -246 -232 10.4227 0.222
NP_442975.1_10 Reverse -232 -246 4.22722 0.245
NP_440784.1_7 Forward -244 -237 15.9687 0.0123
NP_440784.1_7 Reverse -237 -244 15.9687 0.0123
NP_441250.1_3 Forward -57 -38 4.71934 0.244
NP_440061.1_9 Reverse -234 -248 17.7968 0.012
NP_440110.1_8 Forward -391 -372 1.0811 0.211
NP_439979.1_9 Forward -388 -370 8.86894 0.26
NP_442062.1_3 Forward -57 -38 -3.63879 0.294
NP_442062.1_8 Reverse -236 -246 17.6796 0.00193
NP_442062.1_8 Forward -245 -235 10.3048 0.0493
NP_440304.1_4 Reverse -234 -244 19.9412 0.00364
NP_440304.1_4 Forward -247 -237 9.91146 0.051
NP_442242.1_4 Forward -244 -237 14.3954 0.0124
NP_442242.1_4 Reverse -237 -244 14.3954 0.0124
NP_439918.1_3 Forward -371 -352 8.75091 0.252
NP_441935.1_1 Forward -200 -181 15.7324 0.126
NP_442110.1_7 Forward -245 -231 2.75286 0.222
NP_441925.1_4 Reverse -361 -380 -7.6711 0.196
NP_441925.1_4 Reverse -364 -383 -9.34271 0.218
NP_440014.1_6 Reverse -227 -246 6.78429 0.287
NP_440856.1_4 Reverse -229 -248 1.0811 0.161
NP_441083.1_5 Reverse -236 -246 19.3512 0.000718
NP_441083.1_5 Forward -245 -235 11.2881 0.0159
NP_441738.1_2 Forward -243 -236 15.28 0.0102
NP_441738.1_2 Reverse -238 -245 15.28 0.0102
NP_441558.1_5 Reverse -210 -229 4.916 0.267
NP_440209.1_1 Reverse -236 -244 18.1123 0.00295
NP_440209.1_1 Forward -245 -237 18.1123 0.00295
NP_442889.1_1 Forward -197 -178 -3.83545 0.146
NP_442889.1_8 Forward -248 -234 9.24208 0.101
NP_440447.1_6 Forward -129 -111 9.95058 0.135
NP_441713.1_1 Reverse -230 -249 -14.1602 0.257
NP_440178.1_7 Forward -246 -227 -1.57384 0.0298
NP_440178.1_7 Forward -186 -167 -11.4069 0.0927
NP_440178.1_7 Reverse -265 -284 -22.3217 0.261
NP_441716.1_1 Forward -245 -231 11.0127 0.0936
NP_441716.1_1 Reverse -236 -250 8.35772 0.143
NP_441716.1_1 Reverse -325 -339 3.14618 0.278
NP_442111.1_4 Reverse -235 -249 17.0108 0.0123
NP_442111.1_4 Forward -246 -232 8.45605 0.0744
NP_441163.1_1 Forward -270 -253 5.053 0.281
NP_440343.1_9 Forward -387 -368 10.1275 0.248
NP_440906.1_5 Forward -244 -237 15.8704 0.0124
NP_440906.1_5 Reverse -237 -244 15.8704 0.0124
NP_440747.1_10 Reverse -233 -245 7.80712 0.00223
NP_440747.1_10 Forward -248 -236 7.31547 0.00577
NP_440747.1_10 Forward -266 -254 -12.1541 0.227
NP_441486.1_1 Reverse -233 -247 -3.147 0.176
NP_441194.1_4 Forward -256 -237 6.98095 0.227
NP_442634.1_4 Forward -247 -233 25.074 0.0027
NP_442634.1_4 Reverse -311 -325 -4.52363 0.206
NP_441014.1_5 Forward -126 -108 9.36059 0.276
NP_442848.1_9 Reverse -183 -202 0.392778 0.273
NP_441012.1_4 Reverse -168 -181 9.2624 0.272
NP_443018.1_3 Forward -244 -237 14.8871 0.0123
NP_443018.1_3 Reverse -237 -244 14.8871 0.0123
NP_441316.1_7 Forward -247 -232 -2.08505 0.243
NP_440376.1_1 Forward -245 -236 19.4693 0.000692
NP_440376.1_1 Reverse -236 -245 19.4693 0.000692
NP_440376.1_1 Forward -191 -182 3.83464 0.19
NP_442687.1_7 Forward -246 -236 18.5646 0.0028
NP_442687.1_7 Reverse -235 -245 9.02648 0.0994
NP_442191.1_4 Forward -205 -191 10.7022 0.288
NP_442485.1_3 Forward -202 -183 -5.31042 0.289
NP_441846.1_10 Forward -380 -361 -22.2233 0.257
NP_441422.1_7 Forward -247 -230 -3.69774 0.235
NP_441950.1_7 Forward -379 -360 -9.14533 0.293
NP_442296.1_9 Reverse -237 -256 0.58944 0.197
NP_442658.1_1 Forward -247 -237 16.0075 0.00966
NP_442658.1_1 Reverse -234 -244 13.0576 0.04
NP_442782.1_2 Forward -245 -231 2.35953 0.275
NP_442205.1_9 Reverse -230 -246 -3.18639 0.28
NP_441414.1_9 Reverse -236 -255 2.94938 0.0612
NP_441487.1_6 Forward -253 -234 -1.08219 0.283
NP_439959.1_4 Forward -380 -361 16.5191 0.283
NP_442321.1_4 Reverse -256 -275 -8.35868 0.289
NP_441958.1_5 Reverse -235 -245 21.2195 0.000805
NP_441958.1_5 Forward -246 -236 20.5312 0.000966
NP_440203.1_2 Reverse -303 -322 15.1424 0.201
NP_439905.1_1 Reverse -183 -196 7.49244 0.258
NP_440984.1_7 Forward -196 -182 5.99778 0.231
NP_439990.1_5 Reverse -231 -244 8.08242 0.181
NP_442376.1_2 Forward -250 -231 -12.6852 0.286
NP_442911.1_2 Forward -255 -236 -0.295539 0.0737
NP_442911.1_2 Reverse -226 -245 -2.0655 0.0939
NP_440153.1_5 Forward -244 -230 1.86788 0.245
NP_443055.1_3 Forward -200 -181 15.1332 0.105
NP_443055.1_3 Forward -73 -54 12.555 0.21
NP_440993.1_2 Reverse -231 -247 1.23851 0.286
NP_440138.1_6 Reverse -237 -256 4.52188 0.237
NP_441099.1_5 Forward -255 -236 5.11266 0.0474
NP_442002.1_1 Forward -381 -363 2.18243 0.173
NP_442002.1_9 Forward -246 -239 14.1004 0.074
NP_440809.1_9 Reverse -227 -245 -7.25734 0.225
NP_441646.1_1 Forward -252 -233 8.55425 0.141
NP_441646.1_1 Reverse -175 -194 1.37609 0.231
NP_442431.1_10 Forward -386 -368 5.32902 0.201
NP_441000.1_6 Reverse -235 -249 -3.44199 0.221
NP_441000.1_6 Forward -246 -232 -4.4253 0.243
NP_442771.1_1 Reverse -234 -252 -6.56903 0.168
NP_440147.1_4 Reverse -234 -247 11.6223 0.0326
NP_440147.1_4 Forward -247 -234 9.95071 0.0362
NP_441550.1_8 Forward -247 -237 18.1707 0.00754
NP_441550.1_8 Reverse -234 -244 13.0576 0.0273
NP_441916.1_7 Forward -245 -235 18.9579 0.00144
NP_441916.1_7 Reverse -236 -246 16.893 0.00407
NP_440206.1_4 Forward -327 -308 -1.96793 0.293
NP_441041.1_4 Forward -245 -226 -3.3438 0.121
NP_441041.1_4 Forward -76 -57 -8.752 0.207
NP_441041.1_7 Forward -248 -236 10.8188 0.0864
NP_441041.1_7 Reverse -233 -245 6.34865 0.211
NP_442004.1_6 Reverse -313 -327 2.65453 0.26
NP_441725.1_4 Forward -250 -236 9.04542 0.178
NP_441725.1_5 Reverse -237 -247 11.7798 0.0247
NP_441725.1_5 Forward -244 -234 11.1898 0.0247
NP_439966.1_7 Reverse -234 -244 14.8275 0.0177
NP_439966.1_7 Forward -247 -237 8.63269 0.132
NP_440202.1_8 Reverse -183 -202 17.6846 0.192
NP_440202.1_8 Forward -199 -180 9.32 0.297
NP_442941.1_3 Forward -244 -234 19.9412 0.00262
NP_442941.1_3 Reverse -237 -247 10.6981 0.0116
NP_440289.1_2 Reverse -233 -246 6.70579 0.0591
NP_440289.1_2 Forward -248 -235 5.62415 0.0623
NP_440802.1_8 Reverse -188 -207 17.0107 0.237
NP_442281.1_1 Reverse -231 -245 9.24208 0.0726
NP_442281.1_1 Forward -327 -313 6.19383 0.133
NP_442281.1_1 Forward -250 -236 3.93223 0.213
NP_442256.1_2 Forward -247 -229 -8.43732 0.224
NP_440437.1_1 Reverse -211 -230 -5.21209 0.276
NP_440647.1_9 Forward -247 -229 3.75572 0.263
NP_441087.1_5 Reverse -357 -376 9.83173 0.141
NP_441556.1_7 Reverse -181 -200 20.4514 0.056
NP_440498.1_1 Reverse -227 -245 -0.275845 0.218
NP_442982.1_5 Reverse -226 -245 -0.295539 0.254
NP_441644.1_6 Forward -245 -235 19.0557 0.000803
NP_441644.1_6 Reverse -236 -246 15.7125 0.0048
NP_441644.1_6 Reverse -182 -192 5.97777 0.172
NP_441644.1_6 Forward -191 -181 5.87944 0.174
NP_440253.1_2 Forward -371 -353 0.0191479 0.198
NP_440929.1_8 Forward -245 -236 19.2726 0.000701
NP_440929.1_8 Reverse -236 -245 19.2726 0.000701
NP_442933.1_10 Forward -245 -236 17.601 0.00325
NP_442933.1_10 Reverse -236 -245 17.601 0.00325
NP_441751.2_8 Forward -244 -230 6.19444 0.0387
NP_441751.2_8 Reverse -237 -251 5.80112 0.0408
NP_441751.2_8 Reverse -177 -191 -5.21195 0.199
NP_442926.1_3 Reverse -237 -256 9.24257 0.16
NP_442554.1_8 Forward -244 -234 16.9913 0.0065
NP_442554.1_8 Reverse -237 -247 15.123 0.00944
NP_442554.1_8 Reverse -183 -193 5.28991 0.153
NP_442554.1_8 Forward -190 -180 4.79825 0.173
NP_442554.1_8 Reverse -213 -223 1.74999 0.298
NP_441762.1_7 Forward -246 -234 1.61227 0.0736
NP_441762.1_7 Reverse -235 -247 -6.74586 0.284
NP_442142.1_4 Reverse -233 -246 8.18017 0.12
NP_442142.1_4 Forward -248 -235 4.54195 0.217
NP_442292.1_1 Forward -244 -235 17.5026 0.00435
NP_442292.1_1 Reverse -237 -246 9.53783 0.0183
NP_442476.1_6 Reverse -237 -251 6.29277 0.13
NP_442381.1_8 Reverse -233 -252 -14.2585 0.28
NP_442381.1_8 Forward -256 -237 -14.5535 0.283
NP_443009.1_5 Reverse -235 -246 17.0694 0.00659
NP_443009.1_5 Forward -246 -235 16.7744 0.00677
NP_443009.1_5 Forward -323 -312 7.72798 0.122
NP_441865.1_3 Reverse -6 -24 13.2938 0.252
NP_441715.1_4 Forward -244 -234 14.238 0.0295
NP_441715.1_4 Reverse -237 -247 9.81313 0.097
NP_440183.1_9 Reverse -184 -203 -9.93197 0.226
NP_441198.1_8 Reverse -234 -244 13.2713 0.108
NP_441468.1_1 Forward -244 -237 15.8704 0.0124
NP_441468.1_1 Reverse -237 -244 15.8704 0.0124
NP_441020.2_6 Reverse -234 -251 16.8534 0.0241
NP_441015.1_10 Forward -382 -363 -1.7705 0.176
NP_441015.1_10 Forward -388 -369 -9.24366 0.281
NP_441673.1_1 Forward -245 -236 20.8459 0.000698
NP_441673.1_1 Reverse -236 -245 20.8459 0.000698
NP_442253.1_5 Forward -194 -177 1.71047 0.159
NP_441826.1_2 Reverse -230 -244 -4.62196 0.298
NP_441826.1_5 Forward -389 -370 6.78429 0.222
NP_441764.1_4 Forward -359 -342 9.69521 0.281
NP_442868.1_6 Forward -247 -237 18.5646 0.0104
NP_442868.1_6 Reverse -234 -244 1.06167 0.205
NP_441056.1_1 Forward -245 -226 -8.94866 0.286
NP_442227.1_2 Reverse -297 -316 -1.08219 0.262
NP_442808.1_1 Reverse -235 -245 8.73102 0.0481
NP_442808.1_1 Forward -246 -236 8.73102 0.0481
NP_442808.1_1 Reverse -190 -200 1.94622 0.281
NP_441101.1_10 Reverse -309 -328 -4.72043 0.281
NP_442542.1_2 Forward -247 -234 10.4424 0.126
NP_442050.1_5 Reverse -234 -244 18.0724 0.00365
NP_442050.1_5 Forward -247 -237 13.6475 0.0295
NP_442342.1_9 Forward -247 -231 10.1866 0.137
NP_440558.1_2 Reverse -178 -197 3.6377 0.154
NP_440558.1_2 Forward -194 -175 -0.590531 0.204
NP_441878.1_6 Forward -246 -236 20.2362 0.0046
NP_441878.1_6 Reverse -235 -245 10.5014 0.0176
NP_441878.1_6 Forward -192 -182 0.766681 0.134
NP_441878.1_6 Reverse -181 -191 0.668351 0.139
NP_441878.1_6 Reverse -253 -263 -7.68978 0.255
NP_441036.1_8 Reverse -235 -245 15.713 0.00724
NP_441036.1_8 Forward -246 -236 8.4365 0.174
NP_441557.1_5 Forward -245 -236 19.9609 0.000699
NP_441557.1_5 Reverse -236 -245 19.9609 0.000699
NP_441557.1_8 Forward -321 -311 15.8108 0.18
NP_441445.1_1 Reverse -227 -246 5.70265 0.165
NP_441433.1_8 Forward -205 -186 -3.83545 0.285
NP_441308.1_8 Reverse -234 -244 13.353 0.218
NP_442183.1_1 Forward -245 -231 7.27608 0.145
NP_442183.1_1 Reverse -236 -250 4.22782 0.271
NP_440595.1_1 Forward -139 -120 14.0608 0.0628
NP_441116.1_6 Forward -76 -57 7.57094 0.29
NP_441549.1_9 Forward -249 -231 -5.68405 0.198
NP_442347.1_2 Forward -244 -235 3.34298 0.284
NP_442347.1_2 Reverse -237 -246 3.34298 0.284
NP_442645.1_2 Forward -193 -174 -18.4868 0.274
NP_441037.1_4 Forward -247 -237 9.55921 0.21
NP_441037.1_4 Reverse -234 -244 7.31769 0.237
NP_442594.1_8 Forward -379 -360 3.73603 0.279
NP_440151.1_5 Reverse -307 -326 7.07928 0.225
NP_441633.1_3 Forward -266 -253 -2.83231 0.177
NP_441633.1_3 Reverse -234 -247 -3.71729 0.177
NP_441633.1_3 Forward -247 -234 -3.91395 0.177
NP_440136.1_2 Forward -244 -237 15.9687 0.0123
NP_440136.1_2 Reverse -237 -244 15.9687 0.0123
NP_442998.1_10 Forward -243 -236 15.5754 0.0102
NP_442998.1_10 Reverse -238 -245 15.5754 0.0102
NP_440299.1_1 Forward -249 -236 13.6867 0.0298
NP_440299.1_1 Reverse -232 -245 3.55864 0.241
NP_441799.1_1 Forward -249 -235 14.5519 0.0228
NP_441799.1_1 Reverse -232 -246 6.48882 0.17
NP_441007.1_10 Forward -250 -237 -0.865694 0.295
NP_442201.1_10 Forward -256 -237 -6.68705 0.184
NP_440256.1_1 Reverse -233 -252 13.6675 0.00982
NP_440256.1_1 Forward -248 -229 -8.85033 0.268
NP_441559.1_8 Reverse -177 -191 3.04785 0.143
NP_441559.1_8 Reverse -231 -245 1.27789 0.156
NP_441559.1_8 Forward -196 -182 0.491246 0.166
NP_440915.1_6 Forward -249 -235 18.4858 0.0114
NP_440915.1_6 Reverse -232 -246 2.06454 0.126
NP_442855.1_3 Reverse -167 -186 13.6675 0.221
NP_442785.1_7 Reverse -234 -248 10.6193 0.228
NP_441704.1_8 Reverse -225 -244 6.1935 0.262
NP_440748.1_5 Reverse -239 -258 -1.86883 0.27
NP_441464.1_2 Reverse -370 -380 17.2863 0.221
NP_441464.1_8 Reverse -236 -250 5.21113 0.26
NP_442453.1_6 Reverse -188 -202 18.2045 0.113
NP_441199.1_6 Reverse -232 -251 9.63589 0.0851
NP_442993.1_1 Forward -245 -229 -0.531451 0.077
NP_442386.1_9 Forward -246 -237 6.39082 0.219
NP_442386.1_9 Reverse -235 -244 6.39082 0.219
NP_441340.1_5 Forward -244 -237 15.6737 0.0124
NP_441340.1_5 Reverse -237 -244 15.6737 0.0124
NP_442186.1_9 Reverse -380 -399 3.73603 0.294
NP_441132.1_3 Reverse -304 -323 2.55606 0.294
NP_440161.1_3 Forward -247 -228 16.6174 0.0811
NP_440161.1_3 Reverse -234 -253 14.9458 0.118
NP_440586.1_8 Forward -244 -237 13.2151 0.026
NP_440586.1_8 Reverse -237 -244 13.2151 0.026
NP_442251.1_6 Forward -244 -237 15.2804 0.0124
NP_442251.1_6 Reverse -237 -244 15.2804 0.0124
NP_440192.1_5 Forward -390 -371 5.30933 0.237
NP_441262.1_3 Reverse -236 -243 14.7888 0.0223
NP_441262.1_3 Forward -245 -238 14.7888 0.0223
NP_440027.1_3 Reverse -182 -200 1.88669 0.295
NP_443051.1_1 Reverse -235 -244 19.5676 0.00335
NP_443051.1_1 Forward -246 -237 18.0926 0.00402
NP_439996.1_1 Forward -76 -57 10.1275 0.235
NP_441232.1_10 Forward -256 -237 14.9458 0.0591
NP_439937.1_9 Reverse -235 -252 -14.8098 0.287
NP_439937.1_9 Forward -246 -229 -15.0064 0.287
NP_440439.1_1 Reverse -233 -246 18.2105 0.0105
NP_440439.1_1 Forward -248 -235 1.69091 0.147
NP_440439.1_1 Forward -194 -181 1.49425 0.153
NP_440439.1_1 Reverse -376 -389 -2.144 0.298
NP_440372.1_2 Forward -244 -237 16.3621 0.0124
NP_440372.1_2 Reverse -237 -244 16.3621 0.0124
NP_441789.1_7 Reverse -370 -389 4.71854 0.193
NP_441789.1_7 Reverse -361 -380 -5.60616 0.299
NP_440819.1_5 Forward -313 -305 6.41093 0.285
NP_440139.1_1 Forward -251 -232 8.65176 0.109
NP_441572.1_7 Reverse -166 -185 -2.85214 0.203
NP_440267.1_2 Reverse -231 -245 9.6354 0.156
NP_440267.1_2 Forward -250 -236 9.6354 0.156
NP_442384.1_10 Reverse -236 -249 20.7671 0.00203
NP_442384.1_10 Forward -245 -232 6.50913 0.0995
NP_442384.1_10 Reverse -182 -195 6.01747 0.113
NP_442384.1_10 Forward -322 -309 3.85419 0.176
NP_442384.1_10 Forward -226 -213 1.69091 0.249
NP_442384.1_10 Forward -334 -321 0.904263 0.275
NP_442790.1_4 Forward -254 -235 0.687771 0.0876
NP_442262.1_10 Forward -244 -237 14.1988 0.0123
NP_442262.1_10 Reverse -237 -244 14.1988 0.0123
NP_441689.1_5 Reverse -234 -244 17.8758 0.0158
NP_440344.1_10 Forward -252 -235 -10.9742 0.197
NP_440531.1_6 Forward -199 -180 -1.37718 0.231
NP_442123.1_3 Reverse -236 -255 16.3224 0.0904
NP_441965.1_10 Forward -248 -232 6.74504 0.165
NP_441965.1_10 Reverse -179 -195 4.18844 0.247
NP_442529.1_4 Forward -254 -235 8.84924 0.255
NP_442693.1_6 Forward -328 -309 1.67108 0.278
NP_440297.1_9 Reverse -237 -247 9.61647 0.0917
NP_440297.1_9 Forward -244 -234 9.22315 0.0917
NP_442280.1_1 Reverse -236 -255 8.65258 0.162
NP_440894.1_10 Forward -126 -107 6.88262 0.211
NP_440888.1_2 Forward -245 -231 12.2903 0.0476
NP_440888.1_2 Reverse -236 -250 8.25877 0.167
NP_440600.1_4 Forward -253 -235 1.78911 0.125
NP_440052.1_8 Reverse -311 -330 8.06259 0.296
NP_442033.1_10 Forward -247 -228 -11.3086 0.251
NP_441543.1_2 Forward -244 -235 15.9293 0.00518
NP_441543.1_2 Reverse -237 -246 9.34117 0.0818
NP_442845.1_2 Reverse -176 -190 8.75105 0.187
NP_441834.1_10 Forward -388 -369 5.40766 0.26
NP_441551.1_5 Forward -249 -233 10.2842 0.193
NP_441178.1_6 Reverse -364 -383 5.89851 0.268
NP_441469.1_8 Forward -246 -237 13.3727 0.073
NP_441469.1_8 Reverse -235 -244 6.5879 0.227
NP_443064.1_6 Reverse -236 -246 13.8273 0.0796
NP_443064.1_6 Forward -245 -235 10.8217 0.13
NP_442578.1_7 Forward -244 -237 14.5921 0.026
NP_442578.1_7 Reverse -237 -244 14.5921 0.026
NP_440710.1_1 Forward -253 -235 2.47742 0.121
NP_441462.1_2 Forward -245 -235 20.2362 0.000805
NP_441462.1_2 Reverse -236 -246 20.1379 0.000967
NP_441621.1_7 Forward -247 -233 2.5562 0.123
NP_443062.1_1 Forward -245 -227 17.2241 0.026
NP_443062.1_1 Reverse -236 -254 7.66836 0.17
NP_443062.1_6 Reverse -228 -247 5.89931 0.193
NP_441410.1_3 Reverse -227 -246 8.94757 0.21
NP_440519.1_8 Reverse -313 -329 11.8583 0.181
NP_440519.1_8 Forward -392 -376 5.76173 0.21
NP_442204.1_1 Reverse -232 -243 9.49844 0.0759
NP_442204.1_6 Forward -386 -367 5.60432 0.271
NP_442780.1_3 Reverse -5 -24 8.16414 0.269
NP_440516.1_2 Reverse -176 -194 2.18243 0.18
NP_440516.1_8 Forward -245 -236 16.9127 0.00442
NP_440516.1_8 Reverse -236 -245 16.9127 0.00442
NP_442080.1_8 Forward -388 -369 8.35759 0.244
NP_442428.1_5 Forward -244 -237 15.8704 0.0124
NP_442428.1_5 Reverse -237 -244 15.8704 0.0124
NP_440673.1_3 Forward -243 -236 12.4288 0.0426
NP_440673.1_3 Reverse -238 -245 12.4288 0.0426
NP_440865.1_9 Reverse -230 -249 -8.752 0.269
NP_441052.1_2 Forward -245 -235 10.4031 0.0285
NP_441052.1_2 Reverse -236 -246 10.4031 0.0285
NP_441052.1_2 Reverse -182 -192 2.33998 0.209
NP_442219.1_9 Forward -244 -235 8.25953 0.0681
NP_442219.1_9 Reverse -237 -246 8.25953 0.0681
NP_440436.1_4 Reverse -237 -246 15.9289 0.00508
NP_440436.1_4 Forward -244 -235 9.24241 0.0871
NP_440436.1_4 Forward -321 -312 6.78414 0.147
NP_441884.1_8 Forward -246 -227 -7.67036 0.254
NP_442907.1_9 Reverse -231 -250 -6.09707 0.289
NP_441719.1_2 Reverse -53 -67 15.4628 0.265
NP_441719.1_4 Forward -244 -237 16.3621 0.0124
NP_441719.1_4 Reverse -237 -244 16.3621 0.0124
NP_441733.1_10 Reverse -233 -246 4.14919 0.273
NP_442366.1_3 Forward -246 -228 9.65558 0.0543
NP_442366.1_3 Reverse -152 -170 -3.81576 0.258
NP_440129.1_10 Forward -252 -238 4.32615 0.185
NP_441115.1_4 Reverse -235 -253 7.58986 0.279
NP_443054.1_2 Reverse -234 -248 0.88457 0.252
NP_441851.1_10 Forward -246 -236 17.4829 0.0027
NP_441851.1_10 Reverse -235 -245 8.53483 0.114
NP_441851.1_10 Reverse -312 -322 6.17489 0.182
NP_442622.1_8 Reverse -236 -254 -8.92897 0.138
NP_442515.1_1 Reverse -235 -249 5.50613 0.107
NP_442515.1_1 Forward -246 -232 2.65453 0.131
NP_442515.1_1 Forward -264 -250 -0.983719 0.241
NP_440165.1_5 Reverse -235 -254 2.75272 0.103
NP_440940.1_7 Reverse -373 -391 6.01657 0.225
NP_441349.1_10 Reverse -226 -245 12.5858 0.0201
NP_441349.1_10 Forward -255 -236 -4.52377 0.173
NP_441409.1_6 Reverse -230 -249 -14.0619 0.249
NP_441409.1_6 Forward -251 -232 -15.2418 0.285
NP_442314.1_1 Forward -202 -184 -4.30741 0.256
NP_440432.1_9 Reverse -237 -252 7.35472 0.0427
NP_442843.1_1 Reverse -237 -256 -10.7186 0.28
NP_442843.1_1 Forward -379 -360 -11.6036 0.291
NP_441477.1_5 Forward -204 -185 11.6025 0.268
NP_441477.1_5 Reverse -178 -197 5.70265 0.293
NP_440431.1_7 Forward -303 -284 -1.86883 0.297
NP_442450.1_5 Forward -247 -237 10.0098 0.115
NP_442450.1_5 Reverse -234 -244 9.41981 0.115
NP_442450.1_5 Forward -228 -218 5.97822 0.209
NP_442168.1_5 Reverse -237 -256 4.32602 0.218
NP_440588.1_2 Reverse -227 -246 7.37428 0.0502
NP_441003.1_9 Forward -343 -324 3.53937 0.291
NP_441570.1_1 Forward -245 -227 1.69077 0.029
NP_441570.1_1 Reverse -236 -254 -5.88071 0.0761
NP_441078.1_4 Forward -245 -236 19.6659 0.0007
NP_441078.1_4 Reverse -236 -245 19.6659 0.0007
NP_441078.1_4 Reverse -182 -191 5.50626 0.111
NP_441078.1_4 Forward -191 -182 -1.6719 0.266
NP_441663.1_8 Reverse -373 -392 16.4207 0.0374
NP_441663.1_8 Forward -328 -309 -3.63879 0.294
NP_440707.1_9 Forward -379 -360 -0.197208 0.299
NP_442443.1_1 Forward -379 -360 -3.24547 0.265
NP_442443.1_1 Reverse -373 -392 -4.32711 0.271
NP_440793.1_1 Reverse -11 -25 17.1085 0.204
NP_440526.1_3 Forward -321 -310 5.46638 0.247
NP_440526.1_3 Reverse -237 -248 1.72983 0.267
NP_441432.1_8 Reverse -235 -244 16.8143 0.00595
NP_441432.1_8 Forward -246 -237 8.35786 0.0755
NP_441732.1_2 Reverse -232 -248 -7.70961 0.0885
NP_441732.1_2 Reverse -178 -194 -16.6577 0.186
NP_440629.1_1 Reverse -78 -96 9.36059 0.114
NP_442003.1_4 Reverse -237 -256 9.3409 0.3
NP_440760.1_1 Forward -64 -45 -14.5535 0.133
NP_440760.1_1 Reverse -236 -255 -18.4868 0.214
NP_440713.1_4 Reverse -226 -245 11.2092 0.119
NP_442489.1_2 Reverse -225 -244 7.7676 0.172
NP_442489.1_7 Forward -245 -236 20.1576 0.000695
NP_442489.1_7 Reverse -236 -245 20.1576 0.000695
NP_442489.1_7 Forward -191 -182 -1.6719 0.235
NP_442489.1_7 Reverse -182 -191 -1.77023 0.247
NP_442079.1_7 Reverse -237 -256 9.24257 0.113
NP_442079.1_7 Forward -244 -225 5.50599 0.172
NP_440559.1_1 Reverse -237 -246 17.306 0.00658
NP_440559.1_1 Forward -244 -235 8.65285 0.0586
NP_441659.2_8 Forward -245 -235 20.9245 0.000805
NP_441659.2_8 Reverse -236 -246 19.3512 0.000966
NP_442913.1_10 Forward -254 -235 -5.60541 0.271
NP_442008.1_2 Reverse -233 -252 13.8641 0.0822
NP_441800.1_7 Reverse -356 -374 1.19912 0.21
NP_442346.1_2 Reverse -171 -190 4.52268 0.289
NP_442346.1_5 Forward -246 -236 17.9746 0.00128
NP_442346.1_5 Reverse -235 -245 16.303 0.00248
NP_442346.1_5 Reverse -312 -322 5.68323 0.234
NP_442346.1_5 Forward -192 -182 4.69992 0.276
NP_442346.1_5 Reverse -181 -191 4.69992 0.276
NP_440545.1_3 Reverse -178 -195 7.31533 0.0511
NP_440545.1_3 Reverse -232 -249 4.26707 0.073
NP_440545.1_3 Forward -249 -232 -1.0428 0.162
NP_441856.1_3 Forward -248 -229 -1.47551 0.239
NP_441856.1_7 Forward -389 -370 20.5506 0.181
NP_441653.1_2 Forward -256 -237 2.17674 0.299
NP_440010.1_3 Forward -382 -363 -8.16202 0.294
NP_442551.1_4 Forward -193 -178 -1.88839 0.25
NP_442603.1_7 Reverse -236 -250 6.19383 0.253
NP_442603.1_9 Forward -198 -180 7.68896 0.279
NP_441888.1_7 Forward -250 -236 2.94952 0.225
NP_441888.1_9 Reverse -49 -68 14.3605 0.278
NP_440449.1_6 Reverse -174 -192 8.64489 0.197
NP_441948.1_4 Reverse -229 -247 4.6407 0.0902
NP_441948.1_4 Forward -252 -234 -2.14413 0.16
NP_441833.1_4 Forward -244 -237 15.9687 0.0124
NP_441833.1_4 Reverse -237 -244 15.9687 0.0124
NP_442162.1_9 Forward -244 -237 16.2637 0.0124
NP_442162.1_9 Reverse -237 -244 16.2637 0.0124
NP_440671.1_4 Reverse -230 -244 14.7492 0.0565
NP_442140.1_3 Reverse -237 -247 11.5831 0.0743
NP_441609.1_1 Reverse -49 -68 -1.86883 0.275
NP_440875.1_2 Reverse -177 -196 11.1109 0.137
NP_440875.1_9 Forward -243 -233 8.27469 0.233
NP_441813.1_5 Forward -247 -237 18.3679 0.00743
NP_441813.1_5 Reverse -234 -244 15.9097 0.01
NP_440594.1_8 Reverse -237 -250 12.3101 0.152
NP_440590.1_4 Reverse -237 -250 -5.78224 0.289
NP_440567.1_1 Reverse -237 -251 7.07942 0.0779
NP_442497.1_10 Reverse -237 -246 19.8626 0.00532
NP_442497.1_10 Forward -244 -235 17.601 0.00813
NP_440821.1_4 Reverse -234 -244 11.0914 0.0146
NP_440821.1_4 Forward -247 -237 10.9931 0.0146
NP_441239.1_9 Reverse -234 -246 15.6736 0.0186
NP_441239.1_9 Forward -247 -235 12.6253 0.0446
NP_441239.1_9 Forward -193 -181 9.28209 0.11
NP_440400.1_1 Reverse -371 -390 3.44025 0.232
NP_441892.1_1 Reverse -227 -244 0.727158 0.163
NP_440604.1_6 Reverse -236 -255 -0.787193 0.189
NP_440546.1_4 Forward -245 -235 13.5365 0.0459
NP_440546.1_4 Reverse -236 -246 12.8578 0.0572
NP_440546.1_4 Reverse -313 -323 8.59164 0.181
NP_440546.1_4 Forward -191 -181 8.00989 0.209
NP_440546.1_4 Reverse -153 -163 7.62206 0.23
NP_440675.1_3 Reverse -236 -255 9.53756 0.186
NP_440462.1_4 Reverse -312 -326 7.37441 0.278
NP_440462.1_6 Reverse -234 -244 16.893 0.00853
NP_440462.1_6 Forward -247 -237 9.7148 0.0429
NP_440462.1_9 Forward -325 -306 16.5191 0.156
NP_440868.1_4 Reverse -232 -244 12.9203 0.0231
NP_440868.1_4 Forward -249 -237 1.31728 0.186
NP_440868.1_8 Reverse -309 -328 -0.197208 0.263
NP_442499.1_1 Forward -268 -249 3.53937 0.252
NP_441879.1_3 Forward -244 -225 19.2723 0.0159
NP_441474.1_1 Reverse -360 -379 -2.75457 0.285
NP_441848.1_10 Reverse -16 -29 17.249 0.177
NP_440696.1_3 Forward -249 -231 -3.02911 0.282
NP_440696.1_3 Forward -185 -167 -3.32411 0.285
NP_442882.1_7 Forward -252 -238 15.9285 0.261
NP_442039.1_4 Forward -244 -237 15.1821 0.0124
NP_442039.1_4 Reverse -237 -244 15.1821 0.0124
NP_441811.1_2 Forward -300 -281 15.8299 0.284
NP_442679.1_1 Forward -324 -305 -2.95047 0.245
NP_442837.1_3 Forward -244 -237 15.7721 0.0124
NP_442837.1_3 Reverse -237 -244 15.7721 0.0124
NP_442053.1_1 Forward -245 -236 18.3876 0.0007
NP_442053.1_1 Reverse -236 -245 18.3876 0.0007
NP_440505.1_3 Reverse -234 -244 15.123 0.014
NP_440505.1_3 Forward -247 -237 9.61647 0.122
NP_440914.1_1 Forward -245 -235 16.3248 0.00196
NP_440914.1_1 Reverse -236 -246 8.51751 0.186
NP_441011.1_8 Forward -244 -235 16.6177 0.00602
NP_441011.1_8 Reverse -237 -246 14.356 0.0249
NP_442101.1_10 Reverse -228 -247 -13.5702 0.297
NP_442533.1_1 Forward -380 -361 -11.9969 0.236
NP_442533.1_6 Forward -245 -236 17.2076 0.00137
NP_442533.1_6 Reverse -236 -245 17.2076 0.00137
NP_442533.1_6 Reverse -182 -191 15.831 0.00468
NP_442533.1_6 Forward -191 -182 6.78456 0.103
NP_442541.1_3 Reverse -244 -263 17.0107 0.0555
NP_442232.1_3 Reverse -228 -247 -14.9469 0.288
NP_442322.1_4 Reverse -360 -377 -9.89323 0.297
NP_441482.1_7 Reverse -230 -244 7.9644 0.0215
NP_441482.1_7 Forward -251 -237 4.71948 0.0454
NP_439944.1_9 Forward -244 -234 17.6796 0.00347
NP_439944.1_9 Reverse -237 -247 8.82982 0.101
NP_439944.1_10 Forward -389 -370 26.2538 0.00775
NP_440816.1_7 Reverse -232 -251 11.1109 0.218
NP_440116.1_5 Reverse -233 -250 2.98877 0.249
NP_440116.1_8 Reverse -237 -256 -4.52377 0.174
NP_440116.1_8 Forward -244 -225 -4.91709 0.182
NP_440115.1_6 Reverse -233 -243 7.45319 0.147
NP_440115.1_6 Forward -248 -238 7.05986 0.161
NP_440007.1_9 Forward -230 -216 7.47274 0.208
NP_439965.1_1 Reverse -227 -246 -9.24366 0.284
NP_443045.1_9 Reverse -362 -380 6.60656 0.3
NP_441972.1_5 Reverse -237 -256 -4.13045 0.206
NP_441972.1_5 Reverse -369 -388 -7.96535 0.256
NP_441106.1_1 Reverse -235 -244 18.486 0.0028
NP_441106.1_1 Forward -246 -237 9.73449 0.0311
NP_439903.1_6 Reverse -233 -252 2.55527 0.225
NP_442306.1_10 Reverse -231 -250 -20.65 0.219
NP_441286.1_1 Reverse -235 -247 6.03717 0.0258
NP_441286.1_1 Forward -246 -234 4.95553 0.027
NP_442674.1_3 Reverse -272 -291 2.75194 0.299
NP_440670.1_8 Forward -245 -236 18.3876 0.000699
NP_440670.1_8 Reverse -236 -245 18.3876 0.000699
NP_440886.1_7 Forward -246 -236 8.04271 0.0805
NP_440886.1_7 Reverse -235 -245 8.04271 0.0805
NP_440886.1_7 Reverse -370 -380 4.89613 0.213
NP_440828.1_1 Reverse -370 -389 10.7167 0.182
NP_440828.1_4 Reverse -181 -200 -8.35941 0.296
NP_442614.1_2 Reverse -31 -45 8.25939 0.255
NP_441399.1_6 Reverse -176 -195 16.1249 0.185
NP_442072.1_9 Forward -246 -228 -22.4003 0.234
NP_440513.1_4 Reverse -236 -255 8.06259 0.295
NP_442022.1_4 Forward -389 -370 12.8808 0.168
NP_440907.2_8 Reverse -237 -247 9.91099 0.103
NP_440907.2_8 Forward -244 -234 9.51767 0.103
NP_441021.1_1 Reverse -237 -256 -0.688862 0.104
NP_440841.1_4 Reverse -234 -253 -9.34199 0.258
NP_441463.1_3 Forward -255 -236 7.7676 0.0503
NP_441463.1_3 Reverse -226 -245 -0.590531 0.133
NP_441463.1_6 Reverse -234 -248 5.64286 0.287
NP_441626.1_2 Forward -244 -237 15.7721 0.0124
NP_441626.1_2 Reverse -237 -244 15.7721 0.0124
NP_442365.1_7 Reverse -232 -251 0.884433 0.175
NP_442794.1_1 Forward -267 -255 4.07055 0.279
NP_442615.1_1 Reverse -227 -245 6.70565 0.034
NP_442615.1_1 Forward -254 -236 -6.86402 0.266
NP_440387.1_1 Reverse -236 -252 0.55019 0.124
NP_440387.1_1 Forward -245 -229 -3.57971 0.162
NP_441174.1_1 Reverse -304 -319 10.7963 0.262
NP_440467.1_3 Reverse -237 -256 14.8697 0.156
NP_440114.1_10 Reverse -236 -250 12.6843 0.0754
NP_440114.1_10 Forward -245 -231 8.45605 0.202
NP_441510.2_9 Reverse -237 -256 8.35759 0.165
NP_440293.1_3 Forward -208 -189 -3.73712 0.252
NP_440293.1_10 Forward -392 -373 1.37609 0.219
NP_440766.1_4 Reverse -232 -246 4.22782 0.133
NP_439988.1_7 Reverse -238 -252 12.6836 0.292
NP_439910.1_2 Reverse -228 -245 -13.7275 0.162
NP_442278.1_3 Reverse -46 -64 14.8015 0.256
NP_440457.1_1 Forward -249 -237 18.7219 0.0379
NP_440457.1_1 Reverse -232 -244 1.41561 0.239
NP_440798.1_6 Forward -244 -231 0.707601 0.251
NP_440473.1_1 Reverse -233 -252 11.3538 0.276
NP_442509.1_9 Reverse -236 -246 17.3841 0.00128
NP_442509.1_9 Forward -245 -235 8.04271 0.192
NP_442509.1_9 Reverse -328 -338 7.0594 0.24
NP_442509.1_9 Reverse -379 -389 6.17443 0.286
NP_442514.1_5 Forward -324 -305 -8.85106 0.29
NP_440554.1_4 Forward -244 -234 16.1063 0.0189
NP_440554.1_4 Reverse -237 -247 8.82982 0.0646
NP_441885.1_5 Forward -245 -235 11.3864 0.00668
NP_441885.1_5 Reverse -236 -246 11.3864 0.00668
NP_442341.1_9 Forward -247 -233 10.2254 0.136
NP_442341.1_9 Forward -193 -179 5.40719 0.271
NP_442341.1_9 Reverse -215 -229 4.71887 0.294
NP_441173.1_9 Reverse -351 -359 10.9338 0.242
NP_442395.2_4 Reverse -235 -254 2.26028 0.223
NP_443000.1_7 Reverse -234 -244 17.4829 0.00719
NP_443000.1_7 Forward -247 -237 11.6814 0.0344
NP_441842.1_10 Forward -252 -238 7.66941 0.249
NP_440275.1_3 Forward -247 -237 16.9913 0.0133
NP_440275.1_3 Reverse -234 -244 9.12481 0.055
NP_440091.1_1 Reverse -232 -244 -0.354346 0.273
NP_443010.1_10 Reverse -233 -250 4.5102 0.229
NP_442451.1_2 Reverse -373 -392 -9.93197 0.26
NP_441190.1_2 Forward -166 -147 16.8141 0.0602
NP_440149.1_8 Forward -245 -226 -2.95047 0.178
NP_440149.1_8 Forward -263 -244 -5.31042 0.223
NP_441105.1_3 Reverse -249 -268 -9.14533 0.284
NP_441105.1_3 Forward -173 -154 -9.34199 0.288
NP_440216.1_1 Reverse -236 -250 16.4209 0.00307
NP_440216.1_1 Forward -245 -231 5.40779 0.0209
NP_440172.1_1 Forward -245 -235 17.5813 0.00421
NP_440172.1_1 Reverse -236 -246 16.303 0.00854
NP_442015.1_3 Reverse -369 -388 12.1917 0.265
NP_442015.1_10 Forward -249 -236 3.65753 0.178
NP_442015.1_10 Reverse -232 -245 1.49425 0.204
NP_441226.1_7 Forward -244 -237 14.4934 0.0123
NP_441226.1_7 Reverse -237 -244 14.4934 0.0123
NP_441111.1_7 Forward -244 -236 18.7023 0.00294
NP_441111.1_7 Reverse -237 -245 18.7023 0.00294
NP_441766.1_2 Forward -245 -236 17.5026 0.00297
NP_441766.1_2 Reverse -236 -245 17.5026 0.00297
NP_442252.1_3 Forward -264 -246 7.68896 0.291
NP_440416.1_9 Reverse -229 -248 -11.9969 0.155
NP_440416.1_9 Forward -329 -310 -15.4385 0.191
NP_440416.1_9 Forward -252 -233 -16.4218 0.215
NP_440416.1_9 Forward -264 -245 -19.0768 0.269
NP_443052.1_8 Reverse -42 -61 -6.98204 0.151
NP_443052.1_9 Reverse -364 -383 3.24438 0.164
NP_442403.1_8 Reverse -250 -269 -3.04881 0.296
NP_442154.1_1 Forward -391 -373 -8.63398 0.169
NP_442154.1_1 Forward -382 -364 -16.3038 0.238
NP_440261.1_5 Reverse -237 -250 -2.34066 0.0924
NP_440261.1_5 Forward -244 -231 -3.12731 0.115
NP_440261.1_5 Forward -321 -308 -3.4223 0.132
NP_440261.1_5 Reverse -183 -196 -8.53551 0.201
NP_440988.1_10 Reverse -332 -346 7.22233 0.219
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGCGTTATGGGGCCGTTCCGGTGGTGCGGGGAGTAGGCGGTTTGGTAAATACTGTTTTCGACCGGGATTATGACCAGAACCATCCCCCGGAGAAACGTAATGGTTTTGTTTTCTATCAACCGGATGAGTATGCCCTGGAAACGGCCCTCAGTCGGGCGATCGCCTTGTATAAGGATGATCCCGTGGCTTTTAAAACCTTGGCCTTGCAGGGCATGGCCTACGACTACTCTTGGAATAAACCAGGGCTCCAATATGTGGAAGCCTACGAATACATCCGGGCTTAACACCTCGGGTTTGTAACAGTTTCGTTACACTAGTTCAGAGGCGGAGTCAAAGCAGTTGGTCAAAGCTTCGTTCAGTATTATCCGCACTTAGATAAATAACAACAACTTAAGCATT

CDS

ATGGGATTCTTCGATTTATTCGGTAAAAAAACTGCCATGGTTGCCCCCAATGAAGCATTACCCGGGCGATCGGCCACTATGCCCGTGCCAGATAAGCATTTTGTCAACGGCAATCCTCTCAAAGCTCCCTTTCCCCAGGGAATGGAAACGGCTCTGTTTGGTTTAGGCTGTTTTTGGGGAGCAGAACGCAAATTTTGGCAAATACCTGGAGTTTACAGCACCGCTGTTGGTTATGCGGCTGGTTATACCCCCAATCCCACTTACCAAGAAGTTTGTACGGGTATGACTGGCCATAACGAAGTGGTTTTAGTAGCCTTTGATCCCCAGCAAGTGAGTTACGACCAATTGCTCAAAGTCTTTTGGGAAAGCCATAACCCTACCCAGGGCATGCGCCAGGGCAATGATGTGGGTACCCAATACCGCTCTGGCATTTACACCTATTCCGAAGCCCAACAACAGGCCGCTTTGGCATCGAAGCAAGCCTATCAGCAAGCTCTGCAACAGGCAGGCTACGGGGAAATTACCACGGAAATTTTACCAGCCCCGGATTTTTATTACGCTGAAGACTATCACCAACAATATTTGGCGAAAAACCCCAATGGTTACTGCGGTTTGGGGGGCACTAATGTGGCCTGCCCCATTGGCACAGAAGTTTCCCTGGGAGCTTAG

Protein

MGFFDLFGKKTAMVAPNEALPGRSATMPVPDKHFVNGNPLKAPFPQGMETALFGLGCFWGAERKFWQIPGVYSTAVGYAAGYTPNPTYQEVCTGMTGHNEVVLVAFDPQQVSYDQLLKVFWESHNPTQGMRQGNDVGTQYRSGIYTYSEAQQQAALASKQAYQQALQQAGYGEITTEILPAPDFYYAEDYHQQYLAKNPNGYCGLGGTNVACPIGTEVSLGA