Your browser is old and dusty. Try Google Chrome!

Details for sll1387

ORF sll1387
Accession NP_441557.1
Symbol pppA
Category serine/threonine protein phosphatase PppA
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -236 -250 11.111 0.253
NP_441061.1_2 Forward -349 -335 19.6658 0.0139
NP_440557.1_1 Forward -349 -330 8.65258 0.127
NP_440795.1_7 Forward -349 -342 14.6904 0.0123
NP_440795.1_7 Reverse -342 -349 14.6904 0.0123
NP_441418.1_6 Forward -350 -331 -19.9617 0.0997
NP_440815.1_5 Forward -350 -331 7.57094 0.249
NP_440897.1_6 Reverse -341 -360 -0.197979 0.182
NP_441453.1_1 Forward -56 -38 6.70489 0.227
NP_441453.1_4 Reverse -341 -349 16.539 0.00633
NP_441453.1_4 Forward -350 -342 16.539 0.00633
NP_442151.1_6 Forward -350 -336 18.1908 0.00782
NP_441818.1_1 Forward -349 -338 16.0861 0.0221
NP_440226.1_1 Forward -350 -331 11.1109 0.0569
NP_440120.1_4 Reverse -19 -33 14.3559 0.273
NP_442173.1_1 Forward -349 -341 15.4574 0.00633
NP_442173.1_1 Reverse -342 -350 15.4574 0.00633
NP_442752.1_4 Forward -350 -343 13.8055 0.0199
NP_442752.1_4 Reverse -341 -348 13.8055 0.0199
NP_442752.1_4 Forward -117 -110 5.34899 0.221
NP_443027.1_4 Reverse -339 -349 13.1564 0.0521
NP_443027.1_4 Forward -352 -342 11.8781 0.0872
NP_441812.1_1 Forward -161 -147 16.0269 0.193
NP_442975.1_10 Forward -354 -340 12.782 0.0459
NP_442975.1_10 Reverse -337 -351 4.03056 0.249
NP_440784.1_7 Forward -349 -342 15.9687 0.0123
NP_440784.1_7 Reverse -342 -349 15.9687 0.0123
NP_440061.1_9 Forward -352 -338 12.2903 0.0985
NP_440061.1_9 Forward -22 -8 7.47213 0.205
NP_440061.1_9 Forward -28 -14 5.99717 0.264
NP_441476.1_5 Reverse -336 -355 0.196116 0.19
NP_442062.1_8 Reverse -341 -351 19.4496 0.000558
NP_442062.1_8 Forward -350 -340 17.3846 0.00193
NP_441900.1_2 Reverse -319 -337 -4.40646 0.288
NP_441859.1_3 Forward -351 -332 9.93006 0.124
NP_440304.1_4 Reverse -339 -349 9.91146 0.051
NP_440304.1_4 Forward -352 -342 1.84832 0.299
NP_442242.1_4 Forward -349 -342 14.3954 0.0124
NP_442242.1_4 Reverse -342 -349 14.3954 0.0124
NP_442762.1_10 Reverse -6 -25 -17.7985 0.293
NP_440916.1_1 Forward -32 -18 12.0943 0.206
NP_441208.1_9 Reverse -338 -352 11.7993 0.145
NP_441594.1_6 Reverse -332 -351 4.32602 0.221
NP_441594.1_6 Forward -353 -334 3.44104 0.23
NP_440132.1_1 Forward -352 -334 9.36059 0.24
NP_440518.1_9 Reverse -23 -42 10.1275 0.293
NP_442110.1_7 Forward -350 -336 17.2075 0.0249
NP_442110.1_7 Forward -279 -265 2.45787 0.222
NP_441925.1_4 Reverse -302 -321 -17.5041 0.296
NP_441083.1_5 Forward -350 -340 20.3345 0.00053
NP_441083.1_5 Reverse -341 -351 11.3864 0.0159
NP_441738.1_2 Forward -348 -341 15.28 0.0102
NP_441738.1_2 Reverse -343 -350 15.28 0.0102
NP_441738.1_2 Reverse -285 -292 8.29857 0.176
NP_441558.1_5 Forward -352 -333 13.9625 0.0531
NP_440209.1_1 Reverse -341 -349 18.1123 0.00295
NP_440209.1_1 Forward -350 -342 18.1123 0.00295
NP_442889.1_8 Forward -353 -339 13.5686 0.0588
NP_440178.1_7 Forward -351 -332 -3.63879 0.0481
NP_442570.1_3 Forward -352 -333 -5.21209 0.241
NP_441792.1_5 Reverse -55 -71 10.8749 0.209
NP_441716.1_1 Reverse -341 -355 3.93283 0.259
NP_441716.1_1 Forward -350 -336 3.73617 0.259
NP_442111.1_4 Reverse -340 -354 20.9441 0.00257
NP_441624.1_7 Forward -145 -131 7.17775 0.265
NP_440906.1_5 Forward -349 -342 15.8704 0.0124
NP_440906.1_5 Reverse -342 -349 15.8704 0.0124
NP_440747.1_10 Reverse -338 -350 7.51213 0.00286
NP_440747.1_10 Forward -353 -341 7.21714 0.00643
NP_441130.1_10 Forward -352 -338 17.4042 0.0167
NP_441130.1_10 Reverse -339 -353 8.84938 0.131
NP_441486.1_1 Reverse -338 -352 4.71948 0.0415
NP_441486.1_1 Forward -58 -44 -3.24533 0.177
NP_441486.1_1 Forward -353 -339 -3.93365 0.184
NP_442145.1_4 Reverse -208 -227 2.81659 0.299
NP_442634.1_4 Forward -352 -338 -3.34366 0.161
NP_441265.1_3 Forward -18 -4 -0.393733 0.277
NP_440403.1_4 Forward -359 -340 -7.67036 0.248
NP_441014.1_8 Forward -25 -6 -5.11376 0.263
NP_441014.1_8 Forward -363 -344 -9.14533 0.291
NP_441014.1_10 Reverse -340 -359 1.96529 0.221
NP_441014.1_10 Forward -351 -332 -2.26292 0.274
NP_442848.1_1 Reverse -335 -349 14.5526 0.0196
NP_443018.1_3 Forward -349 -342 14.8871 0.0123
NP_443018.1_3 Reverse -342 -349 14.8871 0.0123
NP_441634.1_8 Forward -352 -338 5.30946 0.114
NP_441634.1_8 Reverse -339 -353 -2.95034 0.295
NP_440376.1_1 Forward -350 -341 19.4693 0.000692
NP_440376.1_1 Reverse -341 -350 19.4693 0.000692
NP_440376.1_1 Reverse -169 -178 2.06468 0.236
NP_441588.1_4 Forward -348 -338 8.63316 0.14
NP_442687.1_7 Forward -351 -341 15.8113 0.0125
NP_442687.1_7 Reverse -340 -350 8.92815 0.0994
NP_441077.1_6 Forward -222 -206 2.80187 0.276
NP_441846.1_10 Reverse -6 -25 -11.8003 0.19
NP_441846.1_10 Reverse -8 -27 -22.2233 0.257
NP_440642.1_10 Reverse -316 -330 2.5556 0.277
NP_440642.1_10 Forward -28 -14 2.45727 0.277
NP_441422.1_7 Forward -352 -335 9.77361 0.0787
NP_440533.1_9 Reverse -351 -370 13.5691 0.0859
NP_440533.1_9 Forward -350 -331 3.04771 0.257
NP_442658.1_1 Forward -352 -342 17.0891 0.00615
NP_442658.1_1 Reverse -339 -349 9.616 0.147
NP_442782.1_2 Forward -194 -180 6.58777 0.222
NP_441414.1_9 Reverse -341 -360 0.294447 0.0833
NP_441414.1_9 Forward -350 -331 -3.44213 0.136
NP_441487.1_6 Reverse -347 -366 -0.688862 0.279
NP_441256.1_1 Forward -347 -328 -9.24366 0.278
NP_439959.1_3 Reverse -329 -348 12.1925 0.229
NP_442937.1_5 Reverse -336 -355 15.7324 0.0546
NP_442937.1_5 Forward -355 -336 11.1109 0.145
NP_441958.1_5 Forward -351 -341 12.2714 0.00183
NP_441958.1_5 Reverse -340 -350 12.2714 0.00183
NP_441127.1_1 Reverse -335 -349 9.14437 0.278
NP_441127.1_1 Forward -320 -306 8.55439 0.29
NP_440203.1_5 Reverse -286 -296 10.4026 0.225
NP_439905.1_1 Reverse -342 -355 8.37742 0.234
NP_440984.1_7 Forward -21 -7 6.09611 0.227
NP_439990.1_5 Forward -355 -342 13.589 0.0935
NP_439990.1_5 Reverse -336 -349 11.819 0.126
NP_442376.1_2 Reverse -336 -355 -11.8986 0.286
NP_442911.1_2 Reverse -331 -350 15.1424 0.011
NP_442911.1_2 Forward -360 -341 -3.24547 0.11
NP_440153.1_5 Reverse -342 -356 3.14618 0.219
NP_441591.1_10 Reverse -5 -24 5.01433 0.297
NP_443055.1_6 Reverse -333 -351 8.08151 0.15
NP_443055.1_6 Forward -33 -15 3.06666 0.2
NP_440993.1_3 Reverse -331 -350 -2.36125 0.299
NP_442210.1_1 Forward -51 -32 5.11266 0.212
NP_441099.1_5 Reverse -331 -350 14.7491 0.0163
NP_441099.1_5 Forward -360 -341 -11.0136 0.27
NP_442002.1_9 Forward -351 -344 10.7572 0.185
NP_441294.1_7 Forward -182 -168 10.2105 0.205
NP_441294.1_7 Forward -354 -340 9.4426 0.244
NP_441646.1_1 Forward -357 -338 13.2741 0.0882
NP_441646.1_1 Forward -185 -166 7.37428 0.16
NP_442438.1_10 Reverse -336 -350 16.7159 0.0212
NP_442231.1_5 Reverse -336 -355 14.3558 0.267
NP_441000.1_6 Reverse -340 -354 -2.45868 0.216
NP_441000.1_6 Forward -351 -337 -4.91696 0.254
NP_440147.1_4 Forward -352 -339 19.3905 0.00277
NP_440147.1_4 Reverse -339 -352 8.47575 0.0504
NP_440147.1_4 Forward -362 -349 -0.177378 0.276
NP_441175.1_7 Forward -350 -331 5.89931 0.267
NP_441550.1_8 Reverse -339 -349 16.7941 0.00906
NP_441550.1_8 Forward -352 -342 8.82935 0.112
NP_441916.1_7 Reverse -341 -351 18.4663 0.00144
NP_441916.1_7 Forward -350 -340 10.3048 0.0261
NP_441916.1_10 Reverse -256 -275 2.0644 0.253
NP_441916.1_10 Reverse -333 -352 1.17943 0.27
NP_440206.1_4 Reverse -331 -350 5.30853 0.244
NP_441041.1_1 Reverse -17 -36 5.99764 0.282
NP_441041.1_4 Forward -350 -331 8.94757 0.0331
NP_441041.1_4 Forward -272 -253 -2.95047 0.118
NP_441041.1_7 Reverse -338 -350 12.4708 0.0611
NP_441041.1_7 Forward -353 -341 8.48655 0.135
NP_442004.1_6 Forward -350 -336 9.14437 0.14
NP_442004.1_6 Forward -91 -77 3.44117 0.24
NP_441725.1_4 Forward -250 -236 6.78381 0.262
NP_441725.1_4 Forward -355 -341 3.14559 0.279
NP_441725.1_4 Forward -365 -351 1.96562 0.3
NP_441725.1_5 Forward -349 -339 9.02648 0.0553
NP_441725.1_5 Reverse -342 -352 2.04498 0.115
NP_439966.1_7 Forward -352 -342 17.9741 0.00631
NP_439966.1_7 Reverse -339 -349 14.8275 0.0177
NP_439966.1_7 Forward -18 -8 4.50281 0.269
NP_439966.1_7 Reverse -309 -319 4.20782 0.285
NP_439966.1_9 Forward -352 -343 0.884706 0.253
NP_439966.1_9 Reverse -339 -348 0.884706 0.253
NP_442941.1_3 Forward -349 -339 10.9931 0.0116
NP_442941.1_3 Reverse -342 -352 10.7964 0.0116
NP_440289.1_2 Forward -353 -340 11.1307 0.0212
NP_440289.1_2 Reverse -338 -351 4.93583 0.0636
NP_440260.1_8 Forward -70 -52 -5.38906 0.273
NP_442281.1_1 Reverse -336 -350 13.5686 0.0256
NP_442281.1_1 Forward -355 -341 2.5556 0.263
NP_442847.1_3 Forward -24 -5 11.405 0.217
NP_001035871.2_7 Reverse -133 -143 15.9097 0.14
NP_440437.1_1 Forward -356 -337 2.65439 0.13
NP_442012.1_1 Reverse -335 -354 -1.37718 0.286
NP_439983.1_1 Reverse -307 -325 13.0964 0.222
NP_443030.1_4 Reverse -251 -270 -7.27704 0.294
NP_441644.1_4 Forward -259 -240 17.8957 0.279
NP_441644.1_6 Forward -350 -340 17.3841 0.00127
NP_441644.1_6 Reverse -341 -351 10.1076 0.0628
NP_442215.1_2 Forward -352 -336 -1.71142 0.187
NP_442215.1_2 Forward -275 -259 -6.03799 0.263
NP_442029.1_1 Reverse -339 -358 -1.86883 0.163
NP_442029.1_6 Reverse -336 -355 3.44104 0.282
NP_442029.1_10 Forward -83 -64 5.11266 0.287
NP_440253.1_2 Reverse -341 -359 11.9172 0.0302
NP_440253.1_2 Forward -350 -332 4.9357 0.1
NP_440929.1_8 Forward -350 -341 19.2726 0.000701
NP_440929.1_8 Reverse -341 -350 19.2726 0.000701
NP_441346.1_7 Forward -37 -18 12.3892 0.203
NP_442933.1_10 Forward -350 -341 17.601 0.00325
NP_442933.1_10 Reverse -341 -350 17.601 0.00325
NP_441751.2_8 Forward -349 -335 2.94952 0.0757
NP_440096.1_5 Forward -271 -252 16.7157 0.109
NP_442554.1_8 Forward -349 -339 18.0729 0.00543
NP_442554.1_8 Reverse -342 -352 14.1397 0.0144
NP_441762.1_7 Forward -351 -339 11.8387 0.0142
NP_441762.1_7 Reverse -340 -352 2.98891 0.0676
NP_442142.1_4 Reverse -338 -351 14.7683 0.0302
NP_442142.1_4 Forward -353 -340 5.91857 0.178
NP_442292.1_1 Forward -349 -340 18.486 0.00229
NP_442292.1_1 Reverse -342 -351 9.63616 0.0183
NP_442292.1_5 Reverse -337 -356 -0.688862 0.257
NP_440919.1_7 Reverse -185 -203 4.77609 0.287
NP_440039.1_9 Forward -361 -342 16.6174 0.253
NP_442476.1_6 Reverse -342 -356 1.76955 0.205
NP_442381.1_8 Reverse -338 -357 -14.6519 0.284
NP_441711.1_4 Reverse -332 -351 14.1591 0.0551
NP_443009.1_5 Reverse -340 -351 18.3477 0.00265
NP_443009.1_5 Forward -118 -107 3.40144 0.296
NP_441715.1_4 Reverse -342 -352 18.8596 0.00741
NP_441715.1_4 Forward -349 -339 7.84651 0.107
NP_440464.1_10 Reverse -176 -186 12.9127 0.176
NP_441468.1_1 Forward -349 -342 15.8704 0.0124
NP_441468.1_1 Reverse -342 -349 15.8704 0.0124
NP_441020.2_6 Reverse -339 -356 7.217 0.237
NP_441015.1_8 Reverse -9 -28 3.83436 0.269
NP_441015.1_10 Reverse -336 -355 7.27595 0.0996
NP_441673.1_1 Forward -350 -341 20.8459 0.000698
NP_441673.1_1 Reverse -341 -350 20.8459 0.000698
NP_441426.1_4 Forward -321 -302 2.75272 0.29
NP_441826.1_2 Reverse -335 -349 6.3911 0.0937
NP_441826.1_2 Forward -350 -336 -0.295402 0.208
NP_442868.1_6 Reverse -339 -349 17.4829 0.012
NP_442868.1_6 Forward -352 -342 10.3048 0.038
NP_442868.1_6 Reverse -262 -272 3.22496 0.202
NP_441056.1_1 Forward -350 -331 -8.16202 0.282
NP_441612.1_2 Forward -350 -340 8.54929 0.21
NP_442361.1_3 Reverse -335 -348 9.65572 0.276
NP_442808.1_1 Forward -351 -341 18.4657 0.00201
NP_442808.1_1 Reverse -340 -350 8.63269 0.0481
NP_442808.1_1 Forward -179 -169 0.962914 0.299
NP_440145.1_3 Reverse -331 -350 0.196116 0.137
NP_440145.1_3 Forward -360 -341 -1.47551 0.152
NP_442718.1_2 Reverse -380 -399 -5.80207 0.295
NP_442542.1_2 Forward -352 -339 8.37742 0.156
NP_442050.1_1 Reverse -66 -85 10.5209 0.243
NP_442050.1_5 Reverse -339 -349 15.6142 0.01
NP_442050.1_5 Forward -352 -342 6.96107 0.27
NP_442342.1_9 Forward -352 -336 8.12167 0.194
NP_440334.1_2 Reverse -47 -60 13.7856 0.293
NP_440346.1_1 Forward -153 -134 13.7658 0.258
NP_440558.1_2 Reverse -248 -267 2.94938 0.164
NP_440558.1_2 Reverse -254 -273 -2.95047 0.232
NP_440558.1_2 Forward -276 -257 -5.40875 0.258
NP_440558.1_2 Forward -264 -245 -5.40875 0.258
NP_440558.1_2 Forward -270 -251 -7.57203 0.296
NP_441518.1_3 Reverse -331 -350 3.44104 0.0556
NP_441878.1_6 Forward -351 -341 10.4031 0.0176
NP_441878.1_6 Reverse -340 -350 10.4031 0.0176
NP_441036.1_8 Forward -351 -341 17.7779 0.000554
NP_441036.1_8 Reverse -340 -350 8.33817 0.174
NP_442650.1_2 Forward -350 -336 7.07942 0.13
NP_442650.1_2 Reverse -264 -278 4.12949 0.19
NP_441557.1_2 Forward -183 -165 15.9488 0.263
NP_441557.1_3 Forward -320 -306 23.1074 0.0649
NP_441557.1_4 Forward -316 -302 11.6026 0.291
NP_441557.1_5 Forward -350 -341 19.9609 0.000699
NP_441557.1_5 Reverse -341 -350 19.9609 0.000699
NP_441557.1_8 Forward -23 -13 16.3025 0.18
NP_441557.1_8 Forward -177 -167 10.206 0.292
NP_441557.1_9 Forward -336 -322 20.0591 0.222
NP_441557.1_10 Forward -160 -141 21.2381 0.0394
NP_441520.1_8 Reverse -248 -267 10.7175 0.238
NP_441445.1_1 Forward -329 -310 2.94938 0.224
NP_441445.1_1 Reverse -332 -351 0.294447 0.278
NP_442066.2_9 Forward -354 -341 10.8357 0.154
NP_442066.2_9 Reverse -337 -350 8.08242 0.193
NP_442777.1_1 Forward -24 -5 6.98015 0.253
NP_441739.1_2 Forward -33 -17 2.22115 0.288
NP_440101.1_3 Forward -195 -176 1.37609 0.276
NP_441458.1_10 Forward -359 -340 13.2741 0.0856
NP_442830.1_5 Forward -26 -12 -1.47595 0.299
NP_442183.1_1 Forward -350 -336 15.5359 0.0202
NP_442183.1_9 Forward -72 -62 9.41981 0.296
NP_441116.1_9 Reverse -23 -37 19.7641 0.111
NP_441549.1_9 Reverse -294 -312 -4.40575 0.198
NP_441467.1_10 Forward -75 -61 5.60446 0.281
NP_442347.1_2 Forward -349 -340 12.4878 0.056
NP_442347.1_2 Reverse -342 -351 11.1111 0.056
NP_442645.1_2 Reverse -333 -352 -10.9153 0.144
NP_442888.1_9 Forward -350 -331 15.1424 0.198
NP_441037.1_4 Reverse -339 -349 9.55921 0.21
NP_441037.1_4 Forward -352 -342 6.92787 0.237
NP_442594.1_8 Forward -125 -106 4.32602 0.266
NP_441633.1_3 Forward -352 -339 15.4572 0.0103
NP_441633.1_3 Reverse -339 -352 1.39592 0.109
NP_441633.1_3 Reverse -299 -312 -6.66722 0.265
NP_440136.1_2 Forward -349 -342 15.9687 0.0123
NP_440136.1_2 Reverse -342 -349 15.9687 0.0123
NP_442998.1_5 Forward -159 -149 7.94484 0.278
NP_442998.1_5 Reverse -21 -31 7.05986 0.3
NP_442998.1_10 Forward -348 -341 15.5754 0.0102
NP_442998.1_10 Reverse -343 -350 15.5754 0.0102
NP_440299.1_1 Forward -354 -341 18.5049 0.00393
NP_440299.1_1 Reverse -337 -350 13.5883 0.0298
NP_441799.1_1 Reverse -337 -351 6.29216 0.176
NP_441799.1_1 Forward -354 -340 3.44058 0.298
NP_441007.1_10 Reverse -336 -349 12.409 0.0499
NP_442201.1_10 Forward -361 -342 1.0811 0.114
NP_440256.1_1 Reverse -338 -357 9.14423 0.0211
NP_440456.1_7 Reverse -245 -259 10.816 0.285
NP_441559.1_8 Forward -355 -341 12.8809 0.0574
NP_441559.1_8 Forward -261 -247 -6.88358 0.281
NP_441395.1_8 Forward -171 -152 5.50599 0.262
NP_440915.1_6 Reverse -337 -351 14.0609 0.0187
NP_440915.1_6 Forward -354 -340 12.1926 0.0218
NP_441464.1_8 Reverse -301 -315 7.76774 0.206
NP_440695.1_6 Forward -33 -19 10.7992 0.265
NP_441939.1_3 Forward -349 -330 25.1722 0.00065
NP_442993.1_1 Reverse -142 -158 -9.87289 0.197
NP_442386.1_9 Forward -351 -342 15.7322 0.0144
NP_442386.1_9 Reverse -340 -349 13.8639 0.0289
NP_440570.1_5 Reverse -331 -350 -3.63879 0.291
NP_441340.1_5 Forward -349 -342 15.6737 0.0124
NP_441340.1_5 Reverse -342 -349 15.6737 0.0124
NP_441340.1_9 Forward -160 -150 8.25522 0.256
NP_440168.1_4 Reverse -331 -350 -3.93378 0.255
NP_442240.1_2 Reverse -342 -361 -1.96717 0.0609
NP_440161.1_3 Forward -346 -327 8.55425 0.269
NP_440586.1_8 Forward -349 -342 13.2151 0.026
NP_440586.1_8 Reverse -342 -349 13.2151 0.026
NP_442251.1_6 Forward -349 -342 15.2804 0.0124
NP_442251.1_6 Reverse -342 -349 15.2804 0.0124
NP_441262.1_3 Reverse -341 -348 14.7888 0.0223
NP_441262.1_3 Forward -350 -343 14.7888 0.0223
NP_443051.1_1 Reverse -340 -349 10.4228 0.00754
NP_443051.1_1 Forward -351 -342 10.4228 0.00754
NP_439937.1_9 Reverse -340 -357 -8.61494 0.176
NP_441595.1_5 Reverse -334 -352 4.44404 0.292
NP_440439.1_1 Forward -353 -340 2.96921 0.122
NP_440439.1_1 Reverse -338 -351 1.39592 0.156
NP_440439.1_1 Forward -19 -6 -0.570702 0.226
NP_442239.1_8 Reverse -289 -308 8.35759 0.249
NP_439943.1_7 Forward -266 -247 3.83436 0.286
NP_440372.1_2 Forward -349 -342 16.3621 0.0124
NP_440372.1_2 Reverse -342 -349 16.3621 0.0124
NP_440271.1_2 Reverse -326 -345 1.57275 0.284
NP_439977.1_5 Forward -356 -337 17.994 0.0361
NP_439977.1_5 Reverse -335 -354 6.39097 0.133
NP_440267.1_2 Forward -156 -142 14.4536 0.105
NP_440267.1_2 Forward -382 -368 5.40719 0.268
NP_442384.1_10 Reverse -341 -354 19.4888 0.00338
NP_442384.1_10 Forward -350 -337 3.95252 0.172
NP_442114.1_4 Reverse -341 -352 9.20345 0.17
NP_440699.1_3 Forward -295 -278 13.2152 0.216
NP_441877.1_7 Forward -355 -336 16.4199 0.0595
NP_441018.1_7 Reverse -165 -184 8.55425 0.242
NP_441018.1_7 Forward -73 -54 6.29264 0.294
NP_442790.1_4 Forward -359 -340 -7.86702 0.158
NP_442262.1_10 Forward -349 -342 14.1988 0.0123
NP_442262.1_10 Reverse -342 -349 14.1988 0.0123
NP_441689.1_5 Reverse -339 -349 5.87944 0.197
NP_440344.1_10 Reverse -334 -351 7.90532 0.0119
NP_440344.1_10 Forward -357 -340 3.67709 0.0263
NP_441965.1_3 Reverse -331 -350 -0.000545616 0.244
NP_442556.1_10 Forward -72 -53 11.3136 0.231
NP_440297.1_9 Reverse -342 -352 -0.118297 0.282
NP_440297.1_9 Forward -349 -339 -0.216628 0.282
NP_442280.1_10 Forward -90 -72 5.55182 0.283
NP_441896.1_3 Forward -359 -340 1.27776 0.218
NP_441896.1_3 Reverse -332 -351 -1.47551 0.26
NP_440894.1_10 Forward -355 -336 20.944 0.0278
NP_440894.1_10 Reverse -306 -325 7.96426 0.188
NP_442078.1_3 Forward -167 -148 6.88182 0.186
NP_440999.1_9 Forward -354 -340 12.0943 0.0414
NP_440999.1_9 Reverse -337 -351 4.81781 0.115
NP_440999.1_9 Reverse -297 -311 -3.24533 0.289
NP_440888.1_2 Forward -350 -336 20.0584 0.000881
NP_440888.1_2 Reverse -341 -355 17.8952 0.00302
NP_440888.1_2 Forward -370 -356 5.70218 0.267
NP_440600.1_4 Forward -358 -340 2.77242 0.121
NP_440491.1_1 Forward -313 -294 7.4043 0.268
NP_442948.1_2 Reverse -235 -254 4.03102 0.274
NP_442033.1_10 Reverse -339 -358 -3.44213 0.171
NP_442033.1_10 Forward -362 -343 -5.40875 0.179
NP_440575.1_8 Forward -155 -136 -7.08038 0.298
NP_440105.1_7 Reverse -381 -400 12.1925 0.241
NP_441543.1_2 Reverse -342 -351 18.486 0.00236
NP_441543.1_2 Forward -349 -340 16.9127 0.00359
NP_442845.1_2 Reverse -335 -349 6.78443 0.202
NP_441834.1_7 Reverse -329 -348 14.5524 0.263
NP_441178.1_6 Forward -28 -9 7.57013 0.26
NP_441469.1_8 Forward -351 -342 16.126 0.00797
NP_441469.1_8 Reverse -340 -349 6.48957 0.227
NP_443064.1_6 Forward -350 -340 12.5669 0.0796
NP_443064.1_6 Reverse -236 -246 8.88251 0.262
NP_442578.1_7 Forward -349 -342 14.5921 0.026
NP_442578.1_7 Reverse -342 -349 14.5921 0.026
NP_440710.1_1 Forward -358 -340 -9.32229 0.297
NP_441462.1_2 Forward -350 -340 11.5831 0.00406
NP_441462.1_2 Reverse -341 -351 11.5831 0.00406
NP_441621.1_7 Reverse -339 -353 -3.24533 0.188
NP_441621.1_7 Forward -352 -338 -3.34366 0.188
NP_443062.1_1 Forward -350 -332 10.3986 0.117
NP_443062.1_1 Reverse -341 -359 6.01073 0.211
NP_443062.1_6 Reverse -333 -352 2.26107 0.258
NP_441601.1_4 Forward -24 -5 -5.11376 0.293
NP_442204.1_1 Forward -354 -343 2.12362 0.266
NP_442204.1_6 Reverse -342 -361 11.9958 0.157
NP_440516.1_8 Forward -350 -341 16.9127 0.00442
NP_440516.1_8 Reverse -341 -350 16.9127 0.00442
NP_440516.1_8 Forward -320 -311 -0.590259 0.283
NP_441785.1_1 Forward -350 -336 14.8714 0.151
NP_442428.1_4 Forward -351 -332 20.1573 0.0564
NP_442428.1_5 Forward -349 -342 15.8704 0.0124
NP_442428.1_5 Reverse -342 -349 15.8704 0.0124
NP_441443.1_1 Reverse -14 -33 0.0977854 0.225
NP_441790.1_3 Forward -349 -330 -5.01543 0.291
NP_442859.1_2 Reverse -342 -361 3.44104 0.253
NP_442120.1_10 Forward -350 -331 -8.55534 0.237
NP_441867.1_2 Reverse -14 -33 -16.5201 0.291
NP_440673.1_3 Forward -348 -341 12.4288 0.0426
NP_440673.1_3 Reverse -343 -350 12.4288 0.0426
NP_441714.1_3 Reverse -334 -352 12.5064 0.294
NP_440865.1_9 Reverse -335 -354 -6.78538 0.232
NP_441052.1_2 Forward -350 -340 19.9412 0.00106
NP_441052.1_2 Reverse -341 -351 10.5014 0.0285
NP_442219.1_9 Forward -349 -340 17.7976 0.00718
NP_442219.1_9 Reverse -342 -351 8.35786 0.0681
NP_440436.1_4 Reverse -342 -351 18.1905 0.00233
NP_440436.1_4 Forward -349 -340 17.2072 0.00233
NP_440436.1_4 Forward -54 -45 6.48915 0.157
NP_441884.1_9 Forward -353 -334 -13.0786 0.138
NP_442907.1_2 Forward -349 -331 10.3439 0.218
NP_442907.1_9 Forward -266 -247 -0.39387 0.222
NP_441719.1_4 Forward -349 -342 16.3621 0.0124
NP_441719.1_4 Reverse -342 -349 16.3621 0.0124
NP_441719.1_6 Reverse -307 -326 12.585 0.269
NP_441733.1_10 Reverse -338 -351 19.6855 0.0151
NP_441004.1_1 Reverse -335 -354 -12.5869 0.247
NP_441004.1_1 Reverse -17 -36 -17.4051 0.291
NP_441004.1_1 Reverse -277 -296 -17.7985 0.294
NP_442813.1_1 Forward -193 -174 10.7175 0.16
NP_442366.1_3 Reverse -107 -125 5.32902 0.0878
NP_442366.1_3 Forward -351 -333 4.05072 0.101
NP_442366.1_3 Forward -56 -38 -1.84914 0.219
NP_439949.1_7 Reverse -20 -34 10.7177 0.291
NP_441115.1_4 Reverse -340 -358 9.06482 0.227
NP_441115.1_4 Forward -351 -333 8.17984 0.257
NP_442206.1_10 Forward -266 -251 -0.413427 0.292
NP_443054.1_2 Forward -352 -338 10.6193 0.0761
NP_442430.1_10 Reverse -331 -350 19.3698 0.0452
NP_442308.1_4 Reverse -335 -354 -0.295539 0.288
NP_441851.1_3 Reverse -377 -396 8.45592 0.299
NP_441851.1_9 Forward -270 -251 9.83255 0.239
NP_441851.1_10 Forward -351 -341 16.008 0.00552
NP_441851.1_10 Reverse -340 -350 15.8113 0.00552
NP_442515.1_1 Reverse -340 -354 4.71948 0.107
NP_442515.1_1 Forward -311 -297 -3.73699 0.297
NP_442515.1_1 Forward -351 -337 -4.4253 0.298
NP_440593.1_3 Reverse -336 -355 4.81767 0.13
NP_440593.1_3 Reverse -259 -278 -6.09707 0.27
NP_441982.1_1 Reverse -236 -255 12.2908 0.157
NP_440463.1_6 Forward -353 -334 6.39097 0.295
NP_441349.1_10 Forward -360 -341 -8.35868 0.274
NP_441349.1_10 Reverse -295 -314 -9.53865 0.294
NP_440432.1_9 Forward -349 -334 -0.511758 0.164
NP_442843.1_1 Reverse -17 -36 -1.96717 0.202
NP_440195.1_5 Reverse -335 -354 0.491109 0.298
NP_442006.1_2 Reverse -9 -26 -17.3657 0.274
NP_442006.1_2 Reverse -15 -32 -19.234 0.299
NP_441570.1_1 Forward -350 -332 -1.55415 0.0578
NP_441078.1_4 Forward -350 -341 19.6659 0.0007
NP_441078.1_4 Reverse -341 -350 19.6659 0.0007
NP_442729.1_8 Forward -354 -341 9.06573 0.125
NP_442729.1_8 Reverse -337 -350 8.77074 0.125
NP_442729.1_8 Reverse -104 -117 6.01747 0.217
NP_440526.1_3 Forward -349 -338 20.0193 0.0113
NP_440526.1_3 Forward -177 -166 7.33466 0.153
NP_441432.1_8 Reverse -340 -349 16.8143 0.00595
NP_441432.1_8 Forward -351 -342 8.25953 0.0755
NP_441432.1_9 Reverse -209 -222 13.6401 0.165
NP_442320.1_8 Reverse -335 -349 15.4376 0.0102
NP_442320.1_8 Forward -356 -342 -1.67204 0.0821
NP_441732.1_2 Forward -354 -338 -5.74299 0.0483
NP_441732.1_2 Forward -395 -379 -17.7394 0.292
NP_440760.1_1 Forward -350 -331 5.50599 0.0121
NP_440760.1_1 Reverse -341 -360 -10.817 0.0847
NP_440760.1_1 Forward -117 -98 -15.1435 0.142
NP_442797.1_7 Forward -185 -167 -0.669169 0.284
NP_440131.1_5 Forward -365 -346 15.6341 0.221
NP_440199.1_10 Reverse -338 -348 7.35486 0.231
NP_441945.1_10 Reverse -231 -250 8.16093 0.277
NP_440913.1_1 Forward -352 -334 10.0489 0.175
NP_440713.1_4 Reverse -331 -350 3.14605 0.251
NP_442489.1_7 Forward -350 -341 20.1576 0.000695
NP_442489.1_7 Reverse -341 -350 20.1576 0.000695
NP_442079.1_7 Reverse -342 -361 8.16093 0.125
NP_440559.1_1 Forward -349 -340 17.4043 0.00658
NP_440559.1_1 Reverse -342 -351 8.75118 0.0586
NP_441659.2_8 Forward -350 -340 18.1713 0.00133
NP_441659.2_8 Reverse -341 -351 11.9764 0.0147
NP_442913.1_10 Reverse -332 -351 3.04771 0.115
NP_441040.1_5 Forward -355 -336 3.04771 0.275
NP_442849.1_1 Reverse -75 -89 10.226 0.207
NP_439956.1_7 Reverse -345 -364 3.73603 0.257
NP_440708.1_6 Reverse -313 -332 -10.4236 0.278
NP_442346.1_5 Reverse -340 -350 16.6963 0.00248
NP_442346.1_5 Forward -351 -341 9.02648 0.118
NP_440545.1_3 Reverse -337 -354 5.34871 0.0623
NP_440545.1_3 Reverse -294 -311 -1.14113 0.163
NP_440831.1_3 Reverse -172 -191 6.38714 0.275
NP_440555.1_4 Reverse -76 -95 8.06259 0.214
NP_440459.1_10 Forward -173 -154 15.5357 0.196
NP_441653.1_2 Reverse -330 -349 15.9954 0.0639
NP_440010.1_4 Reverse -331 -350 11.6017 0.157
NP_442603.1_7 Reverse -341 -355 10.6187 0.125
NP_441888.1_7 Forward -355 -341 12.8809 0.0743
NP_441948.1_4 Forward -357 -339 6.60732 0.0633
NP_441047.1_2 Reverse -336 -355 -2.16383 0.273
NP_441833.1_4 Forward -349 -342 15.9687 0.0124
NP_441833.1_4 Reverse -342 -349 15.9687 0.0124
NP_441329.1_6 Forward -225 -206 -0.907597 0.286
NP_441329.1_6 Forward -168 -149 -2.53096 0.294
NP_441895.1_10 Reverse -73 -92 -27.8282 0.299
NP_442162.1_9 Forward -349 -342 16.2637 0.0124
NP_442162.1_9 Reverse -342 -349 16.2637 0.0124
NP_440671.1_2 Forward -270 -256 14.4542 0.257
NP_440671.1_4 Forward -326 -312 10.7177 0.151
NP_442140.1_3 Reverse -342 -352 14.238 0.0486
NP_442140.1_3 Forward -349 -339 13.5497 0.0542
NP_441609.1_1 Reverse -149 -168 0.58944 0.21
NP_440875.1_9 Forward -348 -338 8.66404 0.233
NP_440875.1_9 Reverse -343 -353 8.46937 0.233
NP_441813.1_5 Forward -352 -342 19.4496 0.00647
NP_441813.1_5 Reverse -339 -349 8.73149 0.0367
NP_440590.1_4 Reverse -342 -355 22.1438 0.00377
NP_440590.1_4 Forward -349 -336 21.0621 0.00401
NP_440590.1_4 Forward -272 -259 7.09911 0.0554
NP_440590.1_4 Forward -359 -346 -5.29059 0.277
NP_440567.1_1 Forward -349 -335 17.1092 0.0153
NP_442497.1_10 Forward -349 -340 10.4228 0.0087
NP_442497.1_10 Reverse -342 -351 10.4228 0.0087
NP_440821.1_4 Reverse -339 -349 17.9746 0.00497
NP_440821.1_4 Forward -352 -342 10.2065 0.0163
NP_441239.1_9 Forward -352 -340 14.1986 0.0288
NP_441239.1_9 Reverse -339 -351 9.67541 0.0987
NP_441239.1_9 Reverse -309 -321 4.46387 0.253
NP_441239.1_9 Forward -18 -6 3.67722 0.279
NP_441239.1_9 Forward -22 -10 3.18557 0.292
NP_441951.1_4 Reverse -335 -354 4.03102 0.273
NP_440706.1_1 Reverse -337 -356 -4.81876 0.262
NP_441727.1_3 Forward -62 -43 3.04771 0.293
NP_441892.1_1 Reverse -332 -349 -3.99273 0.253
NP_440796.1_3 Forward -357 -339 8.47483 0.264
NP_442643.1_3 Reverse -61 -80 8.55425 0.0976
NP_442643.1_3 Reverse -345 -364 -8.16202 0.295
NP_441017.1_6 Reverse -254 -268 13.6669 0.179
NP_441017.1_6 Forward -354 -340 11.9953 0.232
NP_440863.1_1 Reverse -76 -90 14.8705 0.236
NP_441541.1_1 Forward -227 -209 -4.9636 0.291
NP_442216.1_4 Reverse -284 -292 8.1805 0.255
NP_440354.1_7 Reverse -335 -353 8.7706 0.232
NP_440354.1_10 Reverse -259 -273 18.2885 0.245
NP_442138.1_9 Forward -216 -197 9.83173 0.223
NP_440412.1_3 Reverse -67 -86 21.9273 0.0928
NP_440546.1_4 Reverse -341 -351 11.8882 0.0679
NP_440546.1_4 Forward -350 -340 10.046 0.109
NP_439974.1_4 Reverse -330 -349 11.4058 0.231
NP_440462.1_6 Forward -352 -342 17.2863 0.00752
NP_440462.1_6 Reverse -339 -349 10.3048 0.0396
NP_440462.1_6 Forward -18 -8 2.04498 0.294
NP_441184.1_10 Reverse -7 -26 21.0423 0.0947
NP_442611.1_1 Reverse -336 -355 -0.295539 0.266
NP_440868.1_4 Forward -354 -342 3.48056 0.135
NP_440868.1_4 Reverse -337 -349 0.432302 0.212
NP_442402.1_10 Reverse -304 -314 11.9759 0.23
NP_441848.1_4 Forward -164 -148 8.79206 0.288
NP_441848.1_4 Forward -165 -149 8.21911 0.288
NP_440696.1_3 Reverse -341 -359 -0.0791831 0.238
NP_442039.1_4 Forward -349 -342 15.1821 0.0124
NP_442039.1_4 Reverse -342 -349 15.1821 0.0124
NP_442039.1_4 Forward -319 -312 7.02061 0.269
NP_442039.1_7 Reverse -48 -58 14.533 0.211
NP_442039.1_7 Reverse -73 -83 8.63316 0.263
NP_441811.1_8 Reverse -335 -349 6.88276 0.259
NP_442837.1_3 Forward -349 -342 15.7721 0.0124
NP_442837.1_3 Reverse -342 -349 15.7721 0.0124
NP_442053.1_1 Forward -350 -341 18.3876 0.0007
NP_442053.1_1 Reverse -341 -350 18.3876 0.0007
NP_440505.1_3 Reverse -339 -349 16.598 0.00683
NP_440505.1_3 Forward -352 -342 15.9097 0.00857
NP_440505.1_3 Reverse -262 -272 12.0747 0.0596
NP_440505.1_7 Reverse -276 -295 -2.16383 0.289
NP_442255.1_5 Reverse -51 -70 8.65258 0.28
NP_440914.1_1 Forward -350 -340 17.5935 0.000537
NP_440914.1_1 Reverse -341 -351 8.6151 0.186
NP_441011.1_8 Reverse -342 -351 16.9127 0.00602
NP_441011.1_8 Forward -349 -340 8.25953 0.144
NP_442533.1_6 Forward -350 -341 17.2076 0.00137
NP_442533.1_6 Reverse -341 -350 17.2076 0.00137
NP_442322.1_4 Forward -207 -190 -7.82829 0.286
NP_441482.1_7 Forward -356 -342 6.98109 0.0257
NP_441482.1_7 Forward -397 -383 -5.50694 0.184
NP_441482.1_7 Reverse -335 -349 -8.35854 0.193
NP_439944.1_9 Forward -349 -339 19.1546 0.00329
NP_441028.1_6 Forward -28 -18 3.71617 0.281
NP_440115.1_6 Reverse -338 -348 9.81313 0.115
NP_440007.1_9 Reverse -254 -268 0.392915 0.298
NP_441602.1_3 Forward -355 -336 6.68596 0.128
NP_441602.1_3 Reverse -336 -355 -0.000545616 0.219
NP_441972.1_5 Forward -349 -330 6.58763 0.0825
NP_441106.1_1 Forward -351 -342 18.191 0.0028
NP_441106.1_1 Reverse -340 -349 9.63616 0.0311
NP_441106.1_1 Forward -308 -299 2.55633 0.28
NP_440429.1_2 Forward -355 -336 13.5691 0.177
NP_441216.1_6 Forward -342 -323 13.9625 0.262
NP_442306.1_10 Forward -355 -336 -18.5851 0.197
NP_441286.1_1 Forward -351 -339 12.1337 0.0104
NP_441286.1_1 Reverse -340 -352 6.03717 0.0258
NP_440670.1_8 Forward -350 -341 18.3876 0.000699
NP_440670.1_8 Reverse -341 -350 18.3876 0.000699
NP_441705.1_3 Forward -326 -307 10.6192 0.167
NP_440886.1_7 Forward -351 -341 17.7774 0.0011
NP_440886.1_7 Reverse -310 -320 12.0743 0.0805
NP_440886.1_7 Reverse -340 -350 7.94438 0.0805
NP_442614.1_2 Reverse -362 -376 5.70279 0.298
NP_442072.1_9 Forward -351 -333 -2.63579 0.0317
NP_440223.1_6 Reverse -287 -304 4.16874 0.253
NP_442963.1_9 Forward -110 -92 18.8004 0.3
NP_440907.2_8 Forward -349 -339 10.8943 0.0969
NP_440907.2_8 Reverse -342 -352 7.94438 0.117
NP_441021.1_1 Forward -349 -330 8.45592 0.0486
NP_441463.1_3 Reverse -331 -350 -1.86883 0.147
NP_441463.1_3 Forward -277 -258 -7.27704 0.256
NP_442056.1_3 Reverse -122 -141 13.4708 0.241
NP_441626.1_2 Forward -349 -342 15.7721 0.0124
NP_441626.1_2 Reverse -342 -349 15.7721 0.0124
NP_442211.1_3 Forward -332 -313 6.88843 0.295
NP_442794.1_1 Forward -354 -342 7.61046 0.136
NP_442794.1_1 Reverse -337 -349 3.48056 0.286
NP_442794.1_1 Reverse -42 -54 2.49725 0.288
NP_442615.1_1 Reverse -332 -350 -1.55415 0.13
NP_442615.1_1 Forward -359 -341 -4.11075 0.177
NP_441962.1_4 Reverse -336 -355 11.0125 0.0495
NP_441962.1_4 Forward -355 -336 -13.6686 0.277
NP_441962.1_5 Forward -30 -11 4.81767 0.291
NP_440387.1_1 Forward -350 -334 14.4149 0.00649
NP_440387.1_1 Reverse -341 -357 -1.61309 0.143
NP_440387.1_1 Reverse -298 -314 -5.84132 0.254
NP_441431.1_2 Forward -353 -339 7.47213 0.241
NP_441488.1_7 Reverse -335 -354 0.294447 0.298
NP_441836.1_2 Forward -356 -337 -0.4922 0.212
NP_441836.1_2 Forward -184 -165 -3.83545 0.244
NP_441836.1_2 Reverse -335 -354 -5.60541 0.284
NP_441993.1_1 Reverse -335 -354 13.8365 0.0786
NP_441993.1_1 Forward -350 -331 7.79413 0.16
NP_440358.1_8 Reverse -143 -162 1.47442 0.246
NP_442323.1_7 Forward -302 -283 3.24359 0.245
NP_440754.1_5 Reverse -338 -357 12.8808 0.232
NP_441510.2_6 Forward -360 -341 17.9932 0.0974
NP_440287.1_5 Forward -30 -11 6.29183 0.292
NP_440766.1_4 Reverse -337 -351 17.6992 0.0255
NP_440766.1_4 Forward -324 -310 1.08123 0.255
NP_441237.1_9 Forward -349 -339 14.9263 0.0242
NP_439910.1_2 Reverse -333 -350 -21.594 0.183
NP_440457.1_1 Forward -354 -342 6.33216 0.123
NP_440457.1_1 Reverse -337 -349 5.34885 0.141
NP_441984.1_3 Forward -354 -336 10.5406 0.186
NP_441984.1_3 Forward -150 -132 7.88563 0.239
NP_442130.1_8 Forward -267 -248 11.0117 0.125
NP_441436.1_8 Reverse -340 -359 14.9458 0.215
NP_442509.1_9 Reverse -341 -351 16.2041 0.00739
NP_442509.1_9 Forward -350 -340 8.14104 0.192
NP_440554.1_4 Reverse -342 -352 16.4996 0.0189
NP_440554.1_4 Forward -349 -339 6.37155 0.123
NP_442862.1_3 Reverse -149 -166 8.98696 0.236
NP_441885.1_5 Forward -350 -340 20.9245 0.000538
NP_441885.1_5 Reverse -341 -351 11.4848 0.00668
NP_440478.1_2 Reverse -47 -66 2.75272 0.2
NP_442703.1_6 Reverse -220 -239 16.1855 0.233
NP_442341.1_7 Forward -351 -337 20.3541 0.00702
NP_442341.1_7 Reverse -340 -354 12.1926 0.0467
NP_442341.1_9 Forward -352 -338 9.24208 0.155
NP_441756.1_5 Forward -354 -335 -0.000545616 0.242
NP_441173.1_9 Forward -83 -75 14.3753 0.161
NP_440423.1_6 Forward -328 -309 -3.73712 0.126
NP_443000.1_7 Forward -352 -342 11.5831 0.0344
NP_443000.1_7 Reverse -339 -349 10.4031 0.0345
NP_440507.2_3 Reverse -332 -351 12.585 0.15
NP_442513.1_5 Reverse -333 -352 9.53674 0.266
NP_441842.1_10 Reverse -334 -348 10.3243 0.165
NP_440275.1_3 Reverse -339 -349 17.6796 0.0102
NP_440275.1_3 Forward -352 -342 15.418 0.0178
NP_440275.1_3 Forward -309 -299 4.99491 0.167
NP_442932.1_9 Reverse -18 -37 7.7676 0.241
NP_440091.1_1 Reverse -337 -349 10.7571 0.0429
NP_440149.1_8 Reverse -335 -354 -4.42544 0.207
NP_441105.1_3 Reverse -330 -349 7.47261 0.0542
NP_441105.1_3 Forward -361 -342 5.30933 0.069
NP_441105.1_3 Forward -272 -253 -7.08038 0.245
NP_441105.1_3 Forward -31 -12 -8.16202 0.267
NP_440216.1_1 Reverse -341 -355 7.37441 0.00942
NP_440216.1_1 Forward -350 -336 -9.73518 0.145
NP_440172.1_1 Forward -350 -340 15.0247 0.00945
NP_440172.1_1 Reverse -341 -351 8.73149 0.0586
NP_442371.1_1 Reverse -19 -29 13.4509 0.206
NP_442015.1_10 Forward -354 -341 12.8023 0.0365
NP_442015.1_10 Reverse -337 -350 3.65753 0.178
NP_442015.1_10 Forward -277 -264 1.10092 0.213
NP_441226.1_7 Forward -349 -342 14.4934 0.0123
NP_441226.1_7 Reverse -342 -349 14.4934 0.0123
NP_441485.1_9 Reverse -189 -208 15.2408 0.283
NP_441111.1_7 Forward -349 -341 18.7023 0.00294
NP_441111.1_7 Reverse -342 -350 18.7023 0.00294
NP_442379.1_10 Reverse -334 -351 6.43035 0.115
NP_441766.1_2 Forward -350 -341 17.5026 0.00297
NP_441766.1_2 Reverse -341 -350 17.5026 0.00297
NP_441766.1_2 Reverse -181 -190 1.86802 0.271
NP_441766.1_2 Reverse -311 -320 1.1797 0.299
NP_442417.1_5 Reverse -341 -355 10.6193 0.11
NP_440416.1_9 Reverse -334 -353 -5.21209 0.0791
NP_440416.1_9 Forward -27 -8 -7.86702 0.108
NP_443052.1_8 Reverse -331 -350 -7.57203 0.161
NP_441135.1_4 Forward -357 -338 2.16274 0.284
NP_442403.1_2 Reverse -169 -188 18.6823 0.0666
NP_440591.1_9 Reverse -334 -352 8.37728 0.18
NP_440261.1_5 Reverse -342 -355 -4.40561 0.147
NP_440261.1_5 Forward -349 -336 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTAACCAAGCCGACCTTAACCAATTACTTACCGTGCCCCATCTATCTCCGGCGATCGCCACTGCGTTGTTGCAAGAAAGGGAGATTGGGGGAGACTACCGCAACCTAGGGGATTTACAAAAGCGTTTAGGATTGCCAGTGGCATTGATTACCCAACTGATCCACTATCTACAATTCTAAAAAGTGCTAAAACCACTCTCAAGCCGGCCGAGAGTTCGGGCTGACCAACCCCACTAAAGCTAGGAAAAAATCCATTACCTAGCCCTTGGACTATATTGGACTAGGGAATCGATCCAAGTTAGTTAATCCATCCATCCTTTTCCCAACTGTTGGCGGTTTTATGTCTGCCATTGTTATAGACTGTCCTGCAAATTTCCCCCTGCCCCGGCTCGCTTGATCC

CDS

ATGCCCAATCCTCGACGCATTGTCTTTGGTGATGTCCACGGCCATTTCGACGCCCTTACTGCTTTGTTCGAGGCGATCGCCCCCAATGAAAGAGATGGGGTTTACTTCGTCGGTGACCTGATCGACCGAGGTCCAGAAAGCGCCAAAGTGGTGGATTTTGTCATGGAGAACAAGTACCATTGCCTGTTGGGTAACCATGAACAAATGATGTTGGATGCGGTGGGGGGCTTTAACTTTTCTCCCCAACTACTACATGCTTGGATTTATAGCGGCGGCAAATCAACCCTAGAAAGTTATGAGCACCAGATTCCCCAAAGCCATGTGGACTGGATGCGCAACTTACCCCTCTATCTTGACCTGGGGGATGTTTGGTTAGTCCACGCTGGGGTAGATCCCCGCCTCCCTATCGAAGAGCAGGGAGAAGCCCAATTCTGTTGGATCCGGGATGAGTTCCATCGCTACCCCTATCCCTACTTTGCCAACAAGTTAATTATCACCGGCCACACCATAACGTTCACCTTTGCCAACGTGGAGCCGGGTAAGTTAGTGTCGGGCCCCGGTTGGTTGGATATTGACACTGGGGCCTATCATCCCAAAAGTGGCTGGCTCACTGCCCTAGAACTAAATAACCAAGAAGTGTATCAAGCCCATATCTTCACCAATGAAGTCCGCCGTTTGCCCCTGGAAGACGCAGTGGTTCCCCTGCCGCCCCAGAACTTGCATCGTTCCCGGCAGAAAGGGAAAAAAAGAGGTCTGCTGGGGTAG

Protein

MPNPRRIVFGDVHGHFDALTALFEAIAPNERDGVYFVGDLIDRGPESAKVVDFVMENKYHCLLGNHEQMMLDAVGGFNFSPQLLHAWIYSGGKSTLESYEHQIPQSHVDWMRNLPLYLDLGDVWLVHAGVDPRLPIEEQGEAQFCWIRDEFHRYPYPYFANKLIITGHTITFTFANVEPGKLVSGPGWLDIDTGAYHPKSGWLTALELNNQEVYQAHIFTNEVRRLPLEDAVVPLPPQNLHRSRQKGKKRGLLG