Your browser is old and dusty. Try Google Chrome!

Details for sll1386

ORF sll1386
Accession NP_441558.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -203 -189 3.8345 0.159
NP_441061.1_2 Reverse -190 -204 2.16287 0.178
NP_441061.1_2 Forward -307 -293 1.08123 0.195
NP_440795.1_7 Forward -203 -196 8.8889 0.188
NP_441418.1_6 Forward -204 -185 -20.4534 0.114
NP_441418.1_6 Reverse -287 -306 -29.1065 0.216
NP_441453.1_4 Reverse -195 -203 11.5241 0.043
NP_440561.1_4 Reverse -300 -319 16.5175 0.158
NP_440150.1_6 Forward -207 -188 1.0811 0.295
NP_442975.1_10 Forward -312 -298 6.78381 0.161
NP_441250.1_8 Forward -252 -243 19.4688 0.274
NP_440061.1_9 Forward -200 -186 7.47213 0.205
NP_441054.1_2 Forward -60 -41 14.8474 0.156
NP_441145.1_1 Forward -312 -293 3.6377 0.271
NP_441476.1_3 Forward -300 -281 9.53756 0.283
NP_442062.1_8 Reverse -195 -205 5.09324 0.184
NP_442062.1_8 Forward -123 -113 4.20827 0.228
NP_441802.1_1 Reverse -5 -24 6.09597 0.269
NP_440304.1_4 Forward -206 -196 7.74818 0.101
NP_441035.1_3 Forward -372 -353 0.884433 0.245
NP_439918.1_2 Forward -168 -149 1.17943 0.217
NP_442110.1_7 Reverse -108 -122 -0.0987402 0.274
NP_442726.1_4 Reverse -349 -368 4.03102 0.28
NP_441925.1_4 Reverse -47 -66 -15.1442 0.263
NP_441925.1_4 Reverse -49 -68 -17.1108 0.288
NP_441925.1_4 Reverse -44 -63 -17.4058 0.294
NP_441083.1_5 Forward -204 -194 0.766681 0.218
NP_441083.1_5 Reverse -195 -205 -0.216628 0.261
NP_441083.1_5 Forward -308 -298 -0.904945 0.283
NP_441738.1_2 Reverse -45 -52 8.29857 0.176
NP_441738.1_2 Forward -253 -246 8.29857 0.176
NP_441738.1_2 Forward -74 -67 6.52862 0.261
NP_441558.1_5 Forward -200 -181 13.1758 0.0619
NP_441645.1_6 Reverse -49 -63 11.7987 0.241
NP_441713.1_8 Reverse -191 -209 9.75391 0.268
NP_441770.1_5 Reverse -375 -394 -1.86883 0.277
NP_441716.1_1 Forward -198 -184 14.6509 0.0646
NP_441716.1_1 Reverse -195 -209 12.3893 0.0789
NP_441716.1_1 Forward -204 -190 8.84938 0.13
NP_442111.1_4 Reverse -194 -208 6.58777 0.12
NP_440747.1_10 Reverse -192 -204 -2.32097 0.0331
NP_440747.1_10 Forward -207 -195 -11.7607 0.142
NP_441130.1_2 Forward -316 -297 6.98095 0.237
NP_442973.1_5 Forward -213 -194 14.7491 0.13
NP_441486.1_1 Reverse -192 -206 0.196253 0.143
NP_441486.1_1 Forward -159 -145 -5.60527 0.248
NP_442634.1_4 Forward -206 -192 -5.11362 0.235
NP_440403.1_10 Reverse -299 -318 4.71934 0.254
NP_440403.1_10 Forward -371 -352 1.17943 0.291
NP_441014.1_8 Reverse -47 -66 -6.88371 0.276
NP_441012.1_4 Reverse -191 -204 7.98409 0.272
NP_441012.1_4 Reverse -197 -210 6.21414 0.284
NP_441012.1_4 Forward -202 -189 5.72248 0.291
NP_443018.1_3 Forward -122 -115 10.7572 0.0907
NP_443018.1_3 Reverse -196 -203 4.56234 0.241
NP_443018.1_3 Reverse -115 -122 4.56234 0.241
NP_443018.1_3 Forward -203 -196 4.46401 0.244
NP_441634.1_8 Reverse -291 -305 5.40779 0.114
NP_441634.1_8 Forward -200 -186 2.06454 0.173
NP_441634.1_8 Reverse -297 -311 1.96621 0.175
NP_440376.1_1 Reverse -195 -204 7.76787 0.0688
NP_440376.1_1 Forward -204 -195 6.39124 0.1
NP_440376.1_1 Reverse -299 -308 5.50626 0.131
NP_441857.1_6 Forward -163 -153 15.3197 0.215
NP_442687.1_7 Reverse -301 -311 4.3066 0.255
NP_442687.1_7 Reverse -194 -204 4.3066 0.255
NP_442485.1_3 Reverse -184 -203 8.94757 0.126
NP_442485.1_3 Forward -310 -291 1.96607 0.216
NP_442485.1_3 Reverse -297 -316 -0.787193 0.253
NP_441846.1_10 Reverse -287 -306 -23.1083 0.277
NP_440642.1_10 Forward -23 -9 16.6169 0.119
NP_441013.1_2 Reverse -184 -202 -3.02911 0.288
NP_440667.1_2 Forward -173 -154 -8.35868 0.289
NP_441950.1_8 Reverse -298 -312 6.48943 0.234
NP_440360.1_10 Forward -309 -295 5.70279 0.227
NP_442658.1_1 Reverse -112 -122 12.7626 0.0476
NP_442658.1_1 Forward -370 -360 7.64939 0.213
NP_442658.1_1 Forward -78 -68 4.89613 0.292
NP_440141.1_8 Reverse -171 -190 4.81767 0.28
NP_440141.1_8 Reverse -180 -199 4.52268 0.288
NP_442782.1_2 Forward -167 -153 6.6861 0.22
NP_440607.1_5 Forward -207 -188 -0.688862 0.279
NP_441487.1_6 Forward -212 -193 6.58763 0.216
NP_441256.1_1 Forward -344 -325 -6.78538 0.239
NP_442937.1_5 Forward -203 -184 8.35759 0.225
NP_442937.1_5 Reverse -339 -358 6.68596 0.272
NP_442321.1_4 Forward -356 -337 -6.1954 0.284
NP_441958.1_5 Forward -205 -195 0.963343 0.12
NP_441127.1_1 Reverse -293 -307 8.94771 0.284
NP_442836.1_5 Reverse -293 -312 6.98095 0.171
NP_442836.1_10 Forward -163 -153 16.7946 0.192
NP_439905.1_1 Reverse -360 -373 6.70579 0.279
NP_439905.1_2 Forward -15 -1 9.5377 0.233
NP_440153.1_8 Forward -311 -298 5.03416 0.18
NP_440153.1_8 Forward -198 -185 1.9859 0.22
NP_440153.1_8 Forward -308 -295 -3.4223 0.295
NP_440153.1_8 Reverse -46 -59 -3.71729 0.299
NP_442064.1_4 Forward -363 -344 5.01354 0.281
NP_443055.1_6 Forward -316 -298 -1.84987 0.284
NP_443044.1_1 Reverse -39 -58 4.12936 0.279
NP_440411.1_10 Forward -170 -151 9.09059 0.293
NP_441646.1_1 Forward -205 -186 -0.983855 0.276
NP_441646.1_1 Forward -211 -192 -1.08219 0.278
NP_440377.1_1 Forward -95 -78 10.5973 0.293
NP_440377.1_1 Reverse -359 -376 10.2107 0.298
NP_442771.1_1 Reverse -187 -205 -0.472507 0.108
NP_442771.1_1 Forward -206 -188 -0.865831 0.12
NP_440147.1_3 Reverse -180 -199 1.76941 0.296
NP_441295.1_4 Reverse -190 -209 -2.65548 0.29
NP_441916.1_7 Reverse -195 -205 4.0116 0.193
NP_441916.1_7 Forward -311 -301 3.91327 0.198
NP_440465.1_10 Reverse -296 -315 -1.7705 0.297
NP_441041.1_4 Forward -204 -185 -11.8986 0.254
NP_441041.1_7 Forward -311 -299 6.64018 0.2
NP_441725.1_5 Reverse -196 -206 9.22315 0.0553
NP_439966.1_9 Reverse -65 -74 3.7363 0.253
NP_442941.1_3 Forward -203 -193 0.373358 0.212
NP_440983.1_5 Reverse -189 -208 -8.55534 0.295
NP_440260.1_8 Forward -171 -153 -4.60241 0.273
NP_440260.1_8 Reverse -186 -204 -6.27403 0.289
NP_441514.1_6 Reverse -82 -89 14.2971 0.248
NP_441514.1_6 Reverse -6 -13 14.2971 0.248
NP_442281.1_1 Reverse -190 -204 5.40719 0.159
NP_442281.1_1 Reverse -109 -123 3.34225 0.235
NP_442281.1_1 Reverse -142 -156 2.35894 0.269
NP_442575.1_1 Reverse -186 -205 2.16274 0.23
NP_441644.1_6 Forward -198 -188 7.94438 0.113
NP_441644.1_6 Forward -248 -238 6.27276 0.163
NP_441644.1_6 Forward -204 -194 6.27276 0.163
NP_441644.1_6 Reverse -344 -354 5.19112 0.204
NP_441644.1_6 Reverse -189 -199 5.09279 0.21
NP_441644.1_6 Reverse -195 -205 4.69947 0.228
NP_442215.1_2 Reverse -186 -202 -3.48138 0.216
NP_442215.1_2 Reverse -193 -209 -5.64466 0.254
NP_442215.1_2 Forward -307 -291 -6.43131 0.271
NP_442029.1_1 Reverse -74 -93 -20.4534 0.298
NP_442029.1_6 Forward -128 -109 12.7825 0.151
NP_440253.1_2 Reverse -299 -317 6.214 0.0836
NP_442933.1_10 Forward -204 -195 4.42462 0.246
NP_441751.2_8 Reverse -196 -210 6.78443 0.0348
NP_441751.2_8 Forward -203 -189 -1.8687 0.132
NP_442554.1_8 Forward -203 -193 5.5849 0.145
NP_442554.1_8 Forward -197 -187 5.28991 0.153
NP_442554.1_8 Reverse -196 -206 4.60159 0.18
NP_442554.1_8 Reverse -190 -200 4.0116 0.2
NP_442554.1_8 Forward -352 -342 3.81494 0.209
NP_442142.1_4 Reverse -164 -177 13.195 0.0381
NP_442142.1_4 Forward -207 -194 4.93527 0.206
NP_442142.1_4 Reverse -186 -199 2.87033 0.273
NP_442292.1_5 Forward -259 -240 -0.590531 0.257
NP_440122.1_2 Reverse -187 -206 3.34271 0.235
NP_441523.1_6 Reverse -3 -22 7.86593 0.19
NP_443009.1_5 Reverse -194 -205 4.18809 0.259
NP_443009.1_5 Forward -124 -113 3.79477 0.278
NP_440183.1_9 Forward -202 -183 -12.2919 0.256
NP_441468.1_1 Reverse -115 -122 4.07068 0.263
NP_441468.1_1 Forward -203 -196 3.97235 0.277
NP_442099.1_1 Forward -122 -104 15.2604 0.274
NP_439939.1_3 Forward -36 -17 -2.75381 0.214
NP_441015.1_10 Forward -68 -49 -9.93197 0.282
NP_441673.1_1 Forward -204 -195 1.27803 0.155
NP_441673.1_1 Reverse -195 -204 1.27803 0.155
NP_441673.1_1 Reverse -299 -308 -7.86675 0.187
NP_441673.1_1 Forward -308 -299 -7.96508 0.206
NP_441731.1_9 Forward -321 -304 19.705 0.201
NP_442253.1_5 Reverse -356 -373 -5.27103 0.294
NP_441826.1_2 Reverse -189 -203 12.3893 0.0284
NP_441826.1_2 Forward -210 -196 0.982901 0.167
NP_441826.1_5 Reverse -297 -316 2.16274 0.276
NP_441330.1_1 Reverse -109 -128 -15.3402 0.275
NP_442490.1_9 Forward -204 -185 -1.96717 0.202
NP_442719.1_2 Forward -204 -186 -10.0113 0.268
NP_442227.1_2 Reverse -197 -216 2.16274 0.238
NP_442227.1_2 Forward -303 -284 0.196116 0.252
NP_443058.1_9 Forward -310 -292 14.0805 0.164
NP_442808.1_1 Reverse -166 -176 5.28945 0.162
NP_442808.1_1 Reverse -194 -204 4.50281 0.197
NP_442808.1_1 Reverse -152 -162 4.10949 0.207
NP_442808.1_1 Forward -101 -91 1.15957 0.292
NP_441101.1_10 Reverse -191 -210 7.47261 0.173
NP_440031.1_10 Reverse -282 -301 -0.4922 0.285
NP_440145.1_3 Forward -172 -153 -6.29373 0.295
NP_441906.1_2 Reverse -151 -170 2.26028 0.286
NP_442718.1_1 Reverse -168 -187 1.67108 0.297
NP_442542.1_2 Forward -206 -193 9.45906 0.134
NP_442542.1_2 Reverse -187 -200 8.57408 0.154
NP_442050.1_1 Reverse -1 -20 11.2092 0.233
NP_442342.1_9 Reverse -165 -181 3.69678 0.258
NP_442342.1_9 Reverse -187 -203 2.12349 0.29
NP_440558.1_2 Reverse -186 -205 3.73603 0.153
NP_440558.1_2 Reverse -96 -115 -1.08219 0.208
NP_440558.1_2 Reverse -356 -375 -3.83545 0.239
NP_442789.1_4 Forward -322 -303 -4.52377 0.26
NP_441518.1_3 Forward -318 -299 -13.6686 0.264
NP_441878.1_6 Forward -205 -195 11.9764 0.0155
NP_441878.1_6 Reverse -188 -198 10.5014 0.0176
NP_441878.1_6 Reverse -194 -204 1.25834 0.108
NP_441878.1_6 Forward -199 -189 0.57002 0.14
NP_441557.1_5 Forward -204 -195 0.393051 0.166
NP_441557.1_5 Reverse -195 -204 0.393051 0.166
NP_441557.1_8 Reverse -49 -59 12.4676 0.236
NP_441445.1_1 Forward -213 -194 5.99764 0.159
NP_441445.1_8 Reverse -346 -365 -12.4886 0.277
NP_441433.1_8 Forward -122 -103 5.89931 0.175
NP_441433.1_8 Forward -295 -276 0.491109 0.239
NP_442777.1_1 Reverse -49 -68 9.43841 0.194
NP_442777.1_3 Forward -102 -84 23.3227 0.0255
NP_441564.1_9 Forward -260 -241 20.649 0.106
NP_442192.1_4 Reverse -328 -347 10.7167 0.274
NP_442397.1_9 Reverse -189 -208 5.211 0.247
NP_442494.1_7 Forward -202 -183 -2.16383 0.277
NP_441549.1_9 Reverse -191 -209 -0.7675 0.15
NP_442645.1_2 Forward -164 -145 -17.9951 0.267
NP_442965.1_2 Reverse -2 -21 -7.37537 0.268
NP_442888.1_6 Reverse -156 -175 5.01433 0.228
NP_442594.1_8 Reverse -83 -102 6.09597 0.236
NP_442594.1_8 Reverse -74 -93 3.83436 0.279
NP_442508.1_8 Forward -65 -48 9.08529 0.292
NP_441633.1_3 Reverse -112 -125 -3.4223 0.177
NP_442590.1_10 Reverse -290 -309 13.1758 0.137
NP_442998.1_5 Reverse -40 -50 14.0414 0.151
NP_442998.1_5 Reverse -39 -49 13.1564 0.158
NP_442998.1_5 Reverse -83 -93 10.9931 0.199
NP_442998.1_10 Forward -202 -195 4.16902 0.259
NP_440299.1_1 Reverse -191 -204 18.2099 0.00451
NP_440299.1_1 Forward -202 -189 8.08184 0.098
NP_440299.1_1 Reverse -185 -198 2.57534 0.284
NP_441007.1_10 Reverse -297 -310 0.904263 0.212
NP_442334.1_2 Reverse -185 -202 -6.35267 0.249
NP_440087.1_1 Reverse -186 -205 -5.80207 0.249
NP_441559.1_3 Reverse -45 -64 15.5349 0.274
NP_441559.1_9 Reverse -11 -30 18.6823 0.0902
NP_441270.1_6 Forward -320 -306 21.2391 0.115
NP_442860.1_9 Reverse -51 -64 13.8833 0.214
NP_442785.1_7 Reverse -381 -395 12.1926 0.228
NP_441464.1_1 Reverse -100 -119 7.27595 0.262
NP_441464.1_2 Reverse -319 -329 17.2863 0.221
NP_441494.1_6 Reverse -297 -310 8.37742 0.23
NP_440677.1_8 Forward -65 -46 15.5357 0.281
NP_442386.1_9 Reverse -113 -122 8.65242 0.188
NP_442386.1_9 Reverse -388 -397 6.29249 0.226
NP_442386.1_10 Forward -66 -53 5.32916 0.262
NP_440570.1_5 Reverse -185 -204 7.17762 0.174
NP_440570.1_5 Forward -208 -189 -0.295539 0.262
NP_440570.1_5 Reverse -58 -77 -4.03212 0.299
NP_441750.1_1 Reverse -287 -306 -12.4886 0.3
NP_441750.1_7 Forward -66 -56 14.828 0.254
NP_441340.1_5 Reverse -196 -203 11.0522 0.0749
NP_441340.1_5 Forward -122 -115 3.97235 0.274
NP_442186.1_9 Reverse -187 -206 4.52268 0.27
NP_440168.1_4 Reverse -185 -204 4.42435 0.185
NP_441776.1_5 Forward -208 -189 12.9791 0.229
NP_441254.1_1 Forward -258 -245 12.9984 0.295
NP_442240.1_1 Reverse -291 -310 10.1267 0.207
NP_441160.1_1 Forward -116 -97 -3.3438 0.236
NP_440586.1_1 Forward -327 -308 4.32602 0.202
NP_440586.1_8 Forward -197 -190 5.8403 0.283
NP_440684.1_9 Reverse -180 -194 8.55439 0.226
NP_440027.1_8 Reverse -192 -211 9.34008 0.243
NP_439937.1_8 Forward -310 -291 -2.45882 0.259
NP_439937.1_9 Forward -53 -36 -12.6465 0.274
NP_439937.1_9 Reverse -166 -183 -13.3348 0.285
NP_442294.1_3 Forward -54 -40 14.1586 0.248
NP_440408.1_7 Forward -210 -191 12.4875 0.21
NP_440819.1_5 Reverse -39 -47 7.68924 0.266
NP_440316.1_10 Forward -205 -195 7.84651 0.245
NP_440210.1_10 Forward -31 -12 5.50519 0.296
NP_442384.1_10 Forward -204 -191 6.80412 0.0939
NP_442384.1_10 Reverse -189 -202 3.65753 0.183
NP_442384.1_10 Reverse -147 -160 3.16588 0.199
NP_440364.1_1 Forward -70 -51 17.7974 0.251
NP_441877.1_7 Reverse -109 -128 5.70185 0.218
NP_441018.1_7 Forward -214 -195 6.4893 0.286
NP_441018.1_7 Forward -171 -152 6.4893 0.286
NP_442790.1_4 Reverse -290 -309 -15.0452 0.284
NP_442262.1_10 Forward -122 -115 9.87221 0.164
NP_442262.1_10 Reverse -196 -203 7.90559 0.266
NP_440163.1_10 Forward -201 -191 12.5664 0.159
NP_440344.1_10 Forward -315 -298 -3.69774 0.0862
NP_440282.1_10 Forward -300 -281 4.42435 0.125
NP_440282.1_10 Reverse -185 -204 -7.08038 0.251
NP_440297.1_1 Reverse -180 -199 12.5858 0.134
NP_440297.1_9 Reverse -196 -206 10.5998 0.0917
NP_440297.1_9 Forward -203 -193 6.76487 0.17
NP_440297.1_9 Reverse -115 -125 1.16001 0.282
NP_440297.1_9 Forward -197 -187 -0.314959 0.282
NP_440297.1_9 Reverse -190 -200 -0.41329 0.283
NP_442280.1_10 Forward -20 -2 10.3244 0.223
NP_441592.1_4 Reverse -189 -208 -4.22878 0.297
NP_442553.1_5 Forward -275 -256 19.2723 0.0824
NP_440999.1_1 Forward -103 -84 5.50519 0.197
NP_440999.1_1 Reverse -52 -71 4.52188 0.232
NP_440999.1_9 Forward -306 -292 0.0979218 0.193
NP_440999.1_9 Reverse -163 -177 -3.63866 0.299
NP_440888.1_2 Forward -308 -294 5.50552 0.276
NP_442225.1_10 Reverse -303 -322 8.35677 0.27
NP_442033.1_10 Forward -310 -291 -7.86702 0.186
NP_441543.1_2 Forward -203 -194 5.80125 0.174
NP_441543.1_2 Reverse -196 -205 4.0313 0.293
NP_442845.1_2 Forward -204 -190 8.75105 0.187
NP_442845.1_2 Forward -162 -148 7.76774 0.195
NP_442845.1_2 Reverse -189 -203 4.71948 0.254
NP_441469.1_8 Reverse -113 -122 12.7828 0.0967
NP_441469.1_8 Forward -109 -100 7.96454 0.227
NP_442315.1_2 Forward -160 -148 10.8554 0.291
NP_441462.1_2 Reverse -195 -205 0.57002 0.144
NP_441621.1_7 Forward -319 -305 -1.77037 0.187
NP_442204.1_1 Forward -180 -169 7.82682 0.112
NP_442204.1_1 Reverse -3 -14 1.82863 0.266
NP_442204.1_6 Reverse -287 -306 12.5858 0.138
NP_440504.1_7 Forward -374 -355 -1.57384 0.238
NP_442428.1_4 Reverse -188 -207 8.16093 0.18
NP_442428.1_4 Forward -205 -186 1.67108 0.287
NP_442428.1_5 Reverse -115 -122 4.46401 0.267
NP_442428.1_5 Forward -203 -196 4.36568 0.271
NP_441443.1_1 Reverse -82 -101 -5.01543 0.297
NP_441443.1_7 Reverse -341 -360 -2.16383 0.268
NP_440673.1_2 Forward -321 -302 8.5361 0.266
NP_440673.1_2 Forward -379 -360 8.04834 0.284
NP_440673.1_2 Reverse -292 -311 8.04834 0.284
NP_441052.1_2 Forward -204 -194 13.5497 0.0285
NP_441052.1_2 Reverse -189 -199 4.0116 0.168
NP_442219.1_8 Reverse -185 -204 17.154 0.0758
NP_441884.1_9 Forward -311 -292 -11.3086 0.108
NP_440314.1_9 Forward -263 -244 -5.9004 0.225
NP_441004.1_1 Forward -128 -109 -3.14714 0.154
NP_441004.1_1 Forward -204 -185 -10.6203 0.224
NP_441004.1_1 Reverse -281 -300 -16.5201 0.286
NP_442873.1_5 Forward -303 -284 17.8948 0.123
NP_442873.1_5 Reverse -50 -69 8.65176 0.259
NP_440296.1_10 Reverse -83 -102 -13.7669 0.269
NP_440296.1_10 Forward -68 -49 -15.3402 0.294
NP_441729.1_4 Forward -60 -41 10.0292 0.293
NP_441115.1_4 Forward -177 -159 9.06482 0.227
NP_441115.1_7 Forward -321 -302 23.2047 0.0505
NP_442206.1_1 Reverse -359 -378 -5.60541 0.209
NP_443054.1_2 Reverse -297 -311 -0.590395 0.299
NP_442430.1_2 Reverse -185 -204 3.44104 0.268
NP_441851.1_10 Forward -205 -195 6.17489 0.182
NP_441851.1_10 Forward -124 -114 4.20827 0.282
NP_441668.1_3 Forward -166 -147 8.25926 0.234
NP_441668.1_4 Forward -166 -147 -0.983855 0.265
NP_441396.1_5 Reverse -294 -303 7.66954 0.241
NP_441396.1_5 Forward -175 -166 7.37455 0.279
NP_441683.1_7 Reverse -1 -20 -12.9802 0.3
NP_440593.1_3 Reverse -184 -203 -5.60541 0.264
NP_440593.1_3 Forward -203 -184 -6.09707 0.27
NP_440593.1_3 Reverse -109 -128 -6.29373 0.272
NP_440593.1_9 Reverse -296 -310 8.25939 0.261
NP_441982.1_6 Reverse -38 -47 12.4854 0.275
NP_441046.1_2 Forward -167 -148 0.491109 0.268
NP_441349.1_10 Forward -214 -195 -8.65367 0.278
NP_442843.1_1 Reverse -240 -259 -10.0303 0.274
NP_442168.1_5 Forward -321 -302 5.211 0.202
NP_440588.1_2 Reverse -186 -205 -4.81876 0.23
NP_442006.1_2 Reverse -239 -256 -8.22096 0.192
NP_442006.1_2 Reverse -1 -18 -17.4641 0.276
NP_442243.1_1 Reverse -183 -201 -2.73484 0.295
NP_440078.1_10 Forward -198 -179 2.75272 0.269
NP_441078.1_4 Forward -204 -195 15.831 0.00457
NP_441078.1_4 Reverse -195 -204 7.76787 0.0454
NP_441078.1_4 Reverse -189 -198 -1.6719 0.266
NP_441078.1_4 Forward -198 -189 -1.77023 0.266
NP_441078.1_4 Forward -308 -299 -1.86856 0.272
NP_442729.1_5 Forward -199 -189 7.84651 0.261
NP_442729.1_7 Reverse -245 -263 6.90232 0.277
NP_440539.1_6 Forward -226 -207 13.9625 0.192
NP_442348.1_2 Forward -52 -43 17.011 0.055
NP_442348.1_2 Reverse -246 -255 7.76787 0.28
NP_442443.1_1 Reverse -288 -307 -5.01543 0.28
NP_442443.1_1 Forward -57 -38 -5.11376 0.281
NP_441094.1_6 Forward -315 -298 7.11794 0.284
NP_441432.1_8 Forward -205 -196 4.32629 0.223
NP_441432.1_8 Reverse -359 -368 2.65466 0.292
NP_442320.1_8 Forward -314 -300 -5.11362 0.206
NP_441732.1_2 Reverse -154 -170 -16.9527 0.223
NP_441732.1_2 Reverse -191 -207 -17.7394 0.292
NP_440497.1_2 Reverse -291 -310 5.99764 0.28
NP_440685.1_8 Forward -174 -155 12.0942 0.281
NP_440760.1_1 Reverse -114 -133 -15.8318 0.157
NP_440760.1_1 Reverse -147 -166 -16.2252 0.169
NP_442797.1_7 Reverse -188 -206 -0.865831 0.288
NP_440199.1_10 Forward -201 -191 6.46988 0.299
NP_441057.1_4 Reverse -343 -361 -0.275845 0.26
NP_441023.1_1 Reverse -86 -104 12.2122 0.233
NP_442489.1_7 Forward -204 -195 8.06287 0.0371
NP_442489.1_7 Reverse -195 -204 1.08137 0.109
NP_442489.1_7 Reverse -189 -198 -1.47524 0.203
NP_442489.1_7 Forward -198 -189 -1.77023 0.247
NP_440757.1_6 Reverse -298 -317 9.53756 0.28
NP_440757.1_7 Forward -316 -298 -0.275845 0.269
NP_440757.1_7 Forward -203 -185 -0.570838 0.269
NP_441659.2_8 Reverse -195 -205 7.55152 0.0593
NP_441659.2_8 Forward -198 -188 4.20827 0.142
NP_442913.1_10 Reverse -180 -199 -4.13045 0.227
NP_441800.1_3 Reverse -282 -300 3.55906 0.292
NP_442346.1_5 Forward -205 -195 13.4514 0.0235
NP_442346.1_5 Forward -199 -189 13.353 0.0261
NP_442346.1_5 Reverse -194 -204 6.46988 0.201
NP_442346.1_5 Reverse -188 -198 6.27322 0.208
NP_442346.1_5 Reverse -163 -173 4.79825 0.272
NP_440352.1_5 Forward -121 -102 10.9037 0.27
NP_440545.1_3 Reverse -191 -208 7.11867 0.0518
NP_440545.1_3 Forward -127 -110 -2.61609 0.189
NP_440545.1_3 Forward -208 -191 -3.40274 0.203
NP_440545.1_3 Forward -321 -304 -5.56602 0.253
NP_440545.1_3 Reverse -185 -202 -5.66436 0.256
NP_440545.1_3 Forward -202 -185 -6.15601 0.27
NP_440459.1_2 Reverse -111 -128 10.8552 0.189
NP_440010.1_4 Reverse -185 -204 -1.96793 0.273
NP_440010.1_10 Reverse -290 -309 4.03102 0.248
NP_442551.1_4 Reverse -357 -372 0.668214 0.245
NP_442551.1_4 Forward -200 -185 -3.46169 0.29
NP_442900.1_1 Forward -67 -48 -6.29373 0.238
NP_441888.1_7 Reverse -109 -123 0.982901 0.272
NP_441050.1_5 Forward -171 -153 -0.669169 0.256
NP_441895.1_10 Reverse -79 -98 -17.9951 0.281
NP_441895.1_10 Reverse -70 -89 -27.8282 0.299
NP_442699.1_8 Forward -119 -100 -12.3902 0.253
NP_442162.1_10 Forward -73 -54 16.6125 0.216
NP_440671.1_4 Forward -210 -196 7.37441 0.219
NP_442140.1_3 Forward -197 -187 8.53483 0.119
NP_442140.1_3 Forward -175 -165 7.25653 0.146
NP_442140.1_3 Reverse -345 -355 6.17489 0.184
NP_442140.1_3 Reverse -115 -125 3.91327 0.271
NP_442723.1_1 Forward -20 -1 4.52188 0.276
NP_441692.1_2 Reverse -70 -89 4.62101 0.169
NP_441813.1_5 Reverse -112 -122 -0.806614 0.285
NP_442497.1_10 Reverse -196 -205 0.29472 0.199
NP_440821.1_4 Forward -206 -196 0.275027 0.19
NP_441239.1_9 Reverse -112 -124 11.2487 0.0648
NP_441239.1_9 Reverse -187 -199 5.34885 0.223
NP_441951.1_4 Reverse -296 -315 5.89931 0.273
NP_441951.1_7 Reverse -66 -80 15.9379 0.278
NP_441892.1_1 Forward -213 -196 -1.33779 0.203
NP_440665.1_1 Forward -341 -322 -15.7335 0.275
NP_442643.1_3 Forward -75 -56 3.24438 0.149
NP_441017.1_6 Forward -202 -188 16.7152 0.0651
NP_441874.1_1 Reverse -176 -190 11.406 0.249
NP_443035.1_10 Forward -246 -229 5.54538 0.273
NP_441526.1_8 Forward -338 -319 -3.14714 0.277
NP_440546.1_4 Forward -198 -188 8.59164 0.181
NP_440546.1_4 Reverse -195 -205 8.39772 0.192
NP_442499.1_1 Reverse -190 -209 3.34271 0.257
NP_442499.1_3 Forward -205 -187 5.32902 0.282
NP_441249.1_3 Reverse -187 -206 0.58944 0.285
NP_441868.1_2 Forward -47 -28 13.2741 0.224
NP_442402.1_2 Forward -51 -37 11.7003 0.272
NP_442402.1_4 Reverse -267 -286 -7.57277 0.276
NP_442402.1_10 Forward -48 -38 13.0576 0.204
NP_441848.1_7 Reverse -42 -61 2.35861 0.224
NP_441084.1_6 Reverse -187 -201 10.7015 0.231
NP_442923.1_4 Forward -204 -185 -4.91709 0.263
NP_441811.1_8 Forward -374 -360 9.2427 0.227
NP_441811.1_8 Reverse -183 -197 6.48943 0.272
NP_442380.1_10 Reverse -179 -197 10.8356 0.242
NP_442380.1_10 Reverse -292 -310 10.5406 0.242
NP_442409.1_5 Forward -168 -149 13.3725 0.238
NP_440505.1_3 Reverse -193 -203 5.48657 0.227
NP_441701.1_3 Forward -378 -361 6.23369 0.294
NP_442532.1_7 Reverse -293 -307 3.14618 0.206
NP_440914.1_1 Forward -204 -194 6.95605 0.257
NP_440914.1_4 Reverse -97 -113 10.9726 0.271
NP_442470.1_3 Reverse -160 -179 8.84842 0.286
NP_442533.1_1 Forward -66 -47 -5.31042 0.155
NP_442533.1_1 Reverse -284 -303 -14.0619 0.239
NP_442533.1_1 Forward -173 -154 -14.1602 0.24
NP_442533.1_6 Reverse -195 -204 8.35786 0.0767
NP_442533.1_6 Forward -204 -195 7.57121 0.0898
NP_442533.1_6 Reverse -189 -198 6.98123 0.0992
NP_442533.1_6 Forward -198 -189 6.68623 0.105
NP_442533.1_6 Forward -308 -299 4.52295 0.179
NP_442533.1_6 Reverse -338 -347 3.44131 0.212
NP_442533.1_6 Reverse -302 -311 3.44131 0.212
NP_442533.1_6 Forward -156 -147 3.04799 0.228
NP_442541.1_10 Reverse -383 -397 3.04726 0.254
NP_442232.1_3 Forward -212 -193 -15.9302 0.299
NP_442322.1_4 Reverse -150 -167 -9.10659 0.287
NP_442322.1_9 Forward -98 -80 18.1112 0.139
NP_441482.1_7 Reverse -189 -203 -11.3085 0.254
NP_441482.1_7 Forward -210 -196 -11.6035 0.275
NP_439944.1_9 Forward -203 -193 13.8447 0.05
NP_441028.1_6 Forward -47 -37 7.35439 0.229
NP_441028.1_6 Forward -90 -80 7.0594 0.23
NP_441028.1_6 Reverse -277 -287 3.8145 0.281
NP_440116.1_8 Reverse -168 -187 -8.16202 0.247
NP_441527.1_4 Reverse -12 -31 -9.31089 0.256
NP_441527.1_4 Reverse -14 -33 -9.40638 0.258
NP_440007.1_9 Forward -208 -194 0.982901 0.29
NP_441680.1_4 Forward -297 -278 0.491109 0.246
NP_441680.1_6 Forward -259 -240 15.1416 0.165
NP_441961.1_4 Forward -58 -39 2.16274 0.299
NP_441602.1_3 Forward -203 -184 -5.01543 0.277
NP_441170.1_4 Reverse -329 -347 2.67408 0.283
NP_441106.1_1 Forward -312 -303 2.26134 0.293
NP_441420.1_2 Forward -311 -292 11.9958 0.268
NP_439903.1_6 Reverse -380 -399 8.4551 0.136
NP_439903.1_6 Forward -389 -370 1.76863 0.24
NP_441286.1_1 Reverse -194 -206 4.36554 0.0342
NP_441286.1_1 Forward -199 -187 2.10393 0.0737
NP_442674.1_3 Forward -212 -193 13.5683 0.174
NP_441479.1_1 Forward -322 -303 6.4893 0.295
NP_441930.1_1 Reverse -191 -210 8.16093 0.235
NP_441930.1_2 Forward -205 -195 12.2714 0.262
NP_440886.1_7 Forward -303 -293 11.2876 0.0805
NP_440886.1_7 Reverse -56 -66 8.43603 0.0805
NP_440886.1_7 Forward -306 -296 6.37109 0.13
NP_440886.1_7 Reverse -319 -329 4.89613 0.213
NP_440886.1_7 Forward -309 -299 4.69947 0.22
NP_440886.1_7 Reverse -49 -59 3.32285 0.287
NP_441427.1_2 Forward -188 -169 10.6192 0.127
NP_442773.2_4 Reverse -296 -310 15.8309 0.157
NP_441463.1_6 Forward -200 -186 17.3355 0.114
NP_441463.1_6 Reverse -193 -207 10.088 0.242
NP_442842.1_10 Forward -21 -2 3.66898 0.244
NP_441901.1_1 Forward -207 -188 10.3242 0.11
NP_442365.1_7 Reverse -191 -210 1.17943 0.172
NP_442794.1_1 Reverse -110 -122 4.07055 0.279
NP_441962.1_4 Reverse -294 -313 -5.31042 0.167
NP_441962.1_4 Reverse -184 -203 -14.6519 0.291
NP_440387.1_1 Forward -204 -188 4.18844 0.0455
NP_440387.1_1 Reverse -195 -211 -3.8747 0.169
NP_440387.1_1 Reverse -189 -205 -4.85801 0.203
NP_440387.1_1 Forward -308 -292 -5.448 0.232
NP_441431.1_3 Forward -335 -316 4.32602 0.263
NP_441993.1_1 Forward -129 -110 1.65431 0.273
NP_441993.1_1 Reverse -296 -315 0.972113 0.288
NP_441174.1_2 Reverse -293 -307 13.3726 0.207
NP_442323.1_7 Reverse -122 -141 1.47364 0.279
NP_441510.2_7 Reverse -141 -155 10.0287 0.281
NP_441720.1_2 Reverse -379 -398 5.2102 0.217
NP_439988.1_7 Forward -309 -295 14.8469 0.292
NP_441237.1_9 Reverse -360 -370 9.41981 0.294
NP_442743.1_4 Forward -122 -103 -2.75381 0.211
NP_442867.1_8 Forward -361 -342 4.03102 0.293
NP_440457.1_1 Forward -208 -196 8.29878 0.101
NP_442940.1_2 Forward -311 -292 1.47442 0.295
NP_441981.1_3 Reverse -39 -53 16.6453 0.268
NP_440142.1_7 Reverse -7 -26 7.07928 0.259
NP_442509.1_9 Forward -255 -245 6.96107 0.244
NP_440554.1_4 Forward -122 -112 4.99491 0.167
NP_441885.1_5 Forward -204 -194 9.91146 0.0172
NP_441885.1_5 Forward -308 -298 -0.314959 0.195
NP_440478.1_7 Reverse -339 -358 18.3873 0.25
NP_441428.1_8 Reverse -294 -313 11.2092 0.176
NP_442341.1_7 Forward -205 -191 1.67122 0.282
NP_442341.1_7 Reverse -194 -208 1.08123 0.299
NP_441173.1_9 Forward -46 -38 13.1954 0.184
NP_441173.1_9 Forward -382 -374 11.0321 0.228
NP_440507.2_3 Reverse -186 -205 16.8132 0.0682
NP_442275.1_1 Reverse -186 -205 7.96426 0.253
NP_443010.1_10 Forward -55 -38 8.27892 0.161
NP_442451.1_2 Forward -116 -97 -0.0988766 0.155
NP_442451.1_2 Reverse -106 -125 -7.37537 0.234
NP_439962.1_4 Forward -310 -291 0.982764 0.197
NP_439962.1_6 Forward -333 -315 7.98396 0.275
NP_441105.1_3 Forward -134 -115 2.65439 0.1
NP_441105.1_3 Forward -209 -190 0.0977854 0.13
NP_441105.1_3 Forward -215 -196 -9.24366 0.286
NP_440216.1_1 Reverse -195 -209 -12.6851 0.296
NP_440172.1_1 Forward -204 -194 2.63497 0.274
NP_442290.1_3 Forward -197 -178 12.6841 0.241
NP_442015.1_10 Reverse -110 -123 1.69091 0.204
NP_442015.1_10 Reverse -191 -204 -0.472371 0.268
NP_441226.1_7 Reverse -390 -397 8.29857 0.205
NP_440198.1_3 Reverse -45 -64 17.5998 0.231
NP_440416.1_9 Reverse -188 -207 -17.8968 0.248
NP_440416.1_9 Reverse -306 -325 -20.65 0.287
NP_443052.1_9 Reverse -109 -128 0.392778 0.2
NP_443052.1_9 Forward -351 -332 -1.37718 0.227
NP_443052.1_9 Forward -306 -287 -1.96717 0.231
NP_440072.1_5 Reverse -287 -305 1.69077 0.236
NP_440591.1_9 Reverse -292 -310 9.65558 0.147
NP_442154.1_1 Reverse -285 -303 -13.9439 0.217
NP_442154.1_1 Forward -68 -50 -17.3854 0.254
NP_442154.1_1 Reverse -83 -101 -17.8771 0.272
NP_440261.1_5 Forward -310 -297 -4.01229 0.139
NP_440261.1_5 Forward -197 -184 -6.56889 0.201
NP_440988.1_10 Forward -310 -296 4.02751 0.275
NP_440988.1_10 Forward -200 -186 3.54345 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACAGGGTTGGCAAAGGTCTTTTGCAAAGTGGGGACAATGCCTACCTGTACCATGGGCACGTCCACAAGAATGGTGGTGCGGGATGCTAAAGCGGCGGCCCCCACCGTCAGTACCCGGGCGGAAAAATGCAGTAGGTTGAGGTACTCAAAATCCCCCGTGGCGTAGATAACTCGCCGCAGAATCTCATACTGAGCAGGGCTATGGCCATGGTCCCCGATTTCATAGTCGATGGTGGCTAGGTTTTGGGCGTCGCTAATATGCCAATTCATTATGCTTGTGCCATTGCAGGGGGTGAAATGCCTCCATACCATCTTCCCCTATTTCTACAATCCCAGATGGTTGGGGGGCGGGGATTTTTCCCCACTAAAATTGTATTTGTTCCCTTTCCTTCCCCTTGGCC

CDS

ATGGTCAATTTTCGTCGCCGGGCTCTCCAACGTCGTCTGCAAAATGATCCCTACTACCGTTTTCAATCTTGGCAAGAATTGGCGATCGCCGGGGAATTGGGCCTCAGGATTGAAGTTAACCAAGCCACAGTGGATGAATGGCTGCGTTTGCCTGGGTTATCTATTCACCAGGCCCGACAACTAAAAGAATTGAGCACCATGGGGGTGCAATTTCTAGCCCTGGAAGATTTGGCCGCTGCCCTCAATGTCCCAGTGCAACAAATTAAGCCTTGGGAACCCATACTTTCCTTTACCTATGCCGATCCGGATAGCCTACTGGCACCACCAAAAATTCCGGTTAACCAAGCCGACCTTAACCAATTACTTACCGTGCCCCATCTATCTCCGGCGATCGCCACTGCGTTGTTGCAAGAAAGGGAGATTGGGGGAGACTACCGCAACCTAGGGGATTTACAAAAGCGTTTAGGATTGCCAGTGGCATTGATTACCCAACTGATCCACTATCTACAATTCTAA

Protein

MVNFRRRALQRRLQNDPYYRFQSWQELAIAGELGLRIEVNQATVDEWLRLPGLSIHQARQLKELSTMGVQFLALEDLAAALNVPVQQIKPWEPILSFTYADPDSLLAPPKIPVNQADLNQLLTVPHLSPAIATALLQEREIGGDYRNLGDLQKRLGLPVALITQLIHYLQF