Your browser is old and dusty. Try Google Chrome!

Details for sll1384

ORF sll1384
Accession NP_441566.1
Symbol
Category Chaperones
Definition similar to DnaJ protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -319 -305 1.27789 0.192
NP_441061.1_2 Forward -313 -299 -2.45868 0.293
NP_441418.1_6 Forward -395 -376 -12.7836 0.0699
NP_442291.1_5 Forward -396 -380 4.28677 0.0943
NP_441453.1_4 Reverse -386 -394 7.19758 0.0757
NP_441453.1_4 Forward -395 -387 6.80426 0.121
NP_441453.1_7 Forward -332 -325 14.1988 0.175
NP_441623.1_1 Reverse -325 -343 4.6407 0.184
NP_441623.1_1 Forward -192 -174 -1.75081 0.241
NP_442151.1_6 Reverse -317 -331 7.86607 0.188
NP_442838.1_7 Forward -400 -381 -11.6036 0.297
NP_442655.1_1 Reverse -312 -331 2.65439 0.238
NP_442173.1_1 Forward -394 -386 7.68924 0.142
NP_442173.1_1 Reverse -387 -395 5.72262 0.203
NP_442752.1_4 Forward -395 -388 13.8055 0.0199
NP_442752.1_4 Forward -92 -85 4.26735 0.293
NP_443027.1_4 Forward -397 -387 10.1081 0.144
NP_441812.1_3 Forward -396 -382 6.98109 0.287
NP_440784.1_7 Forward -394 -387 6.23397 0.241
NP_440784.1_7 Reverse -387 -394 6.13563 0.241
NP_442909.1_7 Forward -191 -177 10.2254 0.14
NP_442062.1_8 Forward -395 -385 14.9263 0.0108
NP_442062.1_8 Reverse -386 -396 7.15819 0.107
NP_441900.1_2 Reverse -286 -304 -1.9482 0.273
NP_441859.1_3 Forward -396 -377 11.7983 0.103
NP_441859.1_5 Reverse -212 -231 13.6675 0.182
NP_442242.1_4 Reverse -387 -394 10.8555 0.127
NP_440307.1_2 Reverse -184 -203 1.47442 0.278
NP_441208.1_1 Reverse -177 -196 -4.6221 0.263
NP_441208.1_9 Forward -329 -315 13.4709 0.107
NP_441925.1_4 Forward -193 -174 -1.27961 0.155
NP_441083.1_5 Forward -395 -385 -0.0199663 0.251
NP_441738.1_2 Reverse -388 -395 15.28 0.0102
NP_440209.1_1 Forward -395 -387 8.57422 0.0425
NP_440209.1_1 Reverse -386 -394 5.32929 0.139
NP_442889.1_8 Forward -398 -384 7.07881 0.163
NP_441713.1_5 Reverse -301 -320 10.4225 0.229
NP_442570.1_3 Forward -316 -297 -1.27885 0.212
NP_442111.1_4 Reverse -345 -359 3.8345 0.229
NP_441624.1_7 Forward -319 -305 6.09611 0.292
NP_440906.1_5 Forward -394 -387 6.23397 0.234
NP_440906.1_5 Reverse -387 -394 6.13563 0.241
NP_441486.1_1 Forward -398 -384 3.24451 0.0638
NP_442634.1_2 Forward -329 -310 -0.0988766 0.293
NP_442634.1_4 Forward -393 -379 2.06454 0.147
NP_442634.1_4 Forward -321 -307 -5.60527 0.264
NP_442634.1_4 Forward -315 -301 -5.80194 0.279
NP_440470.1_5 Forward -91 -72 6.06331 0.28
NP_441695.1_8 Reverse -89 -103 10.226 0.295
NP_441014.1_8 Reverse -285 -304 -3.63879 0.242
NP_443018.1_3 Forward -394 -387 12.6255 0.0471
NP_443018.1_3 Reverse -387 -394 5.25066 0.214
NP_440376.1_1 Forward -395 -386 -0.000272808 0.285
NP_440376.1_1 Reverse -386 -395 -0.0986038 0.285
NP_441588.1_4 Reverse -388 -398 6.96153 0.178
NP_442687.1_7 Forward -396 -386 5.78156 0.188
NP_442687.1_7 Forward -288 -278 4.0116 0.271
NP_442191.1_4 Forward -198 -184 13.514 0.144
NP_442191.1_4 Forward -379 -365 11.0901 0.271
NP_442946.1_7 Forward -229 -214 17.5283 0.192
NP_440781.1_1 Forward -233 -219 14.8476 0.248
NP_440642.1_10 Reverse -337 -351 2.65393 0.277
NP_440533.1_6 Reverse -192 -211 14.1591 0.238
NP_440360.1_5 Reverse -380 -399 -5.60541 0.297
NP_442658.1_1 Forward -397 -387 9.02601 0.169
NP_442544.1_2 Reverse -338 -352 -0.197071 0.217
NP_441414.1_9 Forward -150 -131 -10.817 0.296
NP_442321.1_4 Reverse -200 -219 3.93269 0.255
NP_441317.1_4 Forward -67 -53 9.27298 0.297
NP_441958.1_5 Forward -396 -386 1.55333 0.095
NP_441958.1_5 Reverse -385 -395 0.963343 0.12
NP_441127.1_1 Forward -296 -282 8.84938 0.284
NP_440318.1_1 Reverse -211 -230 0.392778 0.296
NP_442486.1_4 Reverse -85 -104 13.3725 0.167
NP_442836.1_3 Reverse -191 -210 16.6147 0.27
NP_439905.1_1 Forward -193 -180 11.3273 0.204
NP_439905.1_1 Reverse -230 -243 9.75405 0.216
NP_439990.1_5 Forward -400 -387 8.77074 0.162
NP_442690.1_1 Forward -91 -72 -1.37718 0.128
NP_442911.1_2 Reverse -372 -391 -10.817 0.289
NP_440858.1_1 Forward -230 -211 -1.96717 0.26
NP_443055.1_6 Forward -26 -8 -1.35821 0.277
NP_443055.1_6 Reverse -357 -375 -1.45654 0.279
NP_443055.1_6 Reverse -331 -349 -1.45654 0.279
NP_442236.1_3 Forward -323 -304 7.07928 0.267
NP_441099.1_5 Reverse -289 -308 -10.817 0.262
NP_442002.1_9 Forward -396 -389 10.7572 0.185
NP_443020.1_4 Reverse -295 -314 23.598 0.00999
NP_441424.1_7 Reverse -364 -383 9.43923 0.291
NP_442438.1_10 Forward -31 -17 3.53951 0.161
NP_440879.1_6 Reverse -381 -400 -2.85214 0.279
NP_440377.1_1 Forward -79 -62 11.6602 0.271
NP_441674.1_2 Reverse -373 -392 12.9791 0.131
NP_440147.1_1 Forward -361 -342 3.93269 0.254
NP_440147.1_3 Forward -334 -315 5.01433 0.24
NP_440147.1_4 Forward -328 -315 0.314277 0.257
NP_440147.1_4 Reverse -384 -397 0.215946 0.261
NP_441916.1_7 Reverse -386 -396 15.9097 0.0072
NP_441916.1_7 Forward -395 -385 5.09324 0.146
NP_441041.1_4 Forward -319 -300 1.37609 0.0808
NP_441041.1_7 Forward -398 -386 6.64018 0.2
NP_441725.1_5 Forward -394 -384 2.24165 0.115
NP_441725.1_5 Reverse -387 -397 -0.806614 0.271
NP_439966.1_7 Forward -397 -387 7.74772 0.15
NP_439966.1_7 Forward -20 -10 7.55106 0.15
NP_439966.1_9 Forward -397 -388 10.7178 0.0863
NP_439966.1_9 Forward -316 -307 3.7363 0.253
NP_440736.1_3 Reverse -166 -185 5.99764 0.223
NP_442941.1_3 Forward -394 -384 -0.904945 0.274
NP_440289.1_2 Forward -398 -385 3.46087 0.078
NP_440289.1_2 Reverse -314 -327 0.0192843 0.178
NP_442281.1_1 Forward -324 -310 5.1122 0.169
NP_442281.1_1 Forward -204 -190 4.32555 0.199
NP_442281.1_1 Reverse -312 -326 4.03056 0.21
NP_442281.1_1 Reverse -381 -395 2.94893 0.249
NP_442281.1_1 Forward -400 -386 1.5723 0.296
NP_441566.1_1 Forward -331 -312 33.432 0.0000424
NP_441566.1_2 Forward -229 -210 28.0238 0.00135
NP_441566.1_3 Forward -298 -279 20.7473 0.0877
NP_441566.1_4 Forward -358 -339 34.9069 0.0000199
NP_441566.1_6 Forward -382 -363 28.3188 0.00122
NP_441566.1_9 Forward -249 -230 22.6156 0.0767
NP_001035871.2_7 Reverse -187 -197 19.2529 0.0547
NP_442012.1_1 Forward -191 -172 2.16274 0.204
NP_441556.1_4 Reverse -250 -269 9.61947 0.297
NP_443030.1_4 Reverse -298 -317 -6.09707 0.272
NP_441644.1_6 Forward -319 -309 5.28945 0.199
NP_440867.1_10 Forward -375 -356 5.70265 0.262
NP_442215.1_2 Reverse -315 -331 6.25339 0.0723
NP_442029.1_10 Forward -202 -183 12.9791 0.158
NP_442029.1_10 Reverse -280 -299 5.50599 0.284
NP_440929.1_8 Forward -319 -310 3.63797 0.214
NP_442933.1_10 Reverse -386 -395 15.1427 0.00958
NP_442933.1_10 Forward -395 -386 7.96454 0.0937
NP_441751.2_8 Forward -394 -380 -5.01529 0.19
NP_439922.1_3 Forward -75 -56 11.6018 0.193
NP_442554.1_8 Reverse -387 -397 6.17489 0.125
NP_442554.1_8 Forward -325 -315 3.02829 0.245
NP_441762.1_7 Reverse -385 -397 12.9203 0.0142
NP_442142.1_4 Reverse -182 -195 4.93527 0.206
NP_442142.1_4 Forward -214 -201 3.7553 0.246
NP_442292.1_1 Reverse -387 -396 -0.196935 0.239
NP_440919.1_7 Reverse -179 -197 5.16171 0.286
NP_441899.1_1 Forward -205 -187 12.4089 0.257
NP_443009.1_5 Reverse -385 -396 6.94134 0.144
NP_443009.1_5 Reverse -175 -186 4.28642 0.254
NP_442408.2_1 Forward -395 -376 -3.04881 0.241
NP_440881.1_3 Forward -238 -219 12.88 0.291
NP_441448.1_1 Reverse -219 -238 9.14423 0.198
NP_441468.1_1 Forward -394 -387 6.13563 0.209
NP_441468.1_1 Reverse -387 -394 6.0373 0.223
NP_441673.1_1 Forward -395 -386 1.27803 0.155
NP_441673.1_1 Reverse -386 -395 1.27803 0.155
NP_442253.1_5 Reverse -14 -31 -0.157821 0.213
NP_441172.1_1 Reverse -352 -370 1.39578 0.282
NP_441826.1_2 Reverse -311 -325 4.03116 0.105
NP_441637.1_9 Reverse -201 -219 -1.55415 0.292
NP_442719.1_3 Forward -139 -126 16.4399 0.292
NP_440806.1_1 Reverse -128 -146 10.3439 0.221
NP_441911.1_10 Reverse -56 -75 6.72726 0.294
NP_442808.1_1 Reverse -316 -326 4.69947 0.192
NP_441101.1_10 Reverse -357 -376 -2.85214 0.242
NP_442542.1_2 Forward -397 -384 9.65572 0.133
NP_442050.1_5 Reverse -384 -394 10.8943 0.126
NP_440558.1_2 Reverse -14 -33 -4.52377 0.246
NP_441878.1_6 Forward -327 -317 2.24165 0.0462
NP_441878.1_6 Forward -320 -310 0.963343 0.128
NP_441878.1_6 Reverse -385 -395 0.668351 0.139
NP_441036.1_8 Forward -396 -386 12.7631 0.0678
NP_441036.1_8 Reverse -381 -391 8.23984 0.176
NP_442721.1_3 Reverse -310 -329 12.7825 0.28
NP_441557.1_5 Forward -395 -386 8.94785 0.0289
NP_441557.1_5 Reverse -386 -395 0.688044 0.128
NP_441445.1_1 Forward -364 -345 5.89931 0.162
NP_441590.1_4 Forward -198 -179 2.55527 0.293
NP_442919.1_3 Reverse -51 -70 8.90648 0.231
NP_442183.1_1 Forward -395 -381 7.66941 0.134
NP_440979.1_3 Forward -394 -376 14.3755 0.234
NP_441574.1_1 Forward -326 -307 -5.11376 0.26
NP_441574.1_3 Forward -385 -366 16.4207 0.112
NP_442347.1_2 Reverse -387 -396 10.9145 0.0571
NP_442888.1_4 Forward -358 -339 30.4821 0.000456
NP_442888.1_8 Forward -331 -312 19.5673 0.0826
NP_441037.1_4 Forward -328 -318 7.51261 0.237
NP_441037.1_4 Forward -397 -387 7.22024 0.237
NP_440136.1_2 Forward -394 -387 6.23397 0.171
NP_440136.1_2 Reverse -387 -394 6.13563 0.193
NP_442590.1_10 Reverse -183 -202 3.73603 0.286
NP_442998.1_5 Forward -221 -211 14.0414 0.151
NP_442998.1_5 Reverse -226 -236 8.33817 0.264
NP_442998.1_10 Reverse -388 -395 15.5754 0.0102
NP_440899.1_2 Reverse -375 -394 5.70185 0.275
NP_440899.1_8 Reverse -201 -220 -7.27704 0.244
NP_440299.1_1 Forward -399 -386 7.68852 0.107
NP_440299.1_1 Reverse -313 -326 4.44361 0.207
NP_441799.1_1 Reverse -382 -396 8.94708 0.103
NP_441007.1_10 Reverse -377 -390 0.314277 0.233
NP_442334.1_2 Forward -297 -280 -5.1727 0.2
NP_442201.1_10 Forward -103 -84 -14.9469 0.295
NP_442333.2_1 Reverse -315 -334 -8.55534 0.258
NP_441559.1_8 Reverse -324 -338 -4.22864 0.219
NP_441559.1_8 Forward -332 -318 -6.49025 0.279
NP_441559.1_8 Reverse -226 -240 -6.78525 0.279
NP_440915.1_6 Forward -399 -385 5.50613 0.0898
NP_440717.1_3 Reverse -335 -349 7.47213 0.28
NP_440748.1_5 Reverse -301 -320 -1.57384 0.267
NP_441494.1_6 Reverse -12 -25 6.90245 0.272
NP_442386.1_9 Forward -396 -387 5.9975 0.23
NP_442386.1_9 Reverse -184 -193 5.0142 0.27
NP_441340.1_5 Forward -394 -387 6.23397 0.132
NP_441340.1_5 Reverse -387 -394 5.84064 0.208
NP_441947.1_4 Reverse -375 -394 16.3224 0.131
NP_440327.1_6 Forward -385 -366 2.16274 0.299
NP_441248.1_10 Forward -114 -104 15.1965 0.277
NP_441132.1_2 Forward -268 -249 9.3409 0.163
NP_440586.1_8 Forward -394 -387 14.69 0.026
NP_442251.1_6 Reverse -387 -394 12.0355 0.0627
NP_442959.1_4 Reverse -212 -231 9.24257 0.216
NP_440969.1_3 Reverse -340 -358 8.17984 0.278
NP_440684.1_9 Forward -325 -311 6.58777 0.298
NP_441262.1_3 Forward -395 -388 14.7888 0.0223
NP_441262.1_3 Forward -370 -363 5.44732 0.11
NP_441262.1_3 Reverse -382 -389 5.15232 0.265
NP_443051.1_1 Forward -396 -387 0.884706 0.125
NP_443051.1_1 Reverse -385 -394 -1.08191 0.281
NP_439937.1_8 Forward -397 -378 4.52268 0.2
NP_439937.1_9 Reverse -345 -362 -9.10659 0.181
NP_440439.1_1 Forward -398 -385 2.87088 0.124
NP_440372.1_2 Forward -394 -387 6.82395 0.0854
NP_440372.1_2 Reverse -387 -394 6.52896 0.188
NP_440316.1_10 Forward -195 -185 6.96153 0.251
NP_440316.1_10 Forward -356 -346 5.48657 0.295
NP_441803.1_2 Forward -193 -174 -1.37718 0.298
NP_440139.1_1 Reverse -380 -399 0.981987 0.275
NP_442384.1_10 Forward -199 -186 1.49425 0.257
NP_442384.1_10 Reverse -83 -96 1.00259 0.271
NP_442114.1_4 Reverse -386 -397 10.3834 0.17
NP_442114.1_4 Reverse -361 -372 10.2851 0.17
NP_441877.1_5 Reverse -208 -227 -0.4922 0.276
NP_442262.1_10 Forward -394 -387 12.9205 0.0422
NP_442262.1_10 Reverse -383 -390 9.38056 0.202
NP_441689.1_5 Reverse -384 -394 8.3377 0.132
NP_440163.1_10 Forward -323 -313 10.1081 0.206
NP_440282.1_10 Reverse -376 -395 -8.65367 0.263
NP_441965.1_10 Forward -398 -382 3.20513 0.271
NP_440297.1_9 Forward -394 -384 0.766681 0.282
NP_439926.1_6 Forward -157 -146 17.6594 0.277
NP_440298.1_6 Forward -192 -178 16.8135 0.251
NP_441592.1_4 Forward -158 -139 -2.26216 0.261
NP_440894.1_10 Forward -272 -253 6.39097 0.215
NP_440937.1_5 Forward -320 -301 10.3242 0.275
NP_443036.1_1 Reverse -181 -200 9.83173 0.269
NP_440999.1_9 Reverse -313 -327 6.3911 0.0979
NP_440999.1_9 Forward -399 -385 1.86788 0.157
NP_440888.1_2 Reverse -386 -400 7.86545 0.179
NP_440888.1_2 Reverse -17 -31 5.1122 0.293
NP_440179.1_6 Forward -193 -174 3.14605 0.28
NP_440491.1_1 Forward -358 -339 8.86616 0.226
NP_439969.1_9 Reverse -227 -239 16.1653 0.254
NP_442277.1_4 Reverse -308 -327 12.9783 0.0601
NP_440575.1_3 Forward -369 -350 20.1573 0.18
NP_442077.1_9 Reverse -126 -145 -6.58872 0.29
NP_441543.1_2 Reverse -387 -396 8.65285 0.0968
NP_441543.1_2 Forward -394 -385 4.42462 0.246
NP_441551.1_5 Reverse -181 -197 8.31764 0.238
NP_441469.1_4 Reverse -152 -171 7.17762 0.282
NP_441469.1_8 Forward -396 -387 6.39124 0.227
NP_443064.1_6 Reverse -83 -93 9.65817 0.205
NP_442578.1_7 Forward -394 -387 14.6904 0.026
NP_440071.1_1 Reverse -363 -380 13.9027 0.223
NP_441462.1_2 Forward -395 -385 9.81313 0.0143
NP_441621.1_7 Reverse -141 -155 -4.32697 0.219
NP_443062.1_1 Forward -391 -373 7.08331 0.185
NP_441601.1_3 Reverse -366 -385 21.8289 0.0459
NP_440504.1_7 Forward -32 -13 -3.04881 0.244
NP_441351.1_6 Forward -44 -25 23.4022 0.0426
NP_440454.1_2 Reverse -82 -96 13.3805 0.227
NP_440516.1_2 Forward -376 -358 -2.73412 0.299
NP_440516.1_6 Forward -19 -5 7.76712 0.268
NP_440516.1_8 Forward -395 -386 0.983037 0.13
NP_440516.1_8 Forward -355 -346 -0.68859 0.297
NP_442428.1_5 Forward -394 -387 6.13563 0.209
NP_442428.1_5 Reverse -387 -394 6.0373 0.212
NP_442120.1_10 Reverse -311 -330 -11.6036 0.264
NP_440673.1_3 Reverse -388 -395 12.4288 0.0426
NP_440673.1_3 Forward -133 -126 9.08556 0.202
NP_441714.1_3 Reverse -76 -94 13.883 0.204
NP_442219.1_8 Reverse -79 -98 7.00751 0.28
NP_440436.1_4 Reverse -387 -396 8.55409 0.0997
NP_440436.1_4 Forward -394 -385 5.11253 0.222
NP_441884.1_9 Forward -398 -379 -14.5535 0.138
NP_441719.1_4 Forward -394 -387 13.5105 0.026
NP_441719.1_4 Reverse -387 -394 6.52896 0.188
NP_441719.1_4 Reverse -383 -390 3.77569 0.285
NP_441733.1_10 Forward -398 -385 16.6372 0.0423
NP_441004.1_1 Forward -332 -313 -11.9969 0.243
NP_441004.1_2 Reverse -187 -206 -2.26216 0.264
NP_441004.1_5 Reverse -342 -356 6.98109 0.295
NP_442366.1_3 Forward -315 -297 -1.06249 0.204
NP_442366.1_10 Forward -189 -177 20.5902 0.0795
NP_439949.1_7 Forward -344 -330 11.111 0.291
NP_442694.1_3 Reverse -175 -193 -4.01242 0.265
NP_443054.1_2 Reverse -384 -398 4.62115 0.24
NP_443054.1_2 Reverse -174 -188 -0.000409212 0.283
NP_441966.1_7 Reverse -289 -308 -0.886293 0.268
NP_441966.1_8 Forward -332 -314 -0.964162 0.198
NP_441851.1_10 Forward -396 -386 13.2547 0.0333
NP_442814.1_2 Reverse -206 -225 4.32602 0.294
NP_440593.1_3 Reverse -312 -331 -6.1954 0.271
NP_442689.1_8 Forward -87 -70 -1.33779 0.213
NP_441051.1_1 Forward -319 -309 17.9746 0.292
NP_440389.1_3 Forward -167 -148 15.9291 0.176
NP_442843.1_1 Forward -225 -206 -3.44213 0.222
NP_442843.1_1 Forward -246 -227 -9.83364 0.271
NP_442843.1_1 Reverse -378 -397 -9.93197 0.272
NP_442843.1_1 Forward -292 -273 -11.2103 0.286
NP_440396.1_1 Reverse -180 -199 -5.60541 0.272
NP_442450.1_5 Reverse -384 -394 8.53483 0.13
NP_441031.1_8 Forward -391 -372 -5.11376 0.268
NP_440483.1_1 Reverse -184 -203 -7.4737 0.265
NP_441078.1_4 Forward -326 -317 6.09625 0.0863
NP_441078.1_4 Reverse -386 -395 0.0980582 0.205
NP_441078.1_4 Forward -395 -386 0.0980582 0.205
NP_441078.1_4 Reverse -317 -326 -1.86856 0.272
NP_442348.1_2 Reverse -17 -26 7.17789 0.285
NP_440526.1_3 Reverse -387 -398 2.12315 0.267
NP_441432.1_8 Forward -314 -305 2.65466 0.292
NP_441333.1_1 Forward -64 -54 12.9245 0.217
NP_441732.1_2 Forward -330 -314 -16.5594 0.174
NP_440313.1_1 Reverse -216 -235 18.7807 0.162
NP_440760.1_9 Forward -273 -254 8.94757 0.277
NP_442407.1_2 Forward -385 -366 9.43841 0.25
NP_442400.1_10 Forward -216 -203 8.46506 0.278
NP_442489.1_7 Reverse -386 -395 7.57121 0.057
NP_442489.1_7 Forward -395 -386 0.589713 0.17
NP_442489.1_7 Forward -326 -317 -1.6719 0.235
NP_440559.1_1 Forward -394 -385 14.356 0.0209
NP_440559.1_1 Reverse -383 -392 4.62128 0.24
NP_441659.2_8 Forward -395 -385 0.176696 0.271
NP_441659.2_8 Reverse -386 -396 0.0783647 0.277
NP_441022.1_1 Forward -141 -132 11.0666 0.284
NP_441040.1_2 Reverse -181 -200 3.53937 0.119
NP_441040.1_2 Forward -375 -356 -9.53865 0.236
NP_442346.1_5 Reverse -385 -395 5.97822 0.219
NP_440352.1_5 Forward -231 -212 12.169 0.235
NP_440545.1_3 Forward -330 -313 -6.54933 0.283
NP_441653.1_2 Reverse -178 -197 2.94981 0.28
NP_440847.1_8 Reverse -212 -231 13.0775 0.273
NP_441050.1_5 Forward -291 -273 7.88563 0.181
NP_440449.1_6 Reverse -309 -327 6.69963 0.241
NP_441047.1_2 Forward -157 -138 0.491109 0.239
NP_441833.1_4 Reverse -387 -394 6.52896 0.0924
NP_441833.1_4 Forward -394 -387 6.23397 0.163
NP_441833.1_4 Reverse -362 -369 4.56234 0.248
NP_441895.1_10 Forward -54 -35 -27.7299 0.29
NP_442162.1_9 Forward -394 -387 6.62729 0.142
NP_442162.1_9 Reverse -387 -394 6.52896 0.178
NP_441973.1_1 Reverse -215 -230 0.27489 0.235
NP_442943.1_1 Reverse -72 -87 4.54118 0.231
NP_442140.1_3 Reverse -387 -397 7.94484 0.124
NP_442140.1_3 Forward -193 -183 4.89658 0.238
NP_440875.1_9 Reverse -388 -398 17.619 0.0104
NP_440875.1_9 Reverse -307 -317 8.76138 0.233
NP_440875.1_9 Reverse -187 -197 7.78801 0.255
NP_441813.1_5 Reverse -384 -394 5.68323 0.113
NP_441813.1_5 Forward -397 -387 0.275027 0.206
NP_441813.1_5 Forward -372 -362 -0.609952 0.261
NP_439901.1_1 Reverse -369 -388 1.76941 0.289
NP_441259.1_2 Reverse -144 -163 23.3039 0.0366
NP_440590.1_4 Reverse -387 -400 14.0806 0.0112
NP_440590.1_4 Reverse -84 -97 -4.50394 0.262
NP_440567.1_1 Forward -394 -380 2.16287 0.182
NP_442497.1_10 Forward -394 -385 8.25953 0.047
NP_442497.1_10 Reverse -387 -396 0.589713 0.153
NP_440821.1_4 Forward -397 -387 9.02648 0.0364
NP_440821.1_4 Reverse -384 -394 1.25834 0.139
NP_441239.1_5 Forward -334 -315 17.8026 0.264
NP_441239.1_9 Forward -397 -385 5.74217 0.21
NP_441239.1_9 Forward -321 -309 3.87389 0.272
NP_441239.1_9 Forward -196 -184 3.57889 0.283
NP_441239.1_9 Reverse -384 -396 3.38223 0.285
NP_441009.1_4 Forward -391 -372 12.1925 0.243
NP_440400.1_1 Reverse -373 -392 -2.36125 0.285
NP_440665.1_1 Forward -392 -373 -15.9302 0.275
NP_440665.1_2 Forward -334 -315 -5.70374 0.247
NP_442193.1_1 Forward -314 -296 9.65558 0.233
NP_440833.1_6 Forward -220 -206 14.0603 0.157
NP_442216.1_4 Reverse -334 -342 8.08217 0.255
NP_441617.1_6 Forward -99 -80 -1.67217 0.258
NP_442052.1_8 Forward -201 -191 13.648 0.253
NP_440546.1_4 Forward -194 -184 7.52511 0.235
NP_440546.1_4 Forward -395 -385 6.45857 0.296
NP_440462.1_6 Forward -397 -387 14.7297 0.0186
NP_440462.1_6 Forward -34 -24 1.455 0.294
NP_440868.1_4 Reverse -382 -394 1.51394 0.181
NP_441204.1_7 Forward -369 -350 15.8307 0.0988
NP_441497.1_3 Forward -227 -208 -11.2103 0.294
NP_440638.2_3 Forward -208 -189 13.1758 0.153
NP_441672.1_6 Reverse -283 -302 17.1082 0.088
NP_442402.1_4 Reverse -215 -234 -4.52452 0.226
NP_441084.1_6 Forward -196 -182 12.7376 0.155
NP_439942.1_2 Reverse -57 -76 12.2108 0.271
NP_440696.1_3 Reverse -382 -400 -1.35749 0.257
NP_442039.1_7 Forward -192 -182 14.533 0.211
NP_442039.1_7 Forward -224 -214 10.4031 0.257
NP_441811.1_8 Forward -343 -329 7.47274 0.243
NP_441811.1_8 Reverse -380 -394 7.27608 0.251
NP_442679.1_1 Reverse -260 -279 -2.75381 0.242
NP_442696.1_6 Reverse -352 -371 -11.9969 0.244
NP_442786.1_2 Reverse -45 -64 13.7982 0.157
NP_442837.1_3 Reverse -387 -394 12.1338 0.0702
NP_442837.1_3 Forward -394 -387 6.0373 0.25
NP_439994.1_3 Forward -396 -377 10.8773 0.202
NP_442053.1_1 Reverse -386 -395 6.8829 0.111
NP_440505.1_3 Forward -397 -387 5.28991 0.236
NP_440505.1_7 Forward -330 -311 -2.16383 0.289
NP_441701.1_3 Forward -317 -300 6.03703 0.294
NP_441777.1_4 Reverse -83 -102 13.7292 0.259
NP_442255.1_3 Reverse -321 -340 11.0125 0.208
NP_440914.1_1 Reverse -299 -309 6.27291 0.288
NP_441011.1_8 Reverse -387 -396 7.07956 0.179
NP_441011.1_8 Forward -394 -385 5.99792 0.208
NP_442533.1_1 Forward -305 -286 -14.0619 0.239
NP_442533.1_6 Forward -395 -386 5.40793 0.14
NP_442533.1_6 Reverse -185 -194 1.96635 0.28
NP_442541.1_10 Reverse -304 -318 4.12889 0.252
NP_442232.1_3 Forward -202 -183 -10.1286 0.266
NP_442232.1_3 Reverse -378 -397 -15.9302 0.299
NP_439944.1_9 Forward -394 -384 6.37155 0.184
NP_442203.1_3 Forward -144 -125 17.9016 0.0779
NP_440816.1_7 Forward -399 -380 10.3242 0.241
NP_441028.1_6 Forward -279 -269 5.19112 0.265
NP_441028.1_6 Reverse -98 -108 3.51951 0.292
NP_440007.1_9 Forward -358 -344 0.786239 0.29
NP_440007.1_9 Forward -323 -309 0.786239 0.29
NP_439965.1_7 Forward -269 -250 10.6116 0.294
NP_441170.1_2 Forward -333 -314 3.53937 0.213
NP_441106.1_1 Reverse -360 -369 11.5045 0.0311
NP_441106.1_1 Forward -396 -387 8.45619 0.0548
NP_439903.1_6 Reverse -80 -99 4.62021 0.193
NP_442306.1_10 Forward -169 -150 -20.65 0.219
NP_441286.1_1 Forward -396 -384 -4.28759 0.154
NP_442463.1_3 Forward -206 -187 13.1758 0.275
NP_441930.1_2 Forward -327 -317 11.5831 0.285
NP_440886.1_7 Reverse -316 -326 5.87944 0.158
NP_442614.1_2 Forward -188 -174 6.58777 0.291
NP_442072.1_9 Forward -327 -309 -3.81576 0.0388
NP_442401.1_2 Forward -178 -159 8.06178 0.254
NP_440907.2_8 Reverse -387 -397 8.04271 0.117
NP_441021.1_5 Reverse -186 -205 19.764 0.229
NP_441463.1_3 Forward -384 -365 -5.70374 0.232
NP_441463.1_6 Forward -28 -14 13.6635 0.18
NP_441626.1_2 Forward -394 -387 6.13563 0.177
NP_441626.1_2 Reverse -387 -394 5.93897 0.231
NP_442211.1_3 Forward -319 -300 7.76379 0.275
NP_440107.1_5 Forward -201 -182 -5.40875 0.21
NP_442794.1_1 Forward -330 -318 6.1355 0.192
NP_442794.1_1 Reverse -342 -354 6.03717 0.198
NP_441962.1_4 Reverse -353 -372 -14.7502 0.293
NP_440387.1_1 Forward -395 -379 -4.75968 0.198
NP_441431.1_2 Reverse -314 -328 10.422 0.159
NP_441431.1_2 Forward -197 -183 6.29216 0.275
NP_441488.1_7 Reverse -376 -395 5.60432 0.157
NP_441488.1_7 Reverse -171 -190 0.491109 0.296
NP_441836.1_2 Reverse -215 -234 0.982764 0.197
NP_441836.1_2 Forward -376 -357 -4.81876 0.264
NP_441836.1_2 Reverse -173 -192 -5.40875 0.279
NP_441993.1_1 Forward -380 -361 9.15853 0.136
NP_441993.1_1 Reverse -191 -210 6.0399 0.188
NP_441993.1_1 Forward -164 -145 4.28566 0.222
NP_441993.1_1 Forward -326 -307 2.92126 0.246
NP_441174.1_2 Forward -197 -183 14.2576 0.172
NP_440082.1_7 Reverse -199 -218 17.7878 0.23
NP_440287.1_5 Reverse -280 -299 13.5683 0.206
NP_440766.1_4 Forward -399 -385 9.73436 0.0871
NP_440643.1_2 Forward -188 -169 1.0811 0.298
NP_442867.1_3 Forward -74 -55 6.58763 0.193
NP_442867.1_8 Forward -372 -353 7.07928 0.247
NP_440457.1_1 Forward -399 -387 5.05386 0.149
NP_440987.1_6 Reverse -68 -87 12.4475 0.247
NP_440798.1_1 Reverse -93 -111 10.5418 0.294
NP_440801.1_8 Forward -227 -208 0.982764 0.246
NP_441984.1_3 Forward -165 -147 7.78729 0.239
NP_441253.1_8 Forward -204 -190 10.2813 0.288
YP_003858595.1_1 Forward -190 -171 9.14423 0.188
NP_440554.1_4 Reverse -387 -397 4.3066 0.195
NP_441885.1_5 Forward -395 -385 0.668351 0.133
NP_441885.1_5 Forward -355 -345 -1.59326 0.273
NP_440478.1_10 Forward -372 -358 6.98109 0.279
NP_440478.1_10 Forward -160 -146 6.6861 0.288
NP_440478.1_10 Reverse -219 -233 6.6861 0.288
NP_441614.1_10 Reverse -305 -319 19.2725 0.16
NP_442341.1_7 Reverse -385 -399 11.701 0.052
NP_442341.1_7 Reverse -316 -330 8.94771 0.0801
NP_442341.1_9 Reverse -308 -322 13.372 0.083
NP_441173.1_9 Reverse -87 -95 9.75379 0.284
NP_440275.1_3 Forward -397 -387 8.4365 0.0602
NP_440275.1_3 Reverse -359 -369 3.71661 0.215
NP_440091.1_1 Forward -399 -387 2.89058 0.181
NP_443010.1_10 Forward -398 -381 11.1779 0.115
NP_441359.1_5 Reverse -150 -169 0.196116 0.299
NP_442451.1_2 Forward -193 -174 -9.24366 0.259
NP_442451.1_2 Forward -34 -15 -10.4236 0.269
NP_441207.1_7 Reverse -59 -73 8.28727 0.29
NP_439962.1_4 Reverse -353 -372 -0.000545616 0.197
NP_439962.1_4 Reverse -181 -200 -6.88371 0.285
NP_441105.1_3 Forward -205 -186 -5.21209 0.214
NP_442127.1_1 Reverse -109 -127 6.01657 0.286
NP_440216.1_1 Reverse -382 -396 -11.6035 0.203
NP_440216.1_6 Reverse -310 -326 8.61333 0.14
NP_440172.1_1 Forward -395 -385 8.82982 0.0586
NP_442015.1_10 Forward -330 -317 -0.865694 0.285
NP_441111.1_7 Reverse -387 -395 8.86921 0.0589
NP_441766.1_2 Forward -395 -386 8.1612 0.0645
NP_441766.1_2 Forward -370 -361 3.53964 0.212
NP_443052.1_9 Forward -179 -160 -0.590531 0.213
NP_443052.1_9 Reverse -354 -373 -2.0655 0.233
NP_440845.1_1 Forward -342 -323 -5.60541 0.278
NP_442154.1_1 Forward -327 -309 -18.1721 0.278
NP_440261.1_5 Forward -394 -381 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCAGCGGCGATCGATCTCATCGATGTGGCCTGCGGTCGTTTGGACGGCTATTGGGAAAGGGGGATTAATCCCTGGGATATGGCCGCTGGCATTGTCATTGTGCGGGAAGCAGGGGGAATAGTTTCCGCCTATGATTGTTCTCCTCTGGATCTAAGCACTGGGCGCATTCTGGCCACCAATGGGAAAATTCACCAGGAACTGAGCCAAGCCCTGGCGGCAACTCCCCAATGGTTCCAGCAGTACGCCGCCGCTAGAGCACAAAAAATTTGATTGCTTTGGTGCTCAAGAGAAATTAGGGGTCAAGCTTTGGTGAACGTTTCTAACAATTTGAGAGTATTTTTCTCTTTCTGAGGAATAATGGAGTAGAAAGGGATAGAAATGCCCCCCTCCCGTAATTTTT

CDS

ATGAGCTCGTTTCCCATCAAGCAAGGACTGTTTAATTATGACGTAGTTGACCACCACGCCATTCTTGGCTGTCCTCTGGATGCGACTCCCGAAGAAATTCGTAAAAGTTATCTCAAGATTGCTTTCCAACTACACCCCGACACATCAAAAGCTACCAACGAAGAAGAGCAAGCCTTAGCAGCAAAACTTTTCTCCAAGTTTGTTAACCCGGCCTATGAAGTTTTAAGCCGAGAGAACGACCGTAAAGAACACTTGCTTATCATCCAGCAGACAGTGAGCAACTTAGCTAGCATAGGGCAACCGAGCTTTAGCAGTGCAGAGTCCCAGAAACTCCAGGGAGCAAAGCAAAATTTGGAATTGGTTTACCGCAAGGTGGTCACCCCCCTGAGCAAAGGGCTTTACGAAGACTTTAAAACGGTTTTTCGCAAGATTGCCCAAGTGAGCGAATACAATCTGATTTTTTTGATGGTGAAAGGGGAAAATGCTTCTGCCCGCCCTGTGTTCCAAACTATTGCGTCTTCAAAAGAAACGGTTCCTCCCGTGGTTTCAGGACGATCGCCCCAGGGCCCAACCCCAACCCCTCCCATCAATAATCCCCCGGCGGAAGAACTTTCTCCCTTTGAAAAGAGTTTACGGCGAGCCCAGGAAAACTTTGATCGTCGGCAATATGAGAAGGCCATTGCCGAATTGAAATCTGCCCTGAAAACCGACCCCAAAAATGCCCAGGCTCATTGTTTATTGGGCATGGCCTATCTAAAGAACAACATGATGACCATGGCCAAGGTTCACATTGGCTCAGCAGTGAAGTTAGACCCCAATGACCCTAAAGTGATGGCGGCGAAAAAAGAATTGGCCAAGCACACTAGTTCCGGCAGTAGTCAGGAGGGAGCCAAGTCCAGCCAAGGGGGATTTTTGGGCGGGTTATTCGGGGGCAAAAAGAAATAA

Protein

MSSFPIKQGLFNYDVVDHHAILGCPLDATPEEIRKSYLKIAFQLHPDTSKATNEEEQALAAKLFSKFVNPAYEVLSRENDRKEHLLIIQQTVSNLASIGQPSFSSAESQKLQGAKQNLELVYRKVVTPLSKGLYEDFKTVFRKIAQVSEYNLIFLMVKGENASARPVFQTIASSKETVPPVVSGRSPQGPTPTPPINNPPAEELSPFEKSLRRAQENFDRRQYEKAIAELKSALKTDPKNAQAHCLLGMAYLKNNMMTMAKVHIGSAVKLDPNDPKVMAAKKELAKHTSSGSSQEGAKSSQGGFLGGLFGGKKK