Your browser is old and dusty. Try Google Chrome!

Details for sll1380

ORF sll1380
Accession NP_441571.1
Symbol
Category periplasmic protein, function unknown
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -136 -129 14.6904 0.0123
NP_440795.1_7 Reverse -129 -136 14.6904 0.0123
NP_441418.1_6 Reverse -128 -147 -13.0786 0.073
NP_441418.1_6 Reverse -205 -224 -20.1584 0.106
NP_442291.1_5 Forward -138 -122 -2.10475 0.21
NP_441453.1_4 Reverse -128 -136 16.539 0.00633
NP_441453.1_4 Forward -137 -129 16.539 0.00633
NP_441453.1_7 Reverse -149 -156 14.1988 0.175
NP_441453.1_7 Forward -355 -348 11.9372 0.298
NP_442151.1_6 Reverse -128 -142 14.1593 0.0395
NP_442151.1_6 Forward -214 -200 8.84938 0.164
NP_442151.1_6 Forward -137 -123 8.55439 0.171
NP_441818.1_1 Forward -136 -125 18.446 0.0046
NP_441818.1_1 Reverse -129 -140 14.0211 0.0577
NP_440226.1_1 Forward -137 -118 10.4225 0.0622
NP_440226.1_1 Reverse -128 -147 5.211 0.163
NP_441630.1_3 Reverse -120 -139 9.53756 0.0975
NP_440120.1_4 Reverse -350 -364 14.2576 0.273
NP_442173.1_1 Forward -136 -128 15.4574 0.00633
NP_442173.1_1 Reverse -129 -137 15.4574 0.00633
NP_442173.1_1 Reverse -255 -263 6.01761 0.2
NP_442752.1_4 Forward -137 -130 13.8055 0.0199
NP_442752.1_4 Reverse -128 -135 13.8055 0.0199
NP_443027.1_4 Reverse -126 -136 11.0914 0.107
NP_443027.1_4 Forward -139 -129 6.46988 0.275
NP_441812.1_3 Reverse -127 -141 6.78443 0.291
NP_442975.1_10 Forward -167 -153 3.8339 0.252
NP_442975.1_10 Forward -141 -127 3.04726 0.263
NP_441675.1_4 Forward -376 -357 11.0125 0.182
NP_440784.1_7 Forward -136 -129 15.9687 0.0123
NP_440784.1_7 Reverse -129 -136 15.9687 0.0123
NP_442909.1_7 Reverse -129 -143 11.012 0.131
NP_440061.1_9 Reverse -126 -140 23.5983 0.000985
NP_440061.1_9 Reverse -159 -173 8.06211 0.183
NP_440061.1_9 Reverse -287 -301 5.60385 0.279
NP_441054.1_4 Forward -147 -129 10.3439 0.0619
NP_442062.1_8 Reverse -128 -138 17.6796 0.00193
NP_442062.1_8 Forward -137 -127 17.3846 0.00193
NP_441859.1_3 Reverse -127 -146 14.6499 0.0704
NP_442972.1_1 Reverse -15 -33 6.8091 0.291
NP_440304.1_4 Forward -139 -129 17.9746 0.00654
NP_440304.1_4 Reverse -203 -213 6.56821 0.15
NP_440304.1_4 Reverse -193 -203 5.68323 0.196
NP_440304.1_4 Reverse -183 -193 5.68323 0.196
NP_440304.1_4 Reverse -126 -136 1.84832 0.299
NP_442242.1_4 Forward -136 -129 14.3954 0.0124
NP_442242.1_4 Reverse -129 -136 14.3954 0.0124
NP_442602.1_3 Reverse -196 -215 8.94757 0.0877
NP_441200.1_4 Forward -157 -138 11.4058 0.172
NP_441208.1_9 Forward -140 -126 7.47274 0.221
NP_440132.1_1 Forward -180 -162 9.55725 0.234
NP_441083.1_5 Forward -137 -127 20.3345 0.00053
NP_441083.1_5 Reverse -128 -138 19.3512 0.000718
NP_441571.1_1 Forward -393 -374 33.727 0.0000396
NP_441571.1_2 Forward -360 -341 33.2353 0.0000554
NP_441571.1_3 Forward -132 -113 18.9773 0.0173
NP_441571.1_4 Forward -315 -296 20.944 0.0188
NP_441571.1_5 Forward -246 -227 31.7604 0.000216
NP_441571.1_6 Forward -339 -320 19.8623 0.0647
NP_441571.1_7 Forward -291 -272 23.7947 0.0201
NP_441571.1_9 Forward -270 -251 17.5015 0.223
NP_441738.1_2 Forward -135 -128 15.28 0.0102
NP_441738.1_2 Reverse -130 -137 15.28 0.0102
NP_441558.1_5 Reverse -126 -145 10.5209 0.0968
NP_441558.1_5 Forward -139 -120 7.47261 0.18
NP_440209.1_1 Reverse -128 -136 18.1123 0.00295
NP_440209.1_1 Forward -137 -129 18.1123 0.00295
NP_440870.1_4 Forward -310 -292 2.0841 0.217
NP_440447.1_6 Forward -145 -127 5.72234 0.145
NP_441713.1_1 Forward -143 -124 -12.7836 0.248
NP_440178.1_7 Forward -138 -119 -4.22878 0.0548
NP_440178.1_7 Reverse -127 -146 -19.4701 0.176
NP_442570.1_3 Forward -155 -136 -5.80207 0.25
NP_441716.1_1 Reverse -128 -142 11.8976 0.0888
NP_441716.1_1 Forward -137 -123 11.2093 0.0936
NP_441716.1_1 Reverse -205 -219 6.09611 0.207
NP_442111.1_4 Reverse -127 -141 10.521 0.0535
NP_441163.1_7 Reverse -379 -398 17.404 0.204
NP_440906.1_5 Forward -136 -129 15.8704 0.0124
NP_440906.1_5 Reverse -129 -136 15.8704 0.0124
NP_440747.1_10 Reverse -125 -137 16.8536 0.00143
NP_440747.1_10 Forward -140 -128 -1.92764 0.0192
NP_440747.1_10 Forward -217 -205 -12.2524 0.254
NP_440747.1_10 Reverse -151 -163 -12.2524 0.254
NP_441130.1_10 Forward -139 -125 16.5192 0.0231
NP_441130.1_10 Reverse -126 -140 15.8309 0.0282
NP_441486.1_1 Reverse -125 -139 6.09611 0.0344
NP_441486.1_1 Forward -140 -126 -3.04867 0.175
NP_442634.1_4 Reverse -126 -140 -3.44199 0.161
NP_442634.1_4 Forward -139 -125 -4.81863 0.22
NP_440403.1_4 Reverse -119 -138 -5.70374 0.22
NP_441014.1_10 Forward -215 -196 15.2399 0.0655
NP_442848.1_1 Forward -143 -129 -1.77037 0.263
NP_441012.1_4 Forward -218 -205 6.01747 0.286
NP_443018.1_3 Forward -136 -129 14.8871 0.0123
NP_443018.1_3 Reverse -129 -136 14.8871 0.0123
NP_441634.1_8 Reverse -126 -140 15.4376 0.0248
NP_441634.1_8 Reverse -209 -223 2.16287 0.17
NP_440376.1_1 Forward -137 -128 19.4693 0.000692
NP_440376.1_1 Reverse -128 -137 19.4693 0.000692
NP_440376.1_1 Reverse -154 -163 1.47469 0.251
NP_440376.1_1 Forward -166 -157 -1.27858 0.297
NP_441857.1_5 Forward -144 -126 5.52568 0.2
NP_441588.1_4 Forward -135 -125 8.73149 0.14
NP_442687.1_7 Forward -138 -128 18.5646 0.0028
NP_442687.1_7 Reverse -21 -31 12.0747 0.0862
NP_442687.1_7 Reverse -127 -137 8.92815 0.0994
NP_442687.1_7 Forward -46 -36 8.4365 0.107
NP_442191.1_4 Reverse -255 -269 11.0901 0.271
NP_442485.1_3 Forward -225 -206 2.45773 0.209
NP_440642.1_10 Forward -113 -99 2.16228 0.283
NP_440042.1_2 Forward -147 -128 -5.31042 0.296
NP_441422.1_7 Reverse -126 -143 -3.30441 0.233
NP_440360.1_10 Reverse -130 -144 7.9644 0.227
NP_442658.1_1 Forward -139 -129 17.6791 0.00565
NP_442658.1_1 Reverse -126 -136 7.94438 0.199
NP_440141.1_8 Forward -146 -127 10.0292 0.211
NP_442205.1_9 Forward -143 -127 3.79511 0.174
NP_441414.1_9 Forward -137 -118 -3.44213 0.136
NP_441414.1_9 Reverse -128 -147 -4.72043 0.161
NP_441487.1_9 Forward -138 -119 9.83255 0.0936
NP_441256.1_1 Reverse -292 -311 -8.16202 0.242
NP_442937.1_5 Reverse -123 -142 9.93088 0.177
NP_441958.1_5 Forward -138 -128 20.5312 0.000966
NP_441958.1_5 Reverse -127 -137 12.2714 0.00183
NP_442836.1_5 Forward -143 -124 23.2056 0.0122
NP_440203.1_5 Reverse -131 -141 10.4026 0.225
NP_439905.1_1 Reverse -129 -142 17.8172 0.0359
NP_440984.1_7 Forward -142 -128 12.1926 0.122
NP_440984.1_7 Reverse -152 -166 8.45605 0.144
NP_440984.1_7 Reverse -123 -137 5.50613 0.252
NP_439990.1_5 Reverse -123 -136 12.5073 0.11
NP_442376.1_2 Forward -142 -123 -13.3736 0.292
NP_442690.1_1 Forward -34 -15 -5.40875 0.157
NP_442911.1_2 Forward -147 -128 12.1925 0.0129
NP_441580.1_6 Reverse -133 -152 -3.14714 0.235
NP_442571.1_1 Forward -55 -36 3.04771 0.237
NP_442064.1_4 Forward -224 -205 5.60352 0.267
NP_442536.1_4 Forward -143 -125 9.0656 0.299
NP_440993.1_4 Reverse -205 -222 3.38209 0.289
NP_441099.1_5 Reverse -118 -137 -3.73712 0.138
NP_441099.1_5 Forward -147 -128 -7.37537 0.174
NP_442002.1_9 Forward -138 -131 14.1004 0.074
NP_440809.1_9 Forward -146 -128 -6.76569 0.225
NP_442598.1_2 Reverse -371 -380 16.5193 0.252
NP_441294.1_7 Reverse -124 -138 13.2821 0.0711
NP_441294.1_7 Forward -141 -127 10.1145 0.207
NP_441646.1_1 Forward -144 -125 1.47442 0.231
NP_440879.1_6 Reverse -80 -99 3.34271 0.231
NP_441000.1_6 Forward -138 -124 14.3559 0.0396
NP_440147.1_4 Reverse -126 -139 18.4072 0.00407
NP_440147.1_4 Forward -139 -126 11.6223 0.0326
NP_440147.1_4 Reverse -379 -392 6.21414 0.0999
NP_441550.1_8 Forward -139 -129 19.8424 0.00352
NP_441550.1_8 Reverse -126 -136 15.1225 0.0132
NP_441916.1_7 Reverse -128 -138 16.893 0.00407
NP_441916.1_7 Forward -137 -127 10.3048 0.0261
NP_441041.1_4 Forward -137 -118 -0.0988766 0.0928
NP_441041.1_4 Reverse -205 -224 -11.3086 0.244
NP_441041.1_4 Reverse -254 -273 -13.7669 0.295
NP_441041.1_7 Forward -140 -128 12.568 0.0611
NP_441041.1_7 Reverse -125 -137 10.8188 0.0864
NP_443063.1_7 Reverse -204 -220 9.30165 0.224
NP_442004.1_6 Reverse -128 -142 8.06273 0.149
NP_441725.1_5 Reverse -129 -139 18.7612 0.0119
NP_441725.1_5 Forward -136 -126 2.04498 0.115
NP_441725.1_5 Forward -30 -20 0.275027 0.192
NP_439966.1_7 Reverse -126 -136 15.3192 0.0152
NP_439966.1_7 Forward -139 -129 8.14104 0.14
NP_439966.1_9 Forward -139 -130 0.983037 0.253
NP_440202.1_8 Reverse -119 -138 12.3352 0.272
NP_442941.1_3 Forward -136 -126 19.2529 0.00262
NP_442941.1_3 Reverse -129 -139 2.43831 0.14
NP_440289.1_2 Reverse -125 -138 15.4572 0.0107
NP_440289.1_2 Forward -140 -127 11.524 0.0191
NP_440983.1_5 Reverse -292 -311 -1.57384 0.228
NP_440260.1_8 Forward -223 -205 4.14905 0.154
NP_442281.1_1 Reverse -123 -137 8.75042 0.0764
NP_442256.1_2 Reverse -126 -144 -7.65067 0.214
NP_442256.1_2 Forward -139 -121 -9.12563 0.249
NP_440437.1_1 Reverse -122 -141 -3.04881 0.232
NP_441556.1_7 Reverse -337 -356 -1.08295 0.3
NP_441556.1_10 Forward -142 -128 13.7259 0.178
NP_440375.1_8 Forward -136 -117 0.884433 0.252
NP_443030.1_4 Reverse -198 -217 -5.99873 0.272
NP_441644.1_6 Forward -137 -127 17.3841 0.00127
NP_441644.1_6 Reverse -128 -138 15.7125 0.0048
NP_441644.1_6 Forward -214 -204 3.51951 0.277
NP_441644.1_6 Reverse -205 -215 3.12618 0.297
NP_442247.1_8 Reverse -126 -140 11.0127 0.247
NP_440253.1_2 Forward -137 -119 4.05072 0.107
NP_440929.1_8 Forward -137 -128 19.2726 0.000701
NP_440929.1_8 Reverse -128 -137 19.2726 0.000701
NP_442933.1_10 Forward -137 -128 17.601 0.00325
NP_442933.1_10 Reverse -128 -137 17.601 0.00325
NP_441751.2_8 Forward -136 -122 2.65453 0.0782
NP_441751.2_8 Reverse -129 -143 1.76955 0.0968
NP_441751.2_8 Reverse -382 -396 -5.9986 0.249
NP_442554.1_8 Reverse -129 -139 16.9913 0.0065
NP_442554.1_8 Forward -136 -126 16.2046 0.0065
NP_441762.1_7 Reverse -127 -139 2.59558 0.0676
NP_441762.1_7 Forward -138 -126 1.80894 0.0735
NP_442142.1_4 Reverse -125 -138 5.52525 0.188
NP_442142.1_4 Forward -140 -127 4.05029 0.234
NP_442142.1_4 Reverse -208 -221 2.57534 0.286
NP_442142.1_4 Forward -217 -204 2.47701 0.29
NP_442292.1_1 Forward -136 -127 18.486 0.00229
NP_442292.1_1 Reverse -129 -138 9.53783 0.0183
NP_442292.1_5 Forward -141 -122 -1.18052 0.257
NP_442476.1_6 Reverse -129 -143 11.8976 0.0525
NP_440895.1_6 Reverse -122 -135 10.1474 0.202
NP_443009.1_5 Reverse -127 -138 15.7911 0.0107
NP_443009.1_5 Forward -138 -127 11.1696 0.066
NP_443009.1_5 Forward -215 -204 4.8764 0.226
NP_441715.1_4 Forward -136 -126 17.3846 0.0106
NP_440881.1_5 Reverse -269 -288 12.9791 0.299
NP_441448.1_1 Reverse -212 -231 6.19431 0.251
NP_441448.1_6 Reverse -293 -312 14.3549 0.282
NP_442076.1_8 Reverse -146 -165 6.88262 0.262
NP_441198.1_8 Forward -139 -129 15.2245 0.0427
NP_441468.1_1 Forward -136 -129 15.8704 0.0124
NP_441468.1_1 Reverse -129 -136 15.8704 0.0124
NP_441015.1_10 Forward -303 -284 -8.06369 0.272
NP_441673.1_1 Forward -137 -128 20.8459 0.000698
NP_441673.1_1 Reverse -128 -137 20.8459 0.000698
NP_441826.1_2 Forward -220 -206 7.57108 0.0865
NP_441826.1_2 Forward -143 -129 1.76955 0.142
NP_442868.1_6 Reverse -126 -136 19.2529 0.00563
NP_442868.1_6 Forward -139 -129 16.7946 0.0131
NP_442719.1_2 Forward -30 -12 -11.4863 0.292
NP_441612.1_2 Forward -137 -127 8.54929 0.21
NP_442427.1_8 Forward -146 -127 13.2741 0.148
NP_442808.1_1 Forward -138 -128 8.73102 0.0481
NP_442808.1_1 Reverse -127 -137 8.63269 0.0481
NP_441101.1_10 Reverse -150 -169 -0.983855 0.192
NP_440145.1_3 Reverse -118 -137 22.0256 0.00634
NP_442542.1_2 Forward -139 -126 20.6688 0.00569
NP_442542.1_2 Forward -172 -159 6.21414 0.232
NP_442113.1_10 Reverse -291 -310 -7.08038 0.265
NP_442050.1_5 Forward -139 -129 14.9258 0.0175
NP_442050.1_5 Reverse -126 -136 14.3359 0.0206
NP_441114.1_3 Reverse -206 -215 7.66954 0.231
NP_440558.1_2 Forward -223 -204 0.786102 0.185
NP_440558.1_2 Reverse -154 -173 -7.27704 0.291
NP_441878.1_6 Forward -138 -128 20.2362 0.0046
NP_441878.1_6 Reverse -127 -137 10.4031 0.0176
NP_441878.1_6 Reverse -204 -214 -7.39479 0.222
NP_441036.1_8 Forward -138 -128 8.4365 0.174
NP_441036.1_8 Reverse -127 -137 8.33817 0.174
NP_441557.1_5 Forward -137 -128 19.9609 0.000699
NP_441557.1_5 Reverse -128 -137 19.9609 0.000699
NP_441445.1_1 Reverse -119 -138 14.5524 0.05
NP_441445.1_1 Forward -146 -127 11.3075 0.0863
NP_441445.1_1 Forward -307 -288 0.196116 0.281
NP_441445.1_1 Forward -187 -168 -0.197208 0.286
NP_442066.2_9 Reverse -124 -137 8.47575 0.185
NP_442919.1_3 Reverse -322 -341 11.1077 0.145
NP_442183.1_1 Reverse -128 -142 9.73436 0.094
NP_442183.1_1 Forward -31 -17 4.22782 0.271
NP_441549.1_9 Reverse -124 -142 -7.84733 0.214
NP_441549.1_9 Reverse -153 -171 -8.63398 0.234
NP_442347.1_2 Forward -136 -127 12.4878 0.056
NP_442347.1_2 Reverse -129 -138 3.34298 0.284
NP_442645.1_2 Reverse -120 -139 -22.125 0.29
NP_442888.1_9 Forward -220 -201 16.4207 0.171
NP_441037.1_4 Forward -139 -129 18.9151 0.00351
NP_441633.1_3 Reverse -126 -139 22.6354 0.00371
NP_440136.1_2 Forward -136 -129 15.9687 0.0123
NP_440136.1_2 Reverse -129 -136 15.9687 0.0123
NP_442998.1_5 Reverse -20 -30 9.32148 0.243
NP_442998.1_10 Forward -135 -128 15.5754 0.0102
NP_442998.1_10 Reverse -130 -137 15.5754 0.0102
NP_442998.1_10 Forward -202 -195 9.28223 0.117
NP_442998.1_10 Forward -192 -185 9.28223 0.117
NP_442998.1_10 Reverse -159 -166 3.97235 0.297
NP_440299.1_1 Forward -141 -128 6.50855 0.139
NP_440299.1_1 Reverse -124 -137 2.37867 0.291
NP_441799.1_1 Forward -141 -127 17.3052 0.011
NP_441799.1_1 Reverse -124 -138 4.71887 0.238
NP_441007.1_10 Forward -142 -129 11.7207 0.0599
NP_441007.1_10 Forward -303 -290 0.707601 0.219
NP_440256.1_1 Reverse -251 -270 -1.27885 0.102
NP_440256.1_1 Forward -217 -198 -5.9004 0.196
NP_440256.1_1 Reverse -125 -144 -8.26035 0.256
NP_441559.1_8 Reverse -149 -163 -5.70361 0.27
NP_441559.1_8 Reverse -123 -137 -5.70361 0.27
NP_441559.1_8 Forward -158 -144 -5.90027 0.271
NP_441559.1_8 Reverse -200 -214 -6.19526 0.275
NP_441559.1_8 Forward -142 -128 -6.68692 0.279
NP_441559.1_8 Forward -85 -71 -7.37523 0.291
NP_440915.1_6 Reverse -124 -138 9.5377 0.0406
NP_440915.1_6 Forward -141 -127 -2.16369 0.26
NP_442855.1_3 Forward -175 -156 13.8641 0.22
NP_441704.1_8 Forward -148 -129 7.4718 0.238
NP_441704.1_8 Reverse -174 -193 5.60352 0.284
NP_441464.1_8 Reverse -128 -142 18.9775 0.0644
NP_441494.1_6 Forward -142 -129 10.5407 0.225
NP_442993.1_1 Forward -137 -121 -8.0046 0.151
NP_442993.1_1 Forward -45 -29 -8.39793 0.166
NP_440677.1_1 Forward -146 -127 9.73422 0.181
NP_442386.1_9 Reverse -127 -136 13.8639 0.0289
NP_442386.1_9 Forward -138 -129 6.39082 0.219
NP_441340.1_5 Forward -136 -129 15.6737 0.0124
NP_441340.1_5 Reverse -129 -136 15.6737 0.0124
NP_440168.1_4 Forward -224 -205 -7.08038 0.272
NP_440146.1_1 Reverse -365 -383 14.6123 0.284
NP_440586.1_1 Forward -173 -154 -5.21209 0.282
NP_440586.1_8 Forward -136 -129 13.2151 0.026
NP_440586.1_8 Reverse -129 -136 13.2151 0.026
NP_442251.1_6 Forward -136 -129 15.2804 0.0124
NP_442251.1_6 Reverse -129 -136 15.2804 0.0124
NP_442251.1_6 Forward -203 -196 6.43063 0.298
NP_442251.1_6 Forward -193 -186 6.43063 0.298
NP_440192.1_4 Forward -139 -120 8.9125 0.289
NP_441262.1_3 Reverse -128 -135 14.7888 0.0223
NP_441262.1_3 Forward -137 -130 14.7888 0.0223
NP_443051.1_1 Forward -138 -129 18.0926 0.00402
NP_443051.1_1 Reverse -127 -136 10.4228 0.00754
NP_439984.1_3 Forward -144 -130 12.9786 0.239
NP_439937.1_9 Reverse -127 -144 4.65968 0.0798
NP_439937.1_9 Forward -138 -121 -14.9081 0.287
NP_440439.1_1 Reverse -125 -138 3.95252 0.108
NP_440439.1_1 Forward -140 -127 3.75586 0.11
NP_440439.1_1 Forward -266 -253 3.5592 0.112
NP_442239.1_8 Forward -308 -289 4.42435 0.297
NP_440372.1_2 Forward -136 -129 16.3621 0.0124
NP_440372.1_2 Reverse -129 -136 16.3621 0.0124
NP_441181.1_6 Reverse -255 -273 7.39397 0.219
NP_441789.1_9 Reverse -211 -230 24.4839 0.0162
NP_442488.1_4 Reverse -21 -40 15.3391 0.174
NP_439977.1_5 Reverse -122 -141 1.57275 0.191
NP_441572.1_1 Forward -47 -28 13.3725 0.04
NP_442384.1_10 Reverse -128 -141 11.6223 0.0341
NP_442384.1_10 Forward -137 -124 4.54251 0.153
NP_442384.1_10 Reverse -205 -218 3.65753 0.183
NP_442339.1_1 Reverse -185 -204 11.6017 0.264
NP_441631.1_6 Forward -222 -203 16.3224 0.279
NP_442235.1_3 Reverse -124 -143 4.62101 0.224
NP_442262.1_10 Forward -136 -129 14.1988 0.0123
NP_442262.1_10 Reverse -129 -136 14.1988 0.0123
NP_441689.1_5 Reverse -142 -152 10.206 0.132
NP_441689.1_5 Reverse -126 -136 5.78111 0.197
NP_440344.1_10 Forward -144 -127 -0.649475 0.0444
NP_440282.1_10 Forward -147 -128 -5.99873 0.25
NP_440531.1_6 Forward -145 -126 0.58944 0.19
NP_440531.1_6 Reverse -120 -139 -3.14714 0.262
NP_442123.1_3 Reverse -128 -147 12.0942 0.212
NP_441335.1_9 Reverse -149 -167 18.7012 0.0653
NP_440297.1_9 Reverse -129 -139 9.51814 0.0917
NP_440297.1_9 Forward -30 -20 4.69992 0.223
NP_440297.1_9 Forward -136 -126 -0.118297 0.282
NP_441592.1_4 Forward -170 -151 1.17943 0.225
NP_441896.1_3 Forward -203 -184 11.7992 0.0816
NP_441896.1_3 Forward -146 -127 -1.7705 0.268
NP_442553.1_7 Forward -273 -259 15.5359 0.255
NP_440999.1_9 Forward -141 -127 8.94771 0.0698
NP_440999.1_9 Reverse -124 -138 -0.688726 0.214
NP_440888.1_2 Forward -137 -123 15.7319 0.0092
NP_440888.1_2 Forward -214 -200 12.487 0.0442
NP_440888.1_2 Reverse -163 -177 7.66879 0.186
NP_440888.1_2 Reverse -128 -142 7.47213 0.194
NP_440888.1_2 Reverse -289 -303 5.60385 0.272
NP_440179.1_6 Reverse -129 -148 16.1257 0.0681
NP_442147.1_6 Forward -265 -251 17.8952 0.205
NP_439969.1_3 Forward -142 -123 1.47442 0.257
NP_442277.1_4 Forward -175 -156 3.9319 0.211
NP_442033.1_10 Forward -165 -146 6.58763 0.0711
NP_442033.1_10 Forward -139 -120 0.196116 0.109
NP_442033.1_10 Reverse -126 -145 -6.29373 0.186
NP_441543.1_2 Forward -136 -127 16.9127 0.00359
NP_441543.1_2 Reverse -129 -138 9.34117 0.0818
NP_441551.1_5 Forward -141 -125 7.03934 0.249
NP_441469.1_8 Forward -138 -129 13.3727 0.073
NP_441469.1_8 Reverse -127 -136 6.48957 0.227
NP_443064.1_6 Reverse -128 -138 13.8273 0.0796
NP_443064.1_6 Forward -137 -127 12.5669 0.0796
NP_442578.1_7 Forward -136 -129 14.5921 0.026
NP_442578.1_7 Reverse -129 -136 14.5921 0.026
NP_440710.1_5 Forward -191 -172 17.2074 0.0788
NP_441462.1_2 Reverse -128 -138 20.1379 0.000967
NP_441462.1_2 Forward -137 -127 11.5831 0.00406
NP_441462.1_2 Reverse -157 -167 -0.806614 0.254
NP_441621.1_7 Forward -139 -125 -4.81863 0.246
NP_443062.1_1 Forward -137 -119 16.1515 0.0321
NP_443062.1_6 Forward -145 -126 8.84924 0.135
NP_443062.1_6 Reverse -120 -139 1.47442 0.275
NP_441601.1_2 Reverse -122 -141 -4.52377 0.286
NP_440519.1_8 Forward -152 -136 5.17175 0.21
NP_440519.1_8 Reverse -205 -221 2.12349 0.269
NP_440516.1_8 Forward -137 -128 16.9127 0.00442
NP_440516.1_8 Reverse -128 -137 16.9127 0.00442
NP_442428.1_5 Forward -136 -129 15.8704 0.0124
NP_442428.1_5 Reverse -129 -136 15.8704 0.0124
NP_440673.1_3 Forward -135 -128 12.4288 0.0426
NP_440673.1_3 Reverse -130 -137 12.4288 0.0426
NP_440673.1_3 Forward -212 -205 6.72562 0.277
NP_441052.1_2 Forward -137 -127 19.9412 0.00106
NP_441052.1_2 Reverse -128 -138 10.4031 0.0285
NP_441052.1_2 Reverse -205 -215 4.3066 0.161
NP_442219.1_8 Forward -224 -205 21.5025 0.034
NP_442219.1_9 Forward -136 -127 17.7976 0.00718
NP_442219.1_9 Reverse -129 -138 8.25953 0.0681
NP_440436.1_4 Forward -136 -127 17.2072 0.00233
NP_440436.1_4 Reverse -129 -138 15.9289 0.00508
NP_441884.1_9 Reverse -125 -144 -23.4033 0.284
NP_441884.1_9 Forward -232 -213 -24.19 0.284
NP_442086.1_3 Forward -136 -117 5.70265 0.288
NP_440314.1_9 Forward -136 -117 -1.96717 0.143
NP_441719.1_4 Forward -136 -129 16.3621 0.0124
NP_441719.1_4 Reverse -129 -136 16.3621 0.0124
NP_441733.1_10 Reverse -125 -138 8.08242 0.143
NP_441004.1_4 Forward -47 -37 14.9263 0.175
NP_442366.1_3 Forward -264 -246 2.0841 0.135
NP_442366.1_3 Reverse -253 -271 -3.6191 0.253
NP_440129.1_10 Forward -270 -256 4.03116 0.185
NP_441115.1_4 Reverse -127 -145 8.6715 0.24
NP_442206.1_1 Reverse -128 -147 -10.9153 0.219
NP_440328.1_4 Reverse -122 -141 3.24438 0.184
NP_443054.1_2 Reverse -126 -140 7.9644 0.134
NP_442430.1_2 Forward -224 -205 1.76941 0.268
NP_441851.1_10 Forward -138 -128 17.4829 0.0027
NP_441851.1_10 Reverse -127 -137 15.8113 0.00552
NP_442208.1_5 Forward -303 -284 -6.78538 0.269
NP_442515.1_1 Reverse -127 -141 23.2057 0.00534
NP_442515.1_1 Forward -138 -124 9.63603 0.0614
NP_442689.1_8 Forward -30 -13 0.628827 0.191
NP_441349.1_10 Reverse -118 -137 7.86593 0.0288
NP_441409.1_6 Forward -143 -124 9.83255 0.024
NP_440432.1_9 Forward -136 -121 4.50312 0.0691
NP_442843.1_1 Forward -187 -168 -11.9969 0.296
NP_442944.1_9 Reverse -119 -138 16.4207 0.228
NP_440431.1_7 Forward -341 -322 -1.57384 0.297
NP_442450.1_5 Forward -139 -129 10.1081 0.115
NP_441570.1_1 Forward -137 -119 -9.0273 0.127
NP_441570.1_1 Reverse -205 -223 -11.9772 0.206
NP_441078.1_4 Forward -137 -128 19.6659 0.0007
NP_441078.1_4 Reverse -128 -137 19.6659 0.0007
NP_441078.1_4 Reverse -157 -166 -1.18024 0.237
NP_441078.1_4 Reverse -205 -214 -1.37691 0.254
NP_442729.1_5 Reverse -210 -220 7.94484 0.254
NP_442729.1_8 Forward -141 -128 10.344 0.125
NP_440526.1_3 Reverse -129 -140 11.3662 0.0646
NP_440526.1_3 Forward -136 -125 10.2846 0.0646
NP_440526.1_3 Reverse -86 -97 6.35136 0.205
NP_440526.1_3 Reverse -382 -393 0.156538 0.297
NP_441432.1_8 Reverse -127 -136 16.8143 0.00595
NP_441432.1_8 Reverse -204 -213 11.9961 0.0519
NP_441432.1_8 Forward -138 -129 8.35786 0.0755
NP_441333.1_1 Forward -337 -327 11.6853 0.241
NP_441333.1_1 Forward -36 -26 11.304 0.264
NP_442320.1_8 Reverse -122 -136 6.19444 0.029
NP_441732.1_2 Reverse -124 -140 -15.0844 0.145
NP_441732.1_2 Forward -141 -125 -16.2644 0.165
NP_441732.1_2 Forward -170 -154 -16.3627 0.165
NP_441030.1_6 Forward -216 -197 13.4291 0.216
NP_442003.1_4 Forward -136 -117 10.4225 0.288
NP_442003.1_4 Forward -303 -284 9.3409 0.3
NP_440760.1_1 Reverse -128 -147 -11.5053 0.0857
NP_440199.1_10 Reverse -125 -135 7.25653 0.231
NP_441072.1_2 Reverse -117 -136 10.3242 0.2
NP_440713.1_4 Forward -147 -128 4.916 0.219
NP_442489.1_2 Forward -148 -129 1.17943 0.293
NP_442489.1_7 Forward -137 -128 20.1576 0.000695
NP_442489.1_7 Reverse -128 -137 20.1576 0.000695
NP_442489.1_7 Reverse -205 -214 -1.57357 0.213
NP_442489.1_7 Forward -214 -205 -2.06522 0.288
NP_442079.1_7 Reverse -129 -148 3.14605 0.212
NP_440559.1_1 Forward -136 -127 17.4043 0.00658
NP_440559.1_1 Reverse -129 -138 17.306 0.00658
NP_441659.2_8 Reverse -128 -138 19.3512 0.000966
NP_441659.2_8 Forward -137 -127 18.1713 0.00133
NP_441659.2_8 Reverse -289 -299 0.0783647 0.277
NP_441092.1_6 Forward -303 -284 8.94757 0.233
NP_442913.1_10 Forward -146 -127 7.66927 0.0519
NP_442008.1_2 Reverse -251 -270 4.12936 0.245
NP_442008.1_2 Reverse -154 -173 3.83436 0.245
NP_441800.1_7 Reverse -290 -308 3.06741 0.204
NP_442346.1_5 Forward -138 -128 17.9746 0.00128
NP_442346.1_5 Reverse -127 -137 16.6963 0.00248
NP_442346.1_5 Reverse -204 -214 9.41981 0.118
NP_440545.1_3 Reverse -124 -141 5.9387 0.0587
NP_440545.1_3 Forward -170 -153 -3.10775 0.199
NP_440545.1_3 Reverse -153 -170 -5.27103 0.245
NP_440010.1_4 Reverse -204 -223 0.293673 0.25
NP_440010.1_4 Forward -224 -205 -2.8529 0.291
NP_440010.1_10 Forward -226 -207 6.58763 0.226
NP_442900.1_7 Forward -77 -58 20.059 0.017
NP_442603.1_7 Reverse -128 -142 16.5185 0.0304
NP_441948.1_4 Forward -144 -126 0.412472 0.136
NP_441833.1_4 Forward -136 -129 15.9687 0.0124
NP_441833.1_4 Reverse -129 -136 15.9687 0.0124
NP_442162.1_9 Forward -136 -129 16.2637 0.0124
NP_442162.1_9 Reverse -129 -136 16.2637 0.0124
NP_442162.1_9 Reverse -255 -262 5.93897 0.214
NP_440671.1_4 Reverse -248 -262 7.27608 0.222
NP_442404.1_9 Reverse -131 -145 11.4053 0.263
NP_440224.1_1 Reverse -117 -136 2.3594 0.132
NP_440772.1_8 Reverse -122 -141 9.0459 0.253
NP_442140.1_3 Reverse -129 -139 14.828 0.0433
NP_442140.1_3 Forward -136 -126 10.3048 0.0902
NP_442140.1_3 Reverse -212 -222 3.51995 0.294
NP_440875.1_9 Forward -135 -125 7.69067 0.255
NP_441813.1_5 Reverse -126 -136 18.1713 0.00743
NP_441813.1_5 Forward -139 -129 8.92815 0.0347
NP_440594.1_8 Reverse -129 -142 18.8982 0.0537
NP_440590.1_4 Forward -136 -123 13.1956 0.013
NP_440590.1_4 Reverse -129 -142 5.23083 0.0585
NP_440567.1_1 Reverse -129 -143 2.16287 0.182
NP_442497.1_10 Reverse -129 -138 19.8626 0.00532
NP_442497.1_10 Forward -136 -127 10.4228 0.0087
NP_440821.1_4 Forward -139 -129 19.5479 0.00399
NP_440821.1_4 Reverse -126 -136 9.41981 0.0286
NP_441239.1_9 Forward -139 -127 14.4936 0.0272
NP_441239.1_9 Reverse -126 -138 8.79043 0.122
NP_441892.1_1 Forward -146 -129 -0.649475 0.188
NP_441017.1_6 Reverse -191 -205 11.4053 0.268
NP_441017.1_6 Reverse -181 -195 11.4053 0.268
NP_441017.1_6 Reverse -124 -138 11.2087 0.273
NP_442138.1_10 Forward -137 -118 -6.88371 0.286
NP_440546.1_4 Reverse -128 -138 12.8578 0.0572
NP_440546.1_4 Forward -137 -127 10.046 0.109
NP_440462.1_4 Forward -311 -297 7.86607 0.273
NP_440462.1_6 Forward -139 -129 10.4031 0.0396
NP_440462.1_6 Reverse -126 -136 9.61647 0.0429
NP_440462.1_6 Forward -155 -145 1.74999 0.294
NP_442611.1_1 Reverse -254 -273 -0.688862 0.268
NP_440868.1_4 Forward -141 -129 12.3303 0.0242
NP_440868.1_4 Reverse -124 -136 7.80712 0.0637
NP_441848.1_4 Reverse -15 -31 14.3306 0.17
NP_441848.1_7 Forward -279 -260 -0.886293 0.244
NP_440696.1_3 Forward -208 -190 -2.43913 0.274
NP_440696.1_3 Forward -198 -180 -2.43913 0.274
NP_442039.1_4 Forward -136 -129 15.1821 0.0124
NP_442039.1_4 Reverse -129 -136 15.1821 0.0124
NP_441811.1_8 Forward -143 -129 18.2892 0.0563
NP_442679.1_1 Reverse -318 -337 -2.0655 0.24
NP_442679.1_1 Reverse -322 -341 -4.22878 0.274
NP_441926.1_3 Forward -137 -121 6.25339 0.17
NP_442837.1_3 Forward -136 -129 15.7721 0.0124
NP_442837.1_3 Reverse -129 -136 15.7721 0.0124
NP_442837.1_3 Reverse -145 -152 5.84064 0.272
NP_440160.1_3 Reverse -292 -311 11.8967 0.209
NP_442053.1_1 Forward -137 -128 18.3876 0.0007
NP_442053.1_1 Reverse -128 -137 18.3876 0.0007
NP_440505.1_3 Reverse -126 -136 18.3679 0.00213
NP_440505.1_3 Forward -168 -158 11.3864 0.0778
NP_440505.1_3 Forward -139 -129 7.84651 0.147
NP_440505.1_7 Forward -170 -151 13.2741 0.146
NP_441408.2_7 Reverse -14 -33 -0.590531 0.234
NP_440914.1_1 Forward -137 -127 17.5935 0.000537
NP_440914.1_1 Reverse -205 -215 12.6163 0.0518
NP_440914.1_1 Reverse -128 -138 8.51751 0.186
NP_441011.1_8 Reverse -129 -138 14.356 0.0249
NP_441011.1_8 Forward -136 -127 8.25953 0.144
NP_442533.1_1 Forward -181 -162 -15.9302 0.26
NP_442533.1_1 Forward -307 -288 -16.3235 0.265
NP_442533.1_6 Forward -137 -128 17.2076 0.00137
NP_442533.1_6 Reverse -128 -137 17.2076 0.00137
NP_442533.1_6 Reverse -205 -214 5.11294 0.155
NP_442232.1_2 Forward -336 -317 8.84924 0.29
NP_442232.1_3 Forward -145 -126 -3.73712 0.163
NP_442229.1_3 Reverse -152 -169 14.1002 0.282
NP_441482.1_7 Forward -143 -129 -8.65353 0.193
NP_441482.1_7 Forward -269 -255 -12.2918 0.292
NP_439944.1_9 Reverse -129 -139 17.4829 0.00423
NP_439944.1_9 Forward -136 -126 10.5014 0.0887
NP_441028.1_6 Reverse -342 -352 9.02601 0.216
NP_442202.1_4 Reverse -126 -140 12.7383 0.282
NP_440116.1_8 Reverse -129 -148 -4.6221 0.175
NP_441527.1_4 Reverse -321 -340 -9.02441 0.254
NP_441527.1_4 Reverse -15 -34 -11.2207 0.278
NP_440115.1_6 Forward -140 -130 18.2696 0.0139
NP_440115.1_6 Reverse -125 -135 6.8632 0.167
NP_441602.1_3 Forward -241 -222 -5.11376 0.278
NP_441972.1_5 Reverse -129 -148 -5.80207 0.225
NP_441972.1_6 Reverse -284 -302 15.1613 0.23
NP_441106.1_1 Forward -138 -129 9.73449 0.0311
NP_441106.1_1 Reverse -127 -136 9.63616 0.0311
NP_439903.1_6 Forward -217 -198 5.60352 0.178
NP_442306.1_10 Forward -142 -123 -19.4701 0.197
NP_442306.1_10 Reverse -123 -142 -19.9617 0.201
NP_441286.1_1 Reverse -127 -139 24.2284 0.000758
NP_441286.1_1 Forward -138 -126 3.48056 0.0467
NP_441286.1_1 Forward -167 -155 -6.94252 0.288
NP_440670.1_8 Forward -137 -128 18.3876 0.000699
NP_440670.1_8 Reverse -128 -137 18.3876 0.000699
NP_441479.1_9 Forward -45 -27 12.2122 0.297
NP_441930.1_2 Reverse -204 -214 11.3864 0.294
NP_440886.1_7 Forward -138 -128 8.04271 0.0805
NP_440886.1_7 Reverse -127 -137 7.94438 0.0805
NP_440886.1_7 Reverse -294 -304 6.66608 0.115
NP_442614.1_2 Reverse -128 -142 16.8142 0.0658
NP_442614.1_2 Forward -166 -152 10.521 0.234
NP_442614.1_2 Forward -137 -123 5.80112 0.297
NP_442072.1_9 Forward -138 -120 -20.1387 0.204
NP_442072.1_9 Reverse -127 -145 -21.9087 0.215
NP_440907.2_8 Reverse -129 -139 19.449 0.00351
NP_440176.1_3 Forward -270 -256 16.3219 0.219
NP_441463.1_3 Reverse -118 -137 -3.3438 0.174
NP_441463.1_3 Forward -147 -128 -7.27704 0.256
NP_441463.1_3 Forward -224 -205 -7.67036 0.259
NP_441463.1_5 Forward -138 -124 12.4876 0.188
NP_441463.1_6 Reverse -203 -217 9.89475 0.242
NP_441463.1_6 Reverse -126 -140 6.99573 0.265
NP_441626.1_2 Forward -136 -129 15.7721 0.0124
NP_441626.1_2 Reverse -129 -136 15.7721 0.0124
NP_442211.1_3 Forward -225 -206 9.61179 0.257
NP_442615.1_1 Forward -146 -128 3.85406 0.0512
NP_442615.1_1 Reverse -119 -137 -4.99573 0.201
NP_440387.1_1 Reverse -128 -144 -3.67804 0.164
NP_441431.1_2 Forward -140 -126 8.75042 0.207
NP_441431.1_2 Reverse -125 -139 5.60385 0.294
NP_441488.1_7 Forward -143 -124 0.392778 0.298
NP_441836.1_2 Forward -304 -285 0.392778 0.202
NP_440814.1_4 Forward -146 -127 -0.885524 0.136
NP_440114.1_10 Reverse -128 -142 12.9793 0.0681
NP_440114.1_10 Forward -137 -123 8.55439 0.2
NP_442323.1_7 Forward -219 -200 4.81688 0.213
NP_440725.1_9 Forward -38 -23 16.5978 0.214
NP_441510.2_6 Reverse -144 -163 18.1898 0.0974
NP_441510.2_6 Forward -224 -205 13.7649 0.233
NP_441237.1_9 Reverse -129 -139 17.2863 0.00348
NP_440643.1_6 Reverse -11 -30 5.50599 0.214
NP_442103.1_2 Reverse -134 -152 9.16315 0.246
NP_439910.1_2 Reverse -120 -137 -3.30441 0.0401
NP_439910.1_2 Reverse -28 -45 -22.184 0.215
NP_440457.1_1 Forward -141 -129 9.97041 0.092
NP_440457.1_1 Reverse -124 -136 -0.649339 0.271
NP_442940.1_2 Reverse -128 -147 -1.08219 0.296
NP_440798.1_6 Reverse -129 -142 3.06754 0.153
NP_441801.1_4 Forward -161 -151 2.63497 0.29
NP_442509.1_9 Reverse -128 -138 17.3841 0.00128
NP_442509.1_9 Forward -137 -127 8.14104 0.192
NP_443037.1_7 Reverse -242 -261 -5.31042 0.276
NP_441765.1_4 Reverse -262 -281 12.3892 0.183
NP_440554.1_4 Forward -136 -126 8.92815 0.0646
NP_440554.1_4 Reverse -129 -139 6.27322 0.123
NP_441885.1_5 Forward -137 -127 20.9245 0.000538
NP_441885.1_5 Reverse -128 -138 11.3864 0.00668
NP_441885.1_5 Forward -298 -288 -1.59326 0.273
NP_442341.1_7 Reverse -127 -141 14.9459 0.0256
NP_443000.1_7 Reverse -126 -136 19.9412 0.00223
NP_443000.1_7 Forward -139 -129 2.14332 0.226
NP_441842.1_1 Reverse -130 -143 11.4251 0.254
NP_440275.1_3 Forward -139 -129 19.5479 0.00756
NP_440275.1_3 Reverse -126 -136 15.123 0.0182
NP_440275.1_3 Reverse -155 -165 5.87989 0.13
NP_440091.1_1 Reverse -124 -136 8.88877 0.0567
NP_440091.1_1 Forward -141 -129 0.825626 0.227
NP_443010.1_10 Forward -140 -123 7.21595 0.178
NP_443010.1_10 Reverse -125 -142 3.3506 0.255
NP_440175.1_4 Forward -139 -120 -11.2103 0.185
NP_442495.1_4 Forward -160 -150 10.9931 0.295
NP_440216.1_1 Forward -137 -123 8.06273 0.0068
NP_440216.1_1 Reverse -128 -142 -1.18038 0.0301
NP_440216.1_1 Reverse -157 -171 -11.4068 0.184
NP_440172.1_1 Reverse -128 -138 16.303 0.00854
NP_440172.1_1 Forward -137 -127 15.0247 0.00945
NP_440172.1_1 Reverse -205 -215 6.17489 0.11
NP_440172.1_1 Forward -263 -253 3.91327 0.213
NP_442015.1_10 Forward -141 -128 3.65753 0.178
NP_442015.1_10 Reverse -124 -137 2.87088 0.187
NP_441045.1_1 Reverse -14 -33 14.3558 0.26
NP_441226.1_7 Forward -136 -129 14.4934 0.0123
NP_441226.1_7 Reverse -129 -136 14.4934 0.0123
NP_441226.1_7 Forward -44 -37 9.47853 0.147
NP_441111.1_7 Forward -136 -128 18.7023 0.00294
NP_441111.1_7 Reverse -129 -137 18.7023 0.00294
NP_441766.1_2 Forward -137 -128 17.5026 0.00297
NP_441766.1_2 Reverse -128 -137 17.5026 0.00297
NP_441766.1_9 Forward -228 -209 -1.47551 0.271
NP_440416.1_1 Forward -137 -118 -4.6221 0.13
NP_440416.1_9 Forward -270 -251 -8.85033 0.122
NP_440416.1_9 Reverse -137 -156 -21.4367 0.294
NP_443052.1_8 Reverse -118 -137 -0.197208 0.0684
NP_443052.1_8 Forward -173 -154 -9.63698 0.193
NP_442116.1_2 Forward -43 -24 10.815 0.289
NP_440261.1_5 Reverse -129 -142 24.1104 0.00402
NP_440261.1_5 Forward -165 -152 -2.63565 0.0924
NP_440261.1_5 Forward -136 -123 -4.60227 0.158
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGGGTGCGGGTAGATGGCTCAAAAAAAAGATTGGTGACTACTTGTCCCTGGAGGGCAGGTACTTTTTTTGTTTGTCCACTCAGTACTTGCTGGAATGTGGTGGCGGTCTGTAGCACAATGTCTAATTCTTCGCCCCGCCAATCGGTTAGGTCTAAAATGTGGTTTCGAGTCCAACTGGCCACCATGGTCATTGCCTTAGATTGCCTTAGATTGCCTTAGATAGATATGGGGCAGGCGGTAGTCCCCAGGGATCCATATTGGGGGCGATCGCCAGTTAATGCAAGTCTTTTCCTCGCTACACTAGGGAGGAACGTTCCCATGTATTTAGCTAAAAGTCCGTGGTATTCTGAAATGCGCCAACGGTGTTTAGCTTTTGCCCTAATTTGACTGCCTTTGACT

CDS

ATGACCACCGCAACCCATTTGCTGAAACTTGCCGCGACAGTTCTATTAGGAAGCTTGGTGACAACGGCCCCATTAGTTAGGGCCCAGTTCACAGCCCCGGCTCCCCAGAATAATACTTCCACCCCGATCCCCAAGGTGGAACTAAATTTCCAGCCCTTGGAAACGGCCTTAGCATCCCAGCAGTTTAGTCAGGCCAATGAAATTACCCGCCGCCTGCTGTTGGCCGCTACCAATCGGACACTCCAGGGTTGGTTGACCACCGACACTATTGAGCAAATTCCCTGCCAGGATCTGAAAACCATTGATCAGTTATGGTTACAACATTCCAACAATCGTTTTGGCTTCACTCCCCAATTGGAAGCGTTTTTGGCCACGGGGAATCGCCCCGGTAGATTAATGTCACCGGAGTCCTACGACCAATTTGGTGATCGCATTGGCTGGCGTAAAGAGAACCAGTGGGTCATTTTCAAGAAAAATTTGGACTTCACCCTTAACGCCCCGGCGGGCCATCTACCTAGCCCCAGGGATGAGTACCAAATTAATGGTGGGCGCTTAGAATACACTGCCCTCATGGGTCGTTTCCAAGTCTGTCAATCGGGACAAGTACCCACTGCTCCAGTGCGCTTTACCCCCTTTGGCTCCTAG

Protein

MTTATHLLKLAATVLLGSLVTTAPLVRAQFTAPAPQNNTSTPIPKVELNFQPLETALASQQFSQANEITRRLLLAATNRTLQGWLTTDTIEQIPCQDLKTIDQLWLQHSNNRFGFTPQLEAFLATGNRPGRLMSPESYDQFGDRIGWRKENQWVIFKKNLDFTLNAPAGHLPSPRDEYQINGGRLEYTALMGRFQVCQSGQVPTAPVRFTPFGS