Your browser is old and dusty. Try Google Chrome!

Details for sll1367

ORF sll1367
Accession NP_442838.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -269 -262 14.1988 0.0267
NP_441418.1_1 Reverse -101 -120 6.82725 0.282
NP_441418.1_6 Reverse -261 -280 -10.3253 0.0339
NP_441418.1_6 Forward -327 -308 -28.9099 0.213
NP_441418.1_6 Forward -321 -302 -29.2048 0.219
NP_441418.1_6 Forward -318 -299 -29.2048 0.219
NP_441343.1_7 Forward -142 -123 1.0811 0.278
NP_441453.1_4 Forward -270 -262 6.80426 0.121
NP_441453.1_4 Reverse -261 -269 6.70593 0.121
NP_441453.1_4 Forward -234 -226 3.85433 0.284
NP_441453.1_7 Forward -392 -385 11.9372 0.298
NP_442151.1_6 Forward -270 -256 6.78443 0.221
NP_442838.1_1 Forward -397 -378 26.1555 0.00226
NP_442838.1_2 Forward -151 -132 21.5331 0.0542
NP_442838.1_3 Forward -71 -53 19.587 0.117
NP_442838.1_4 Forward -179 -161 18.4659 0.287
NP_441818.1_9 Forward -312 -293 -0.885524 0.196
NP_441818.1_9 Forward -318 -299 -5.01543 0.248
NP_441818.1_9 Forward -315 -296 -5.40875 0.253
NP_441818.1_9 Forward -324 -305 -9.047 0.287
NP_440226.1_1 Reverse -261 -280 9.83255 0.0687
NP_441630.1_3 Reverse -25 -44 3.73603 0.186
NP_442287.1_1 Reverse -40 -50 13.9425 0.266
NP_442655.1_10 Forward -315 -296 -12.1936 0.261
NP_442173.1_1 Forward -269 -261 5.72262 0.203
NP_442173.1_1 Reverse -262 -270 5.72262 0.203
NP_442752.1_4 Reverse -261 -268 13.5105 0.0314
NP_442752.1_4 Forward -270 -263 4.26735 0.293
NP_443027.1_4 Forward -272 -262 13.8447 0.049
NP_441812.1_3 Reverse -260 -274 13.8643 0.146
NP_442975.1_10 Forward -274 -260 4.52221 0.245
NP_440784.1_7 Reverse -262 -269 13.2155 0.0365
NP_440784.1_7 Forward -269 -262 12.1338 0.0604
NP_440061.1_9 Forward -331 -317 9.24208 0.149
NP_440061.1_9 Forward -52 -38 6.0955 0.261
NP_441054.1_2 Reverse -230 -249 11.8975 0.254
NP_439979.1_9 Forward -311 -293 10.9339 0.227
NP_442062.1_3 Forward -191 -172 14.3558 0.132
NP_442062.1_8 Reverse -261 -271 9.7148 0.0559
NP_442062.1_8 Forward -270 -260 9.7148 0.0559
NP_442062.1_8 Forward -50 -40 9.32148 0.0633
NP_441900.1_2 Reverse -293 -311 2.47668 0.221
NP_442242.1_4 Forward -269 -262 12.0355 0.0521
NP_442242.1_4 Reverse -262 -269 11.5438 0.089
NP_442762.1_10 Reverse -315 -334 -8.06369 0.22
NP_442762.1_10 Forward -333 -314 -11.1119 0.272
NP_439918.1_2 Forward -324 -305 -2.0655 0.24
NP_439918.1_2 Reverse -235 -254 -3.93378 0.263
NP_441935.1_1 Forward -381 -362 5.89931 0.292
NP_441594.1_6 Forward -384 -365 4.03102 0.223
NP_442196.1_10 Forward -251 -232 11.3075 0.225
NP_441925.1_4 Reverse -299 -318 -2.8529 0.168
NP_441925.1_4 Reverse -293 -312 -6.98278 0.188
NP_441925.1_4 Reverse -290 -309 -10.1294 0.236
NP_441925.1_4 Reverse -296 -315 -13.7676 0.259
NP_441083.1_3 Forward -330 -320 13.2542 0.22
NP_441083.1_5 Forward -270 -260 8.82982 0.03
NP_441083.1_5 Reverse -261 -271 1.74999 0.198
NP_441083.1_5 Reverse -41 -51 -1.10161 0.295
NP_442827.1_8 Reverse -225 -244 6.58682 0.105
NP_441434.1_7 Reverse -227 -241 10.816 0.155
NP_441434.1_7 Forward -268 -254 7.07942 0.225
NP_441738.1_2 Forward -258 -251 8.29857 0.176
NP_441558.1_5 Forward -236 -217 13.2741 0.0606
NP_440209.1_1 Forward -270 -262 8.37755 0.0576
NP_440209.1_1 Reverse -261 -269 8.27922 0.0687
NP_442889.1_8 Forward -273 -259 9.34041 0.1
NP_440178.1_5 Reverse -267 -276 18.6826 0.137
NP_442570.1_3 Forward -52 -33 -2.26216 0.212
NP_442570.1_3 Forward -58 -39 -6.39206 0.257
NP_441792.1_5 Reverse -343 -359 13.4315 0.19
NP_442601.1_5 Forward -318 -299 14.3558 0.221
NP_441327.1_5 Reverse -330 -339 14.356 0.192
NP_441624.1_7 Forward -335 -321 8.35772 0.24
NP_441533.1_4 Reverse -146 -163 20.8694 0.0316
NP_440343.1_9 Forward -316 -297 7.57094 0.278
NP_440343.1_9 Forward -60 -41 6.68596 0.293
NP_440906.1_5 Reverse -262 -269 13.3138 0.0268
NP_440906.1_5 Forward -269 -262 6.13563 0.241
NP_440438.2_8 Forward -163 -144 1.86774 0.262
NP_440747.1_10 Reverse -258 -270 -4.48425 0.101
NP_440747.1_10 Forward -273 -261 -11.7607 0.142
NP_440747.1_10 Forward -53 -41 -12.2524 0.254
NP_441486.1_1 Forward -273 -259 11.5043 0.016
NP_441486.1_1 Reverse -258 -272 0.491246 0.134
NP_441486.1_1 Reverse -222 -236 -4.91696 0.213
NP_441014.1_8 Reverse -307 -326 -7.67036 0.281
NP_441014.1_9 Forward -324 -305 9.43923 0.174
NP_441014.1_10 Reverse -260 -279 -0.984623 0.257
NP_443018.1_3 Forward -269 -262 5.15232 0.226
NP_443018.1_3 Reverse -262 -269 5.05399 0.238
NP_443018.1_3 Reverse -226 -233 4.26735 0.267
NP_443018.1_3 Forward -233 -226 4.07068 0.299
NP_441634.1_9 Reverse -266 -285 8.84842 0.294
NP_440376.1_1 Forward -50 -41 11.6028 0.0241
NP_440376.1_1 Reverse -261 -270 9.83282 0.0339
NP_440376.1_1 Forward -270 -261 9.73449 0.0365
NP_441588.1_4 Forward -268 -258 11.6814 0.14
NP_442687.1_7 Reverse -260 -270 14.828 0.0247
NP_442687.1_7 Reverse -40 -50 6.27322 0.175
NP_442687.1_7 Forward -271 -261 6.07655 0.179
NP_442687.1_7 Forward -235 -225 4.89658 0.23
NP_442530.1_2 Reverse -124 -134 13.8447 0.226
NP_442530.1_2 Reverse -159 -169 12.4681 0.276
NP_440642.1_10 Forward -338 -324 1.76896 0.289
NP_441013.1_7 Reverse -303 -322 14.7483 0.281
NP_440741.1_5 Forward -58 -39 17.8782 0.182
NP_440667.1_2 Forward -312 -293 -3.73712 0.236
NP_441950.1_7 Forward -312 -293 -8.55534 0.287
NP_442296.1_5 Reverse -311 -330 5.89931 0.251
NP_442658.1_1 Reverse -39 -49 7.0594 0.214
NP_442658.1_1 Forward -272 -262 6.27276 0.234
NP_442658.1_1 Reverse -259 -269 6.0761 0.238
NP_442198.1_3 Reverse -252 -271 6.4893 0.251
NP_440617.1_6 Forward -323 -304 16.6174 0.0843
NP_442782.1_2 Forward -346 -332 0.88457 0.282
NP_441414.1_9 Forward -270 -251 -3.93378 0.143
NP_439968.1_2 Reverse -293 -312 13.3716 0.259
NP_443061.1_4 Forward -265 -246 3.53937 0.205
NP_440607.1_8 Forward -320 -301 1.96607 0.264
NP_441256.1_1 Reverse -306 -325 -5.01543 0.233
NP_441256.1_1 Reverse -303 -322 -6.98204 0.239
NP_442937.1_5 Forward -320 -301 8.45592 0.22
NP_442937.1_5 Forward -76 -57 6.88262 0.268
NP_441958.1_5 Forward -271 -261 2.53664 0.0409
NP_441958.1_5 Reverse -260 -270 2.43831 0.0422
NP_442486.1_6 Reverse -297 -316 7.57094 0.249
NP_442486.1_6 Reverse -300 -319 -5.31042 0.279
NP_441162.1_3 Reverse -308 -327 12.0942 0.198
NP_439990.1_5 Reverse -256 -269 5.62415 0.283
NP_442911.1_2 Forward -280 -261 -9.53865 0.258
NP_440153.1_8 Reverse -306 -319 -3.12731 0.285
NP_442536.1_8 Forward -318 -299 13.5691 0.229
NP_442536.1_8 Forward -321 -302 11.5042 0.258
NP_443055.1_3 Reverse -379 -398 12.555 0.21
NP_443055.1_6 Reverse -355 -373 6.01657 0.172
NP_443055.1_6 Forward -342 -324 0.608397 0.241
NP_440993.1_2 Forward -247 -231 11.4649 0.0818
NP_440827.1_1 Forward -318 -299 15.0441 0.235
NP_442002.1_1 Reverse -317 -335 -8.04399 0.261
NP_442002.1_9 Reverse -40 -47 12.2322 0.185
NP_442002.1_9 Forward -271 -264 10.7572 0.185
NP_441646.1_1 Reverse -34 -53 16.8141 0.0682
NP_442438.1_10 Forward -275 -261 -0.0987402 0.248
NP_442431.1_10 Forward -318 -300 17.5221 0.0506
NP_442431.1_10 Forward -312 -294 4.24738 0.206
NP_442431.1_10 Forward -315 -297 4.14905 0.208
NP_442431.1_10 Forward -321 -303 0.609134 0.269
NP_442431.1_10 Forward -309 -291 -0.177514 0.286
NP_441752.1_6 Reverse -296 -315 1.86774 0.255
NP_441000.1_6 Reverse -260 -274 3.44117 0.111
NP_441674.1_6 Reverse -307 -326 5.211 0.261
NP_440147.1_4 Reverse -259 -272 1.49425 0.226
NP_441175.1_2 Reverse -354 -373 7.27595 0.226
NP_441550.1_8 Reverse -259 -269 5.78111 0.23
NP_441916.1_7 Forward -270 -260 8.73149 0.042
NP_441916.1_7 Reverse -261 -271 8.63316 0.0437
NP_441916.1_7 Reverse -225 -235 3.22496 0.223
NP_441041.1_4 Forward -318 -299 -7.57203 0.19
NP_441041.1_4 Reverse -261 -280 -10.0303 0.227
NP_441041.1_7 Forward -263 -251 6.25147 0.216
NP_442396.1_5 Reverse -257 -270 9.85238 0.128
NP_440703.1_9 Reverse -320 -333 4.73861 0.293
NP_441725.1_5 Reverse -262 -272 1.455 0.135
NP_439966.1_7 Forward -272 -262 8.92768 0.125
NP_442941.1_3 Reverse -262 -272 1.94665 0.147
NP_442941.1_3 Forward -269 -259 0.0783647 0.231
NP_440289.1_2 Forward -273 -260 4.93583 0.0636
NP_440983.1_5 Reverse -303 -322 -0.983855 0.228
NP_440983.1_5 Forward -285 -266 -1.57384 0.228
NP_440983.1_5 Reverse -300 -319 -6.1954 0.276
NP_441514.1_6 Reverse -324 -331 12.7238 0.29
NP_442281.1_1 Forward -275 -261 11.602 0.0447
NP_442281.1_1 Reverse -315 -329 4.12889 0.206
NP_442847.1_3 Forward -333 -314 4.12856 0.281
NP_441556.1_4 Forward -282 -263 17.4284 0.113
NP_441556.1_4 Forward -279 -260 13.1865 0.201
NP_440498.1_1 Forward -279 -261 -2.63579 0.244
NP_441644.1_6 Forward -270 -260 6.86274 0.144
NP_441644.1_6 Reverse -378 -388 3.12618 0.297
NP_442215.1_2 Forward -337 -321 -1.71142 0.187
NP_442215.1_2 Reverse -259 -275 -2.79306 0.204
NP_442029.1_1 Reverse -249 -268 -20.2567 0.297
NP_442029.1_6 Reverse -315 -334 5.70265 0.249
NP_440253.1_2 Reverse -261 -279 7.59063 0.0682
NP_440929.1_8 Forward -270 -261 9.53783 0.0296
NP_440929.1_8 Reverse -261 -270 9.4395 0.0326
NP_442933.1_10 Reverse -261 -270 13.9627 0.0192
NP_442933.1_10 Forward -270 -261 7.86621 0.103
NP_442933.1_10 Reverse -225 -234 4.81794 0.212
NP_442933.1_10 Forward -234 -225 4.12963 0.28
NP_442926.1_3 Reverse -19 -38 3.53937 0.279
NP_442554.1_8 Reverse -262 -272 4.3066 0.189
NP_442554.1_8 Forward -269 -259 3.51995 0.222
NP_442554.1_9 Forward -319 -300 12.3112 0.281
NP_441762.1_7 Forward -271 -259 9.57708 0.0142
NP_441762.1_7 Reverse -260 -272 2.20226 0.0676
NP_442142.1_4 Forward -273 -260 14.375 0.0311
NP_442142.1_4 Reverse -306 -319 9.26181 0.0998
NP_442142.1_4 Reverse -303 -316 6.70522 0.158
NP_442142.1_4 Reverse -300 -313 4.44361 0.222
NP_442292.1_1 Reverse -262 -271 0.196389 0.234
NP_442292.1_1 Forward -269 -260 -0.0986038 0.239
NP_440919.1_7 Forward -340 -322 11.1389 0.171
NP_443009.1_5 Forward -398 -387 9.30127 0.0965
NP_443009.1_5 Reverse -260 -271 8.02298 0.118
NP_442301.1_2 Reverse -299 -318 11.7 0.159
NP_442301.1_2 Reverse -293 -312 7.27514 0.257
NP_442301.1_2 Reverse -305 -324 5.60352 0.263
NP_442301.1_2 Reverse -296 -315 3.44025 0.294
NP_441715.1_4 Forward -269 -259 9.41981 0.097
NP_441715.1_4 Reverse -262 -272 7.05986 0.118
NP_440357.1_3 Forward -53 -34 1.76941 0.272
NP_440357.1_6 Reverse -300 -319 2.55606 0.296
NP_441448.1_2 Forward -265 -246 -2.06626 0.291
NP_440183.1_9 Reverse -365 -384 -11.7019 0.255
NP_441198.1_8 Forward -399 -389 12.2947 0.144
NP_441468.1_1 Reverse -262 -269 6.3323 0.202
NP_441468.1_1 Forward -269 -262 6.13563 0.209
NP_441468.1_1 Reverse -226 -233 4.07068 0.263
NP_441020.2_6 Reverse -259 -276 8.10198 0.209
NP_441020.2_7 Forward -260 -241 6.58682 0.277
NP_441015.1_10 Forward -317 -298 -1.67217 0.174
NP_441015.1_10 Forward -320 -301 -9.44032 0.282
NP_441015.1_10 Forward -314 -295 -10.6203 0.286
NP_441015.1_10 Reverse -268 -287 -11.0136 0.29
NP_441673.1_1 Forward -270 -261 11.1111 0.0121
NP_441673.1_1 Reverse -261 -270 11.0128 0.018
NP_441016.2_6 Reverse -300 -319 9.53674 0.222
NP_442253.1_5 Reverse -279 -296 -0.649475 0.227
NP_442868.1_6 Reverse -39 -49 4.10993 0.186
NP_442227.1_2 Reverse -305 -324 3.44104 0.216
NP_442227.1_2 Reverse -302 -321 -2.0655 0.27
NP_442427.1_8 Reverse -144 -163 6.98095 0.224
NP_442808.1_1 Forward -271 -261 8.92768 0.0481
NP_442808.1_1 Reverse -260 -270 8.82935 0.0481
NP_442808.1_1 Reverse -39 -49 7.94438 0.0634
NP_442113.1_10 Reverse -302 -321 -6.1954 0.255
NP_441937.1_1 Forward -67 -48 8.35759 0.149
NP_440558.1_2 Reverse -339 -358 14.1591 0.0642
NP_440558.1_2 Reverse -279 -298 -4.91709 0.249
NP_441518.1_3 Forward -280 -261 -1.57384 0.11
NP_441878.1_6 Forward -27 -17 1.65166 0.0795
NP_441878.1_6 Forward -271 -261 0.668351 0.139
NP_441878.1_6 Reverse -260 -270 0.57002 0.14
NP_441878.1_6 Forward -353 -343 -0.0199663 0.163
NP_441036.1_8 Reverse -260 -270 8.92815 0.174
NP_441036.1_8 Forward -271 -261 8.04317 0.177
NP_441557.1_5 Forward -270 -261 10.2261 0.0144
NP_441557.1_5 Reverse -261 -270 10.1278 0.0188
NP_441590.1_1 Reverse -293 -312 12.4875 0.256
NP_441590.1_4 Reverse -41 -60 14.0599 0.183
NP_441590.1_4 Reverse -305 -324 9.83173 0.249
NP_441590.1_4 Reverse -299 -318 9.14342 0.249
NP_441590.1_4 Forward -386 -367 4.03023 0.29
NP_442777.1_1 Reverse -344 -363 12.6833 0.194
NP_441308.1_3 Forward -41 -22 8.16093 0.263
NP_442830.1_5 Reverse -39 -53 12.8803 0.168
NP_442830.1_5 Forward -262 -248 4.42388 0.239
NP_442183.1_1 Reverse -261 -275 10.1277 0.0888
NP_442166.1_3 Forward -316 -297 -5.31042 0.264
NP_441459.1_3 Reverse -285 -304 10.2621 0.296
NP_441574.1_1 Forward -318 -299 -3.93378 0.246
NP_441574.1_1 Reverse -261 -280 -5.99873 0.272
NP_441549.1_9 Reverse -339 -357 -9.81395 0.261
NP_442347.1_2 Reverse -262 -271 13.3727 0.056
NP_442347.1_2 Forward -269 -260 4.71961 0.266
NP_442645.1_2 Reverse -253 -272 -22.3217 0.29
NP_442594.1_8 Forward -324 -305 1.86774 0.295
NP_440151.1_2 Forward -329 -311 14.2763 0.277
NP_441633.1_3 Reverse -259 -272 8.47575 0.0377
NP_441633.1_3 Forward -272 -259 1.39592 0.109
NP_440136.1_2 Reverse -262 -269 6.43063 0.154
NP_440136.1_2 Forward -269 -262 6.23397 0.171
NP_442998.1_2 Reverse -304 -323 5.30853 0.257
NP_442998.1_5 Reverse -331 -341 12.9597 0.158
NP_442998.1_10 Reverse -263 -270 5.93897 0.206
NP_442998.1_10 Forward -268 -261 5.84064 0.235
NP_441799.1_1 Reverse -257 -271 7.57046 0.138
NP_441799.1_1 Forward -274 -260 7.17714 0.149
NP_441799.1_4 Reverse -340 -359 0.982764 0.194
NP_441799.1_4 Reverse -295 -314 -5.80207 0.238
NP_441007.1_10 Forward -317 -304 6.60746 0.161
NP_440256.1_1 Reverse -258 -277 -6.68705 0.217
NP_441559.1_8 Forward -265 -251 -2.55701 0.192
NP_441559.1_8 Forward -347 -333 -5.9986 0.271
NP_441559.1_8 Forward -55 -41 -6.88358 0.281
NP_441270.1_5 Forward -322 -303 12.3111 0.237
NP_441395.1_4 Forward -168 -149 18.9765 0.163
NP_440915.1_6 Forward -83 -69 -3.54032 0.298
NP_442158.1_4 Reverse -360 -370 10.8948 0.283
NP_442158.1_4 Reverse -273 -283 10.3048 0.299
NP_440164.1_1 Reverse -144 -163 4.03102 0.26
NP_440164.1_5 Reverse -34 -53 0.491109 0.211
NP_441704.1_8 Reverse -197 -216 6.29183 0.262
NP_440748.1_5 Reverse -264 -283 -0.0988766 0.253
NP_441464.1_1 Reverse -340 -359 7.07928 0.27
NP_441464.1_8 Reverse -283 -297 5.1128 0.26
NP_441464.1_10 Reverse -243 -257 12.3893 0.201
NP_442993.1_1 Reverse -261 -277 -8.10294 0.153
NP_442993.1_1 Forward -270 -254 -9.67623 0.19
NP_442386.1_9 Reverse -387 -396 10.324 0.132
NP_442386.1_9 Reverse -260 -269 6.29249 0.226
NP_442386.1_9 Forward -271 -262 6.19416 0.23
NP_442386.1_10 Forward -353 -340 3.46087 0.273
NP_441340.1_5 Forward -269 -262 5.93897 0.198
NP_441340.1_5 Reverse -262 -269 5.84064 0.208
NP_441340.1_5 Forward -233 -226 3.97235 0.274
NP_442791.1_5 Forward -326 -307 -7.27704 0.279
NP_440327.1_6 Reverse -264 -283 4.62101 0.272
NP_440327.1_6 Forward -312 -293 4.03102 0.276
NP_441160.1_1 Forward -300 -281 -5.9004 0.24
NP_440586.1_1 Forward -319 -300 -0.4922 0.237
NP_440586.1_1 Forward -325 -306 -2.85214 0.259
NP_440586.1_8 Forward -269 -262 11.1501 0.0845
NP_440586.1_8 Forward -233 -226 9.57686 0.146
NP_442251.1_6 Forward -269 -262 13.7071 0.0268
NP_442251.1_6 Reverse -192 -199 8.10225 0.245
NP_440192.1_5 Forward -319 -300 12.8808 0.116
NP_440684.1_9 Forward -276 -262 7.37441 0.266
NP_440027.1_3 Reverse -306 -324 7.09821 0.214
NP_440027.1_3 Reverse -282 -300 1.98502 0.295
NP_443051.1_1 Forward -271 -262 0.688044 0.134
NP_443051.1_1 Reverse -260 -269 0.589713 0.143
NP_439996.1_6 Forward -322 -303 12.675 0.169
NP_439937.1_9 Forward -261 -244 -17.0714 0.291
NP_442294.1_3 Forward -345 -331 13.5686 0.269
NP_441740.2_4 Forward -259 -240 18.1907 0.185
NP_440439.1_1 Forward -273 -260 -1.35735 0.263
NP_442239.1_8 Forward -319 -300 14.2574 0.227
NP_442239.1_8 Forward -322 -303 13.5691 0.231
NP_439943.1_7 Forward -55 -36 4.22769 0.278
NP_440372.1_2 Forward -269 -262 6.62729 0.151
NP_440372.1_2 Reverse -262 -269 6.52896 0.188
NP_441181.1_6 Reverse -262 -280 5.72234 0.221
NP_441803.1_2 Reverse -301 -320 4.12936 0.181
NP_440589.1_3 Forward -66 -47 5.50599 0.224
NP_440139.1_1 Forward -276 -257 7.17681 0.136
NP_441572.1_1 Reverse -259 -278 -1.57384 0.212
NP_440267.1_2 Forward -275 -261 10.1271 0.15
NP_442384.1_10 Forward -270 -257 10.934 0.0399
NP_442114.1_8 Reverse -98 -112 3.73557 0.281
NP_441018.1_7 Forward -301 -282 13.4708 0.135
NP_442262.1_10 Forward -241 -234 8.39725 0.234
NP_441689.1_5 Forward -399 -389 5.68278 0.215
NP_440163.1_10 Forward -273 -263 11.3864 0.169
NP_440344.1_10 Forward -277 -260 7.512 0.0133
NP_440075.1_2 Forward -391 -372 1.86774 0.292
NP_440487.1_1 Reverse -24 -43 6.78429 0.102
NP_441965.1_10 Forward -273 -257 1.92682 0.297
NP_440297.1_9 Reverse -262 -272 -0.511621 0.289
NP_440350.1_2 Reverse -260 -279 20.059 0.039
NP_442280.1_10 Forward -338 -320 6.23363 0.28
NP_442280.1_10 Reverse -231 -249 5.84403 0.281
NP_441896.1_3 Reverse -252 -271 -1.08219 0.252
NP_441103.1_9 Forward -338 -328 12.4895 0.291
NP_440894.1_10 Reverse -256 -275 6.98095 0.209
NP_440894.1_10 Reverse -361 -380 2.85105 0.281
NP_440999.1_2 Reverse -321 -340 13.4708 0.177
NP_440888.1_2 Reverse -261 -275 12.192 0.0495
NP_442892.1_9 Forward -163 -149 14.3553 0.293
NP_440179.1_6 Forward -269 -250 9.3409 0.191
NP_440052.1_8 Forward -320 -301 18.9773 0.0498
NP_440052.1_8 Forward -323 -304 7.96426 0.296
NP_442277.1_7 Forward -149 -133 -0.375166 0.224
NP_442033.1_10 Reverse -376 -395 -12.4886 0.271
NP_441949.1_2 Forward -280 -261 2.16274 0.261
NP_440575.1_1 Forward -160 -141 0.0970122 0.29
NP_441543.1_2 Forward -269 -260 15.4377 0.00784
NP_441543.1_2 Reverse -262 -271 8.65285 0.0968
NP_442845.1_2 Reverse -219 -233 6.98109 0.199
NP_440982.1_1 Reverse -308 -327 4.52188 0.294
NP_441469.1_8 Forward -271 -262 12.8811 0.0929
NP_441469.1_8 Reverse -260 -269 6.68623 0.227
NP_442315.1_1 Forward -317 -299 5.03403 0.256
NP_443064.1_6 Forward -270 -260 8.6886 0.276
NP_442337.1_8 Forward -335 -316 0.196116 0.255
NP_442337.1_8 Forward -330 -311 -2.0655 0.293
NP_442578.1_7 Forward -269 -262 12.5271 0.0544
NP_440710.1_1 Reverse -33 -51 -9.12563 0.294
NP_441462.1_2 Forward -270 -260 1.84832 0.081
NP_441462.1_2 Reverse -261 -271 1.74999 0.0811
NP_443062.1_1 Reverse -261 -279 14.0063 0.0538
NP_441601.1_4 Forward -43 -24 -0.39387 0.275
NP_442204.1_5 Reverse -251 -270 0.196116 0.27
NP_440504.1_6 Reverse -163 -181 5.72158 0.262
NP_442872.1_1 Forward -287 -268 0.196116 0.184
NP_440516.1_8 Forward -270 -261 7.17789 0.0754
NP_440516.1_8 Reverse -261 -270 7.07956 0.0867
NP_441785.1_1 Reverse -261 -275 14.0957 0.17
NP_442428.1_5 Reverse -262 -269 13.1171 0.038
NP_442428.1_5 Forward -269 -262 6.23397 0.201
NP_442428.1_5 Reverse -226 -233 4.46401 0.267
NP_441443.1_7 Forward -324 -305 0.0977854 0.245
NP_440455.1_2 Reverse -129 -142 15.265 0.274
NP_442823.1_8 Reverse -40 -59 13.4708 0.259
NP_440673.1_3 Reverse -263 -270 10.1672 0.149
NP_441052.1_2 Reverse -261 -271 8.23984 0.0482
NP_441052.1_2 Forward -270 -260 7.45319 0.0712
NP_441052.1_2 Reverse -41 -51 -0.806614 0.299
NP_440992.1_2 Forward -387 -368 10.8159 0.268
NP_442219.1_9 Reverse -262 -271 5.11294 0.186
NP_440592.1_2 Forward -282 -263 1.17943 0.271
NP_440436.1_4 Forward -233 -224 9.73406 0.0871
NP_440436.1_4 Forward -269 -260 8.65242 0.0997
NP_440436.1_4 Reverse -262 -271 8.35743 0.109
NP_440314.1_9 Forward -269 -250 -5.70374 0.225
NP_441719.1_4 Forward -269 -262 6.62729 0.151
NP_441719.1_4 Reverse -262 -269 6.52896 0.188
NP_441004.1_1 Forward -327 -308 -0.983855 0.124
NP_441004.1_1 Forward -312 -293 -14.4552 0.268
NP_441004.1_1 Forward -318 -299 -14.5535 0.268
NP_441004.1_1 Forward -32 -13 -16.9135 0.287
NP_441004.1_4 Forward -29 -19 10.3048 0.254
NP_441004.1_5 Forward -30 -16 11.0127 0.241
NP_441004.1_5 Forward -325 -311 7.66941 0.284
NP_442366.1_3 Reverse -260 -278 5.13236 0.0891
NP_442366.1_3 Forward -235 -217 -4.8974 0.278
NP_441437.1_1 Forward -49 -30 7.57094 0.268
NP_440129.1_10 Forward -277 -263 3.53951 0.194
NP_442206.1_7 Reverse -361 -380 10.1275 0.295
NP_442206.1_10 Reverse -379 -394 -0.216765 0.287
NP_443054.1_2 Forward -251 -237 5.21113 0.237
NP_443054.1_2 Forward -272 -258 1.86788 0.245
NP_441966.1_7 Reverse -293 -312 -0.0996487 0.253
NP_440864.1_9 Forward -333 -314 -6.58872 0.259
NP_441851.1_10 Forward -271 -261 6.66654 0.159
NP_441851.1_10 Reverse -260 -270 6.66654 0.159
NP_442011.1_1 Forward -271 -252 -2.75381 0.282
NP_442515.1_1 Forward -271 -257 -2.75368 0.279
NP_442515.1_1 Reverse -40 -54 -3.83532 0.298
NP_441396.1_5 Reverse -274 -283 8.35786 0.224
NP_441396.1_5 Forward -320 -311 7.27622 0.29
NP_440593.1_3 Forward -340 -321 -3.14714 0.233
NP_440463.1_7 Reverse -38 -52 15.0442 0.29
NP_442689.1_8 Forward -158 -141 -7.43431 0.292
NP_441349.1_10 Reverse -241 -260 -9.83364 0.297
NP_440432.1_9 Reverse -226 -241 -0.0201027 0.163
NP_439960.1_3 Reverse -16 -35 2.75272 0.263
NP_440474.1_8 Reverse -262 -276 4.91554 0.263
NP_442450.1_5 Reverse -259 -269 5.48657 0.242
NP_442168.1_4 Reverse -38 -52 17.3058 0.264
NP_440588.1_3 Forward -302 -283 11.0125 0.253
NP_440588.1_3 Reverse -214 -233 8.55425 0.296
NP_440954.1_1 Forward -312 -293 -5.31042 0.289
NP_442006.1_2 Reverse -325 -342 -10.7776 0.197
NP_441003.1_9 Forward -42 -23 4.03102 0.29
NP_443047.1_7 Forward -78 -59 5.30933 0.245
NP_441570.1_1 Reverse -261 -279 -1.84914 0.0598
NP_441078.1_4 Forward -270 -261 10.1278 0.016
NP_441078.1_4 Reverse -261 -270 9.83282 0.0226
NP_441078.1_4 Reverse -41 -50 -1.57357 0.266
NP_441539.1_1 Forward -172 -158 10.8154 0.294
NP_441539.1_10 Forward -87 -68 -2.16383 0.187
NP_441663.1_7 Reverse -258 -277 5.60432 0.236
NP_442348.1_2 Reverse -251 -260 14.5527 0.147
NP_440707.1_9 Forward -317 -298 2.65439 0.268
NP_442443.1_1 Forward -317 -298 0.884433 0.215
NP_442443.1_1 Forward -314 -295 -2.75381 0.262
NP_442443.1_1 Forward -42 -23 -4.72043 0.276
NP_441432.1_8 Forward -271 -262 5.21127 0.185
NP_442320.1_8 Forward -276 -262 3.14618 0.0674
NP_442344.1_7 Forward -269 -250 2.16274 0.0644
NP_441030.1_4 Forward -155 -136 6.2543 0.277
NP_440760.1_1 Forward -270 -251 -20.8467 0.225
NP_440760.1_1 Reverse -225 -244 -22.2233 0.252
NP_442797.1_1 Reverse -299 -318 7.47261 0.141
NP_440199.1_10 Forward -273 -263 12.6647 0.119
NP_441945.1_10 Reverse -263 -282 10.9142 0.238
NP_441057.1_3 Forward -58 -39 -1.27885 0.138
NP_440913.1_3 Reverse -306 -319 17.2272 0.184
NP_443011.1_4 Forward -313 -294 9.24257 0.225
NP_442751.1_1 Reverse -304 -323 17.1198 0.222
NP_441072.1_2 Reverse -214 -233 12.1925 0.173
NP_442489.1_2 Reverse -214 -233 3.24438 0.242
NP_442489.1_7 Forward -270 -261 10.4228 0.0151
NP_442489.1_7 Reverse -261 -270 10.3245 0.0193
NP_442489.1_7 Forward -50 -41 -1.6719 0.235
NP_441830.1_2 Forward -396 -377 1.96607 0.224
NP_440565.1_3 Forward -338 -319 16.3539 0.218
NP_440559.1_1 Reverse -226 -235 4.42462 0.277
NP_441659.2_8 Forward -270 -260 2.24165 0.207
NP_441659.2_8 Reverse -261 -271 2.14332 0.211
NP_441659.2_8 Forward -234 -224 0.865012 0.256
NP_441040.1_2 Forward -337 -318 -9.73531 0.238
NP_441040.1_5 Reverse -315 -334 2.94938 0.275
NP_441040.1_5 Reverse -36 -55 2.45773 0.282
NP_441800.1_7 Reverse -301 -319 11.3272 0.113
NP_442346.1_5 Forward -235 -225 12.7631 0.0366
NP_442346.1_5 Forward -271 -261 5.68323 0.234
NP_442346.1_5 Reverse -260 -270 4.60159 0.281
NP_441786.1_3 Reverse -321 -340 5.89931 0.29
NP_440486.1_6 Forward -379 -360 5.70265 0.293
NP_440010.1_4 Reverse -302 -321 3.9319 0.22
NP_440010.1_4 Forward -286 -267 0.981987 0.243
NP_440010.1_4 Reverse -299 -318 -0.00131823 0.25
NP_442137.1_5 Forward -55 -41 18.8791 0.216
NP_442551.1_4 Reverse -280 -295 -3.75668 0.295
NP_443022.1_2 Forward -349 -330 13.9616 0.251
NP_441948.1_4 Forward -277 -259 -1.75081 0.152
NP_441833.1_4 Reverse -262 -269 6.3323 0.134
NP_441833.1_4 Forward -269 -262 6.23397 0.163
NP_441329.1_6 Reverse -91 -110 -0.525629 0.278
NP_441329.1_6 Reverse -146 -165 -1.95801 0.293
NP_442162.1_9 Forward -269 -262 6.52896 0.178
NP_442162.1_9 Reverse -262 -269 6.43063 0.208
NP_440772.1_8 Forward -260 -241 9.53756 0.253
NP_442045.1_5 Forward -338 -319 3.04771 0.239
NP_440204.1_1 Reverse -247 -266 2.75272 0.278
NP_442199.1_5 Forward -278 -259 14.8474 0.0369
NP_442140.1_3 Forward -233 -223 6.66654 0.159
NP_442140.1_3 Forward -269 -259 6.46988 0.168
NP_441813.1_5 Forward -272 -262 7.45319 0.0746
NP_441813.1_5 Reverse -259 -269 0.0783647 0.222
NP_440590.1_4 Forward -269 -256 0.805932 0.143
NP_442839.1_3 Reverse -147 -165 26.8352 0.00204
NP_442839.1_4 Reverse -53 -67 19.7634 0.292
NP_442497.1_10 Forward -269 -260 0.688044 0.141
NP_442497.1_10 Reverse -262 -271 0.589713 0.153
NP_440821.1_4 Forward -272 -262 9.32148 0.03
NP_440821.1_4 Reverse -259 -269 0.57002 0.169
NP_441239.1_9 Forward -272 -260 6.1355 0.2
NP_441239.1_9 Forward -354 -342 5.64384 0.213
NP_441239.1_9 Reverse -259 -271 5.25052 0.223
NP_441239.1_9 Forward -28 -16 3.97222 0.269
NP_441239.1_9 Forward -331 -319 3.77555 0.276
NP_441951.1_4 Forward -327 -308 0.294447 0.297
NP_442691.1_2 Reverse -335 -354 10.3242 0.139
NP_440400.1_1 Reverse -300 -319 0.686995 0.27
NP_440400.1_1 Reverse -303 -322 -1.67294 0.285
NP_441892.1_8 Forward -281 -262 16.4199 0.248
NP_441892.1_10 Reverse -240 -259 10.7175 0.262
NP_440665.1_1 Reverse -264 -283 -12.6852 0.251
NP_442044.1_1 Reverse -292 -311 -13.8652 0.28
NP_442193.1_1 Forward -324 -306 9.26226 0.249
NP_440219.1_1 Forward -168 -149 15.7062 0.158
NP_442138.1_9 Reverse -40 -59 8.35677 0.267
NP_442138.1_10 Reverse -261 -280 2.85105 0.115
NP_440412.1_1 Forward -324 -305 18.289 0.0792
NP_440546.1_4 Forward -234 -224 8.78555 0.171
NP_440546.1_6 Reverse -327 -346 8.84924 0.253
NP_442041.1_5 Reverse -331 -350 2.85105 0.246
NP_440675.1_3 Reverse -261 -280 11.9958 0.17
NP_440675.1_10 Reverse -364 -383 10.7175 0.293
NP_440462.1_4 Forward -319 -305 8.65272 0.259
NP_440462.1_6 Forward -272 -262 5.68323 0.145
NP_440462.1_6 Forward -244 -234 1.35667 0.294
NP_440868.1_4 Reverse -257 -269 0.825626 0.199
NP_440868.1_4 Forward -329 -317 0.0389777 0.234
NP_441474.1_1 Forward -283 -264 1.86696 0.247
NP_442402.1_4 Reverse -186 -205 -9.53937 0.291
NP_441084.1_6 Forward -236 -222 12.3498 0.164
NP_440696.1_3 Reverse -230 -248 -3.6191 0.287
NP_441811.1_8 Reverse -219 -233 6.58777 0.267
NP_441811.1_8 Reverse -255 -269 5.50613 0.299
NP_442679.1_1 Reverse -318 -337 -3.04881 0.248
NP_442829.1_2 Reverse -153 -169 11.1367 0.287
NP_442409.1_10 Forward -338 -324 14.8469 0.293
NP_440825.1_6 Forward -64 -45 7.7676 0.285
NP_442837.1_3 Reverse -262 -269 13.5105 0.0268
NP_442837.1_3 Forward -128 -121 6.82395 0.184
NP_442837.1_3 Forward -269 -262 6.13563 0.25
NP_440160.1_2 Reverse -40 -59 -9.44032 0.299
NP_440160.1_3 Reverse -303 -322 19.4681 0.109
NP_439994.1_4 Forward -337 -318 8.94757 0.291
NP_442053.1_1 Forward -270 -261 8.75118 0.0728
NP_442053.1_1 Reverse -261 -270 8.65285 0.0741
NP_442053.1_3 Reverse -381 -400 16.5191 0.144
NP_440505.1_3 Forward -52 -42 5.09324 0.246
NP_440914.1_1 Reverse -41 -51 11.9332 0.0746
NP_440914.1_1 Forward -270 -260 6.76087 0.267
NP_441011.1_8 Reverse -262 -271 14.1594 0.0269
NP_441011.1_8 Forward -269 -260 7.27622 0.179
NP_440303.1_6 Forward -333 -314 13.6675 0.271
NP_442533.1_1 Forward -318 -299 -12.7836 0.236
NP_442533.1_6 Forward -270 -261 14.651 0.01
NP_442533.1_6 Reverse -261 -270 7.37455 0.0898
NP_442533.1_6 Reverse -343 -352 3.44131 0.212
NP_440263.1_3 Reverse -234 -253 1.57275 0.295
NP_442322.1_4 Reverse -306 -323 -2.12512 0.228
NP_441482.1_7 Reverse -320 -334 -9.63684 0.208
NP_441697.1_5 Forward -170 -151 1.95716 0.178
NP_441697.1_5 Reverse -162 -181 -8.54695 0.263
NP_441028.1_6 Forward -338 -328 5.38779 0.255
NP_441028.1_6 Forward -287 -277 4.10949 0.278
NP_440116.1_8 Reverse -234 -253 -6.39206 0.208
NP_440007.1_9 Reverse -322 -336 1.86788 0.282
NP_441059.1_10 Reverse -323 -336 12.6056 0.226
NP_441961.1_4 Forward -315 -296 9.3409 0.259
NP_441961.1_4 Reverse -284 -303 3.53937 0.277
NP_443045.1_5 Forward -31 -18 16.7765 0.119
NP_441106.1_1 Forward -271 -262 8.45619 0.0548
NP_441106.1_1 Reverse -260 -269 8.35786 0.0585
NP_441106.1_1 Reverse -224 -233 2.26134 0.293
NP_442249.1_10 Reverse -330 -349 11.2092 0.285
NP_441286.1_1 Reverse -260 -272 -4.87757 0.18
NP_440670.1_8 Forward -270 -261 8.84951 0.0606
NP_440670.1_8 Reverse -261 -270 8.55452 0.066
NP_440886.1_7 Forward -271 -261 17.1874 0.00477
NP_440886.1_7 Reverse -260 -270 7.94438 0.0805
NP_440886.1_7 Reverse -308 -318 6.66608 0.115
NP_440886.1_7 Reverse -305 -315 6.66608 0.115
NP_440828.1_1 Reverse -305 -324 4.71854 0.21
NP_442213.1_5 Forward -323 -304 5.11266 0.231
NP_442213.1_5 Reverse -240 -259 -2.0655 0.293
NP_441808.1_8 Forward -315 -296 13.0775 0.212
NP_441808.1_8 Forward -312 -293 9.3409 0.259
NP_442022.1_4 Forward -315 -296 9.3409 0.248
NP_442022.1_4 Forward -324 -305 7.86593 0.268
NP_442022.1_4 Forward -318 -299 7.17762 0.268
NP_440907.2_8 Forward -269 -259 5.09279 0.222
NP_441463.1_3 Forward -280 -261 18.9773 0.00908
NP_441463.1_3 Forward -60 -41 -3.93378 0.189
NP_441463.1_3 Forward -221 -202 -7.37537 0.257
NP_441626.1_2 Forward -269 -262 6.0373 0.212
NP_441626.1_2 Reverse -262 -269 5.93897 0.231
NP_441988.1_2 Reverse -291 -310 12.7825 0.239
NP_441589.1_4 Reverse -289 -308 19.2723 0.128
NP_442794.1_1 Forward -280 -268 3.48056 0.286
NP_442794.1_1 Forward -391 -379 3.08724 0.286
NP_442615.1_1 Reverse -252 -270 2.96908 0.0595
NP_441962.1_4 Forward -31 -12 -14.4552 0.288
NP_440387.1_1 Forward -270 -254 3.40179 0.0591
NP_441431.1_2 Reverse -345 -359 9.83206 0.176
NP_441836.1_2 Reverse -270 -289 -1.86883 0.223
NP_440634.1_10 Forward -282 -263 7.57013 0.24
NP_441993.1_1 Reverse -219 -238 5.55261 0.2
NP_440114.1_10 Reverse -225 -239 8.94771 0.19
NP_440114.1_10 Reverse -261 -275 6.09611 0.285
NP_441425.1_2 Forward -163 -144 13.7008 0.243
NP_442090.1_2 Reverse -135 -154 5.77684 0.296
NP_442357.1_1 Forward -369 -350 10.8159 0.254
NP_440754.1_3 Forward -317 -299 15.3588 0.102
NP_441510.2_2 Reverse -302 -321 10.6184 0.16
NP_440287.1_6 Reverse -252 -271 1.67108 0.266
NP_440293.1_3 Forward -314 -295 -4.32711 0.262
NP_440293.1_3 Forward -359 -340 -4.72043 0.264
NP_440293.1_9 Forward -334 -320 17.6254 0.119
NP_440293.1_10 Forward -324 -305 2.85105 0.219
NP_440293.1_10 Forward -318 -299 -0.688862 0.255
NP_439910.1_2 Forward -278 -261 -12.0559 0.0788
NP_442867.1_8 Forward -41 -22 7.57094 0.242
NP_440801.1_9 Reverse -244 -258 13.2231 0.285
NP_441984.1_6 Reverse -314 -326 14.002 0.258
NP_440054.1_4 Forward -278 -259 14.0608 0.148
NP_442509.1_9 Reverse -261 -271 16.1058 0.00871
NP_442509.1_9 Forward -270 -260 7.15773 0.234
NP_441253.1_8 Forward -362 -348 10.7645 0.282
NP_440734.1_9 Reverse -282 -301 14.8474 0.201
NP_440554.1_4 Reverse -262 -272 4.99491 0.167
NP_441845.1_6 Forward -282 -264 -0.570838 0.274
NP_442737.1_5 Reverse -266 -285 12.5881 0.261
NP_441885.1_5 Forward -270 -260 2.04498 0.0868
NP_441885.1_5 Reverse -261 -271 1.65166 0.106
NP_441885.1_5 Reverse -41 -51 0.0783647 0.183
NP_441428.1_8 Reverse -34 -53 10.2259 0.178
NP_442341.1_7 Forward -271 -257 14.4542 0.0298
NP_443000.1_7 Forward -272 -262 5.87989 0.126
NP_440507.2_3 Forward -279 -260 10.1267 0.208
NP_443059.1_10 Forward -284 -265 -0.29631 0.275
NP_441561.1_4 Reverse -346 -365 8.35759 0.202
NP_440091.1_1 Forward -274 -262 15.2803 0.0189
NP_440679.1_10 Forward -319 -300 -9.44032 0.18
NP_440679.1_10 Forward -313 -294 -20.7484 0.286
NP_440679.1_10 Forward -316 -297 -21.4367 0.294
NP_442451.1_2 Reverse -290 -309 -1.18052 0.169
NP_440175.1_7 Forward -333 -315 9.46071 0.28
NP_440149.1_8 Reverse -261 -280 -7.57203 0.288
NP_441105.1_3 Forward -340 -321 3.04771 0.0936
NP_441105.1_3 Forward -61 -42 -9.63698 0.292
NP_441105.1_3 Forward -363 -344 -10.0303 0.3
NP_442373.1_1 Reverse -31 -50 5.50599 0.171
NP_442373.1_2 Forward -321 -302 -9.73531 0.265
NP_440216.1_1 Reverse -261 -275 -3.54032 0.0833
NP_440216.1_1 Forward -270 -256 -12.0951 0.24
NP_440216.1_1 Forward -50 -36 -12.6851 0.296
NP_440216.1_9 Reverse -322 -331 6.78456 0.289
NP_440172.1_1 Forward -270 -260 5.87989 0.127
NP_441008.1_4 Reverse -300 -319 16.0302 0.295
NP_442015.1_10 Reverse -257 -270 -0.865694 0.285
NP_441111.1_7 Forward -269 -261 8.96754 0.0463
NP_441111.1_7 Reverse -262 -270 8.86921 0.0589
NP_441766.1_2 Forward -270 -261 7.86621 0.0703
NP_441766.1_2 Reverse -261 -270 7.66954 0.0723
NP_442252.1_3 Forward -277 -259 14.3755 0.0882
NP_440416.1_9 Forward -336 -317 -1.7705 0.0669
NP_443052.1_8 Forward -280 -261 -2.16383 0.0871
NP_443052.1_9 Reverse -302 -321 -0.787193 0.216
NP_443052.1_9 Reverse -299 -318 -1.96717 0.231
NP_443052.1_9 Reverse -293 -312 -3.83545 0.252
NP_443052.1_9 Reverse -296 -315 -5.9004 0.274
NP_440072.1_5 Forward -318 -300 -1.94747 0.267
NP_440072.1_5 Forward -321 -303 -3.6191 0.281
NP_442116.1_6 Reverse -152 -169 10.4608 0.221
NP_442116.1_6 Forward -169 -152 8.26445 0.254
NP_442403.1_8 Reverse -263 -282 24.3855 0.00853
NP_442154.1_1 Forward -320 -302 4.73903 0.0591
NP_442154.1_1 Forward -323 -305 2.28076 0.0772
NP_442154.1_1 Forward -317 -299 -4.70074 0.125
NP_442154.1_1 Forward -311 -293 -12.1739 0.217
NP_442154.1_1 Forward -64 -46 -16.8938 0.246
NP_440261.1_5 Forward -269 -256 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAAGGCATCCCTGGTAACGGCGTAGCTGACCAAGGTCAAATTAGCGGGGGCCTGGCTAGCATTTTCCCCTTGCCCTGGCTCGGTGGTGGTGGTGGTGTTGCAAGCGGTGATACTGCCCACCATCAAAACGGCGATCACCGAAAATCCCCAGCCAAAAGCAGATCGAGCCATCGTTAACTCCTTGAAATTGTGACCTGTGTGTAATCTCGATAAATCATAGTTGAATTTGAAATGTTTTGCAATTTATTTTTAAAATGCACATAAAAATATTTTGCTCGCATCGTTAATGTTTTGTTATTCGTGTGAATTCTCCGTTCTGTCGGGATTCGGTCTGTGTCATGATTGAGCTGGGGTTTGCCCGACCGTGAACTGGGGCACTGGACGTTATCTCTGAGTTCT

CDS

ATGGCTAAACGATCGCCTGCTTTATCCCCTGCCCTGCCGGAACGATTAGTGCAAGAAAGCTATCTTTTTCGGGGCATGGATCTCCCCTTGGTGGCGGATTATCTTGCTTCAGCAGAACTTAAAATCGAAAAACTGTTTTCCAATCGACCCATTTACACTGCATTTCTGCCGGATCAAACCCTGGATAATCTTTATGTGATGTTGGATGATGGTGTCGTCATCACCCGTAGCACTCCTCTGGACCGCATCATTGCCATTAACTATGCTGGCAGTTGCTTTGGTTGGCGCAGTTTGCCCTTTAGCTATGGTTTGGCCAGTAAATCTTTTCCTTGTTCTGTCGAGGTTTATAAGACCACCCACGTCATTAAAATTCCCCTCGCTACTGTTGAGCAAATTTATGAAAATAGCGAAATTTTTCGGGAACGGTATCGTTTTCTATTTGAATTACAACAAAAATTTGAATATCATCTGCTCAATTGCAGTACCTACCCTCCCCAAGCGGTGGCGAGTTTACTGCGGGCGTTGATTTATCAAGAAAGAGAACTGGGCAACCAACCCGATCGCCAGGGGAATTATATTTTCGATTTGCCCATTGATATGATCGCCAGGGCTTGCCAGCTCAATCAAAGAACGGTGGAGCAGGTGCTGAAGGGTATGCAAAAACACCATCTGATTGCCATTCCCAAGGGAGAAAAAGAAGACTTAATTCAAATTCTGGCCCCGGAAGGACTCAAGGAAGTTTACAGTGCCACCCGGGAAAAGGTTAACTGGTGGCCCTTGAAATAA

Protein

MAKRSPALSPALPERLVQESYLFRGMDLPLVADYLASAELKIEKLFSNRPIYTAFLPDQTLDNLYVMLDDGVVITRSTPLDRIIAINYAGSCFGWRSLPFSYGLASKSFPCSVEVYKTTHVIKIPLATVEQIYENSEIFRERYRFLFELQQKFEYHLLNCSTYPPQAVASLLRALIYQERELGNQPDRQGNYIFDLPIDMIARACQLNQRTVEQVLKGMQKHHLIAIPKGEKEDLIQILAPEGLKEVYSATREKVNWWPLK