Your browser is old and dusty. Try Google Chrome!

Details for sll1358

ORF sll1358
Accession NP_440870.1
Symbol
Category putative oxalate decarboxylase, periplasmic protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -240 -221 -21.535 0.153
NP_441418.1_6 Reverse -191 -210 -29.1065 0.216
NP_441818.1_1 Forward -277 -266 10.0879 0.232
NP_443027.1_4 Forward -317 -307 6.46988 0.275
NP_440878.1_9 Forward -157 -138 -0.295539 0.209
NP_439918.1_2 Reverse -121 -140 4.62101 0.163
NP_441083.1_5 Reverse -383 -393 5.19158 0.123
NP_441083.1_5 Forward -392 -382 -0.118297 0.256
NP_440870.1_1 Forward -34 -17 30.3248 0.000486
NP_440870.1_2 Forward -54 -35 30.8754 0.000145
NP_440870.1_3 Forward -116 -97 30.5804 0.000147
NP_440870.1_4 Forward -327 -309 26.3718 0.00131
NP_440870.1_5 Forward -137 -118 28.6138 0.000329
NP_440870.1_6 Forward -254 -240 24.0907 0.0322
NP_440870.1_8 Forward -347 -330 25.8999 0.00265
NP_442059.1_10 Forward -350 -331 17.994 0.0872
NP_440747.1_10 Reverse -380 -392 -4.48425 0.101
NP_440470.1_5 Forward -193 -174 5.87233 0.291
NP_440842.1_6 Forward -242 -223 17.5015 0.12
NP_441634.1_8 Reverse -310 -324 9.73436 0.0978
NP_441588.1_4 Forward -198 -188 7.35486 0.178
NP_441077.1_2 Reverse -167 -186 3.19856 0.251
NP_440607.1_4 Forward -127 -108 7.7676 0.217
NP_442937.1_5 Forward -397 -378 9.14423 0.202
NP_442690.1_1 Forward -183 -164 -9.14533 0.194
NP_442690.1_1 Forward -193 -174 -17.1101 0.297
NP_442911.1_2 Reverse -373 -392 -8.85033 0.244
NP_440993.1_3 Forward -210 -191 2.55527 0.203
NP_442438.1_10 Reverse -198 -212 9.04604 0.0692
NP_440147.1_4 Forward -242 -229 -0.37404 0.282
NP_441916.1_5 Reverse -375 -394 15.9291 0.273
NP_441041.1_4 Forward -231 -212 -12.1936 0.26
NP_441725.1_5 Forward -277 -267 0.176696 0.206
NP_441725.1_5 Forward -146 -136 -1.29827 0.299
NP_439966.1_7 Reverse -315 -325 5.78111 0.209
NP_439966.1_7 Forward -280 -270 4.69947 0.263
NP_440723.1_4 Forward -203 -184 -11.0136 0.284
NP_441644.1_6 Forward -200 -190 8.43603 0.0998
NP_441644.1_6 Forward -392 -382 3.51951 0.277
NP_442215.1_2 Reverse -362 -378 -2.10475 0.192
NP_442215.1_2 Reverse -304 -320 -3.38305 0.214
NP_440929.1_8 Forward -326 -317 4.52295 0.182
NP_440929.1_8 Forward -278 -269 3.04799 0.238
NP_440576.1_5 Forward -394 -375 8.84924 0.276
NP_442554.1_8 Reverse -307 -317 2.43831 0.272
NP_442476.1_6 Reverse -270 -284 1.57289 0.211
NP_443009.1_2 Reverse -193 -212 -4.03212 0.245
NP_440379.1_5 Reverse -106 -125 -9.63698 0.264
NP_441468.1_1 Forward -325 -318 8.79057 0.111
NP_441826.1_2 Forward -231 -217 -0.000409212 0.201
NP_441764.1_8 Reverse -277 -287 10.8322 0.297
NP_442505.1_2 Reverse -44 -63 16.3242 0.175
NP_440558.1_2 Reverse -308 -327 4.42435 0.152
NP_440558.1_2 Reverse -284 -303 -3.44213 0.236
NP_440558.1_2 Forward -324 -305 -5.80207 0.264
NP_441458.1_8 Forward -185 -166 2.77268 0.293
NP_442183.1_1 Reverse -317 -331 5.30946 0.223
NP_441819.1_5 Forward -111 -92 8.92807 0.287
NP_442645.1_2 Reverse -375 -394 -22.715 0.293
NP_441037.1_4 Forward -355 -345 8.58464 0.237
NP_440136.1_2 Forward -325 -318 4.16902 0.234
NP_440299.1_1 Forward -319 -306 2.08368 0.299
NP_442802.1_6 Reverse -190 -209 9.73422 0.0905
NP_440525.1_1 Forward -114 -95 11.9958 0.224
NP_440026.1_8 Reverse -110 -128 14.2771 0.223
NP_441939.1_4 Forward -292 -273 13.9891 0.221
NP_441939.1_6 Forward -317 -298 15.1416 0.292
NP_442386.1_9 Forward -279 -270 9.04574 0.175
NP_442386.1_9 Forward -322 -313 5.50585 0.25
NP_441340.1_9 Reverse -277 -287 9.99054 0.236
NP_441340.1_9 Reverse -170 -180 8.25522 0.256
NP_441027.1_1 Reverse -228 -242 10.9137 0.277
NP_443051.1_1 Reverse -268 -277 3.24465 0.123
NP_441740.2_1 Forward -131 -112 18.879 0.101
NP_439943.1_1 Reverse -345 -364 -11.3086 0.29
NP_439943.1_4 Forward -38 -19 7.27595 0.265
NP_439977.1_5 Reverse -311 -330 -0.885524 0.236
NP_442384.1_10 Reverse -110 -123 1.69091 0.249
NP_441877.1_5 Reverse -279 -298 1.67108 0.276
NP_441335.1_8 Reverse -311 -330 6.09597 0.294
NP_441640.1_8 Forward -230 -211 0.0977854 0.196
NP_440297.1_9 Forward -146 -136 4.69992 0.223
NP_440297.1_9 Forward -277 -267 -0.216628 0.282
NP_442280.1_10 Reverse -349 -367 10.8114 0.217
NP_441896.1_3 Forward -287 -268 -0.787193 0.247
NP_440491.1_1 Reverse -110 -129 9.54836 0.21
NP_442845.1_2 Reverse -306 -320 8.45605 0.195
NP_441319.1_3 Forward -215 -196 14.3558 0.217
NP_441601.1_2 Forward -398 -379 2.85105 0.219
NP_440516.1_8 Reverse -191 -200 -0.295266 0.232
NP_441867.1_2 Forward -341 -322 -15.2418 0.291
NP_440673.1_7 Forward -385 -366 -0.4922 0.298
NP_441670.1_2 Reverse -327 -346 14.6508 0.286
NP_442206.1_1 Forward -209 -190 -14.3569 0.269
NP_441851.1_10 Reverse -268 -278 4.20827 0.282
NP_442622.1_8 Forward -278 -260 -19.1554 0.296
NP_441477.1_10 Reverse -109 -127 9.0656 0.181
NP_441031.1_1 Reverse -91 -110 9.52211 0.212
NP_441539.1_2 Forward -34 -15 18.879 0.17
NP_441432.1_8 Reverse -382 -391 5.3096 0.17
NP_441432.1_9 Reverse -153 -166 8.01662 0.295
NP_440760.1_1 Forward -374 -355 -16.5201 0.179
NP_442274.1_8 Reverse -224 -242 13.3789 0.286
NP_442400.1_1 Reverse -314 -333 -6.1954 0.299
NP_442489.1_7 Forward -392 -383 -1.86856 0.259
NP_440545.1_3 Reverse -227 -244 -7.04099 0.295
NP_440847.1_8 Forward -331 -312 18.9773 0.129
NP_442603.1_7 Reverse -191 -205 7.76712 0.195
NP_441329.1_6 Forward -344 -325 0.524783 0.253
NP_442140.1_3 Forward -199 -189 7.74818 0.13
NP_441813.1_5 Forward -280 -270 5.78156 0.109
NP_440590.1_4 Reverse -192 -205 -1.35735 0.218
NP_440821.1_4 Forward -328 -318 5.78156 0.106
NP_440821.1_4 Reverse -267 -277 -0.314959 0.251
NP_441239.1_9 Forward -323 -311 11.052 0.0672
NP_441239.1_9 Forward -280 -268 8.49544 0.131
NP_441239.1_9 Forward -328 -316 4.36554 0.253
NP_441017.1_6 Forward -145 -131 11.2087 0.273
NP_441874.1_1 Reverse -187 -201 8.45605 0.298
NP_440833.1_6 Reverse -279 -293 11.602 0.218
NP_442052.1_3 Forward -327 -308 10.9142 0.25
NP_441656.1_3 Reverse -121 -140 8.06259 0.293
NP_440462.1_6 Forward -280 -270 3.91327 0.224
NP_441084.1_6 Forward -234 -220 9.05325 0.295
NP_442039.1_4 Reverse -270 -277 8.10225 0.221
NP_442837.1_3 Forward -325 -318 9.77388 0.115
NP_442837.1_3 Forward -301 -294 6.13563 0.25
NP_440505.1_7 Reverse -224 -243 -2.75381 0.294
NP_442255.1_3 Reverse -220 -239 12.8808 0.19
NP_442541.1_10 Reverse -311 -325 5.01387 0.248
NP_442541.1_10 Reverse -287 -301 2.8506 0.254
NP_441697.1_5 Reverse -203 -222 -10.3613 0.278
NP_441347.1_5 Reverse -311 -325 12.782 0.238
NP_443045.1_2 Forward -153 -134 12.8808 0.287
NP_440670.1_8 Forward -392 -383 9.34117 0.0581
NP_440670.1_8 Reverse -269 -278 3.14632 0.296
NP_440404.1_9 Forward -353 -334 17.5223 0.133
NP_441021.1_1 Reverse -82 -101 -10.817 0.248
NP_440841.1_4 Reverse -381 -400 -9.24366 0.256
NP_441463.1_6 Forward -376 -362 5.54623 0.287
NP_442794.1_1 Reverse -302 -314 6.03717 0.198
NP_441962.1_9 Reverse -225 -244 6.68596 0.258
NP_441488.1_8 Reverse -186 -200 10.422 0.146
NP_441246.1_7 Reverse -115 -134 8.45592 0.197
NP_440457.1_1 Reverse -265 -277 -0.551008 0.268
NP_441885.1_5 Reverse -383 -393 -0.216628 0.189
NP_440423.1_6 Reverse -261 -280 -3.04881 0.126
NP_440552.1_8 Reverse -169 -186 15.4263 0.132
NP_440804.1_7 Reverse -166 -183 10.6578 0.217
NP_440216.1_9 Reverse -275 -284 6.29291 0.289
NP_440172.1_1 Forward -392 -382 7.15819 0.0897
NP_441226.1_7 Reverse -270 -277 9.77352 0.131
NP_440988.1_10 Reverse -310 -324 6.93189 0.228
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTATTTGCCGATTTCCAAGCCTATGTGGATTGTCAAAACCAAGTGGGAGAAGCCTATAAAGATCAGGAAAACTGGGCTCGCATGGCCATCTTAAATGTGGCTCGCATGGGTAAGTTTTCCTCGGATCGCACTATTCGGGAATACGCCGAAGACATCTGGGCTATCAAACCCGTGGTAATTGAATTAGAAGACCTCTGTCCCGATGGTCAATGTTTGTTAATTTCTCCTAATAAATAGTTACCTTAACCTGCCTCTATTGCACTGTAAAAACCCAGTCCTGAGCATCAGTTACATTTTGTTAAGACACTGTTACTGGCCCTTCAATCTTCGTTTACCGTCCAGATAAAGACAACTTTCGTCACCTTTTATCACTGGATTGTGATTATTCCAGTATCACC

CDS

ATGGTCAACTCGGTAATAGGATGGTTGAGACGGCGGTTTTTACTAGTAGGATTGAGTGTTTTACTGATAACTTTTTTAGGGATTTTTACTCCAACCATTGCCCAAAGTGAACAATGGCGATCGCTCTCCAACGTGGTTTGGGGTAAGGATTTACCAGCTTTTACCTATGCCTTTAGCAAAACTCCCCTAGTGCTTTACGACGGCGGCACCACTAAACAGGTGGGTACCTATAACTTTCCCGTCAGCAAGGGGATGGCGGGGGTTTATATGAGCTTGGAGCCCGGAGCGATTCGGGAATTACATTGGCATGCCAACGCGGCGGAATGGGCCTATGTCATGGAAGGCAGAACCCGGATTACCCTCACCAGTCCCGAAGGCAAAGTGGAAATTGCCGATGTGGACAAAGGAGGGCTTTGGTATTTTCCCCGGGGTTGGGGCCACAGCATTGAGGGCATTGGTCCCGACACTGCCAAATTTTTGCTGGTATTCAACGACGGCACCTTTTCTGAAGGGGCAACCTTTAGCGTTACTGATTGGCTTTCCCACACTCCGATCGCCTGGGTGGAAGAAAATTTAGGTTGGACGGCGGCCCAGGTAGCCCAATTACCCAAAAAACAGGTTTACATTTCCTCCTACGGCCCGGCTTCTGGCCCCTTGGCTAGCGCAACTCCCCAGGGGCAAACGGCCAAAATTGAAGTTCCCCACACCCATAATCTCCTGGGGCAACAACCCCTAGTTTCCCTGGGTGGCAACGAATTGAGGCTAGCCAGCGCCAAGGAATTTCCCGGCAGTTTTAATATGACCGGCGCTTTAATTCATTTAGAACCGGGAGCCATGCGTCAACTCCATTGGCATCCCAACGCGGACGAGTGGCAATATGTGCTCGATGGGGAGATGGATTTAACCGTTTTTGCTTCCGAAGGTAAAGCCAGCGTTAGTCGTCTCCAGCAGGGAGATGTGGGCTATGTGCCCAAGGGTTATGGCCATGCCATCCGCAACAGTTCCCAAAAGCCGTTGGATATTGTGGTGGTTTTCAATGATGGGGATTATCAAAGTATTGATCTGAGTACTTGGTTAGCTAGCAATCCTAGCTCGGTGTTGGGGAATACTTTCCAAATTTCGCCGGAATTAACTAAAAAGTTACCAGTGCAAGACACGATTTTTTCTCTACCAACCCAACCATAA

Protein

MVNSVIGWLRRRFLLVGLSVLLITFLGIFTPTIAQSEQWRSLSNVVWGKDLPAFTYAFSKTPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRITLTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWLSHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLLGQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMDLTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLASNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP