Your browser is old and dusty. Try Google Chrome!

Details for sll1344

ORF sll1344
Accession NP_442819.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -308 -322 -0.197071 0.223
NP_441061.1_10 Forward -199 -186 19.9805 0.203
NP_440557.1_1 Reverse -233 -252 15.3391 0.0613
NP_440557.1_1 Reverse -308 -327 10.4225 0.115
NP_440795.1_7 Forward -315 -308 14.6904 0.0123
NP_440795.1_7 Reverse -308 -315 14.6904 0.0123
NP_441418.1_6 Reverse -232 -251 -11.8986 0.0576
NP_441418.1_6 Forward -316 -297 -19.9617 0.0997
NP_441418.1_6 Reverse -195 -214 -20.0601 0.103
NP_440815.1_2 Forward -161 -147 10.8154 0.265
NP_440897.1_6 Forward -316 -297 -0.984623 0.187
NP_441453.1_1 Reverse -343 -361 3.75497 0.263
NP_441453.1_4 Reverse -307 -315 16.539 0.00633
NP_441453.1_4 Forward -316 -308 16.539 0.00633
NP_441453.1_4 Reverse -232 -240 7.19758 0.0757
NP_441453.1_4 Forward -241 -233 6.80426 0.121
NP_441960.1_3 Forward -78 -59 12.9369 0.291
NP_442151.1_6 Forward -316 -302 16.6175 0.0139
NP_442151.1_6 Reverse -307 -321 7.9644 0.184
NP_441818.1_1 Reverse -308 -319 9.69459 0.232
NP_440226.1_1 Reverse -307 -326 17.994 0.0175
NP_440226.1_1 Reverse -232 -251 1.86774 0.286
NP_442655.1_1 Forward -321 -302 3.44104 0.235
NP_442173.1_1 Forward -315 -307 15.4574 0.00633
NP_442173.1_1 Reverse -308 -316 15.4574 0.00633
NP_442173.1_1 Forward -240 -232 7.68924 0.142
NP_442173.1_1 Reverse -233 -241 5.72262 0.203
NP_442752.1_4 Forward -316 -309 13.8055 0.0199
NP_442752.1_4 Reverse -307 -314 13.8055 0.0199
NP_442752.1_4 Forward -241 -234 13.8055 0.0199
NP_442752.1_4 Reverse -350 -357 5.44732 0.202
NP_443027.1_4 Forward -318 -308 14.828 0.0437
NP_443027.1_4 Forward -243 -233 12.3697 0.079
NP_441812.1_3 Reverse -149 -163 11.996 0.21
NP_441812.1_3 Reverse -306 -320 7.9644 0.254
NP_442975.1_10 Forward -320 -306 5.21053 0.228
NP_442975.1_10 Reverse -228 -242 2.8506 0.269
NP_440784.1_7 Forward -315 -308 15.9687 0.0123
NP_440784.1_7 Reverse -308 -315 15.9687 0.0123
NP_440784.1_7 Forward -240 -233 6.23397 0.241
NP_440784.1_7 Reverse -233 -240 6.13563 0.241
NP_440061.1_9 Forward -318 -304 10.5204 0.124
NP_440110.1_8 Reverse -230 -249 -0.787193 0.228
NP_441145.1_1 Reverse -306 -325 4.22769 0.267
NP_440878.1_9 Reverse -297 -316 8.94757 0.121
NP_442062.1_8 Reverse -307 -317 19.4496 0.000558
NP_442062.1_8 Forward -316 -306 17.6796 0.00193
NP_442062.1_8 Forward -241 -231 14.6313 0.012
NP_442062.1_8 Reverse -350 -360 10.2065 0.0504
NP_440761.1_4 Reverse -227 -246 -13.5702 0.257
NP_441859.1_3 Forward -317 -298 2.45694 0.258
NP_440304.1_4 Forward -318 -308 10.8948 0.051
NP_440304.1_4 Forward -243 -233 10.2065 0.051
NP_440304.1_4 Reverse -305 -315 9.91146 0.051
NP_440304.1_4 Reverse -64 -74 3.02829 0.299
NP_442242.1_4 Forward -315 -308 14.3954 0.0124
NP_442242.1_4 Reverse -308 -315 14.3954 0.0124
NP_442242.1_4 Reverse -233 -240 10.8555 0.127
NP_440908.1_4 Forward -186 -167 17.109 0.237
NP_441581.1_9 Forward -129 -110 5.49036 0.296
NP_441935.1_1 Forward -276 -257 6.39097 0.277
NP_441208.1_9 Reverse -304 -318 15.0442 0.0896
NP_441594.1_6 Forward -181 -162 0.196116 0.291
NP_440132.1_1 Forward -318 -300 14.8671 0.117
NP_442110.1_7 Reverse -232 -246 13.0776 0.0586
NP_442110.1_7 Reverse -307 -321 1.96621 0.222
NP_441925.1_4 Reverse -180 -199 -17.6025 0.297
NP_441083.1_5 Forward -316 -306 19.3512 0.000718
NP_441083.1_5 Reverse -307 -317 11.3864 0.0159
NP_441083.1_5 Forward -241 -231 0.963343 0.218
NP_439957.1_9 Forward -143 -124 4.43995 0.3
NP_442827.1_8 Forward -324 -305 1.08032 0.188
NP_442827.1_8 Reverse -224 -243 -1.27961 0.245
NP_441434.1_7 Reverse -309 -323 11.406 0.13
NP_441738.1_2 Forward -314 -307 15.28 0.0102
NP_441738.1_2 Reverse -309 -316 15.28 0.0102
NP_441738.1_2 Reverse -234 -241 15.28 0.0102
NP_441738.1_2 Forward -357 -350 10.2652 0.101
NP_441558.1_5 Reverse -230 -249 7.37428 0.182
NP_440209.1_1 Reverse -307 -315 18.1123 0.00295
NP_440209.1_1 Forward -316 -308 18.1123 0.00295
NP_440209.1_1 Forward -241 -233 8.57422 0.0425
NP_440209.1_1 Reverse -232 -240 5.32929 0.139
NP_442889.1_1 Forward -193 -174 -12.5869 0.234
NP_442889.1_8 Forward -319 -305 13.077 0.0596
NP_442889.1_8 Forward -244 -230 4.32555 0.27
NP_440447.1_6 Reverse -299 -317 7.29564 0.14
NP_441713.1_1 Reverse -301 -320 -3.63879 0.113
NP_440178.1_7 Reverse -306 -325 -5.60541 0.0637
NP_442462.1_8 Reverse -205 -224 11.1109 0.21
NP_441716.1_1 Forward -316 -302 10.7177 0.0936
NP_442111.1_4 Forward -317 -303 11.111 0.0515
NP_442111.1_4 Reverse -231 -245 9.83269 0.0575
NP_440906.1_5 Forward -315 -308 15.8704 0.0124
NP_440906.1_5 Reverse -308 -315 15.8704 0.0124
NP_440906.1_5 Forward -240 -233 6.23397 0.234
NP_440906.1_5 Reverse -233 -240 6.13563 0.241
NP_440747.1_10 Reverse -304 -316 15.2803 0.0019
NP_440747.1_10 Forward -319 -307 -2.02597 0.0196
NP_440747.1_10 Forward -244 -232 -11.7607 0.142
NP_440747.1_10 Reverse -229 -241 -12.0557 0.199
NP_441486.1_1 Forward -319 -305 22.8124 0.00162
NP_441486.1_1 Reverse -304 -318 2.35953 0.0844
NP_441486.1_1 Reverse -229 -243 1.47456 0.109
NP_441486.1_1 Forward -244 -230 -5.50694 0.242
NP_442145.1_4 Forward -131 -112 10.8379 0.146
NP_442145.1_4 Reverse -111 -130 4.34446 0.282
NP_440944.1_2 Forward -349 -330 6.19431 0.194
NP_442634.1_4 Reverse -305 -319 -3.63866 0.161
NP_441265.1_3 Reverse -301 -315 12.8809 0.0742
NP_441265.1_3 Forward -247 -233 -0.197071 0.268
NP_440470.1_5 Reverse -328 -347 13.3207 0.158
NP_440403.1_4 Forward -325 -306 1.67108 0.134
NP_440842.1_10 Reverse -256 -270 5.21113 0.251
NP_442848.1_1 Forward -322 -308 -2.45868 0.263
NP_442848.1_9 Reverse -179 -198 2.94938 0.245
NP_443018.1_3 Forward -315 -308 14.8871 0.0123
NP_443018.1_3 Reverse -308 -315 14.8871 0.0123
NP_443018.1_3 Forward -240 -233 12.6255 0.0471
NP_443018.1_3 Reverse -359 -366 8.39725 0.147
NP_443018.1_3 Reverse -233 -240 5.25066 0.214
NP_441316.1_7 Forward -318 -303 3.61814 0.139
NP_441634.1_8 Forward -219 -205 -1.8687 0.295
NP_441634.1_8 Reverse -305 -319 -4.32697 0.295
NP_440376.1_1 Forward -316 -307 19.4693 0.000692
NP_440376.1_1 Reverse -307 -316 19.4693 0.000692
NP_440376.1_1 Reverse -350 -359 3.83464 0.19
NP_440376.1_1 Forward -241 -232 -0.000272808 0.285
NP_440376.1_1 Reverse -232 -241 -0.0986038 0.285
NP_441857.1_5 Reverse -300 -318 10.2456 0.185
NP_441588.1_4 Reverse -309 -319 6.96153 0.178
NP_442687.1_7 Reverse -306 -316 18.5646 0.0028
NP_442687.1_7 Forward -317 -307 15.8113 0.0125
NP_441077.1_6 Forward -136 -120 12.0569 0.136
NP_441077.1_6 Forward -135 -119 1.74139 0.298
NP_442946.1_7 Reverse -133 -148 15.0217 0.284
NP_440642.1_10 Forward -368 -354 5.50552 0.241
NP_440642.1_10 Forward -296 -282 2.45727 0.277
NP_441763.1_10 Forward -327 -308 6.68515 0.266
NP_442658.1_1 Forward -318 -308 15.9091 0.00966
NP_442658.1_1 Reverse -305 -315 14.8275 0.0188
NP_442496.1_5 Forward -182 -164 6.31233 0.283
NP_441414.1_9 Reverse -307 -326 -4.42544 0.153
NP_441256.1_8 Forward -194 -175 14.4541 0.119
NP_442937.1_5 Forward -149 -130 7.17762 0.26
NP_441958.1_5 Reverse -306 -316 20.5312 0.000966
NP_441958.1_5 Forward -317 -307 12.2714 0.00183
NP_441958.1_5 Forward -242 -232 10.5014 0.0119
NP_441127.1_1 Reverse -265 -279 9.34103 0.278
NP_440950.1_8 Forward -97 -78 13.7918 0.148
NP_440203.1_5 Reverse -235 -245 14.9258 0.0886
NP_440203.1_5 Forward -313 -303 14.3359 0.0886
NP_443001.1_1 Forward -177 -158 14.5524 0.176
NP_440984.1_7 Forward -321 -307 11.3077 0.122
NP_440984.1_7 Forward -272 -258 7.07942 0.187
NP_440984.1_7 Reverse -181 -195 4.81781 0.287
NP_441097.1_2 Reverse -193 -210 3.0871 0.293
NP_439990.1_5 Reverse -302 -315 11.4257 0.128
NP_442911.1_2 Reverse -297 -316 -5.50708 0.16
NP_442911.1_2 Forward -326 -307 -6.1954 0.178
NP_441580.1_6 Forward -327 -308 -8.85033 0.275
NP_440153.1_5 Reverse -308 -322 2.16287 0.237
NP_442064.1_1 Reverse -302 -321 -5.70374 0.211
NP_443055.1_6 Forward -212 -194 9.6548 0.133
NP_440993.1_3 Reverse -297 -316 4.81688 0.161
NP_440602.1_8 Reverse -307 -321 9.5377 0.298
NP_441129.1_3 Reverse -191 -210 -9.73531 0.228
NP_441099.1_5 Reverse -297 -316 -0.688862 0.0964
NP_442002.1_9 Reverse -306 -313 14.1004 0.074
NP_442002.1_9 Forward -317 -310 10.7572 0.185
NP_442438.1_10 Forward -321 -307 9.83269 0.0602
NP_441000.1_6 Reverse -306 -320 5.80112 0.0933
NP_440147.1_4 Reverse -305 -318 11.9173 0.0326
NP_440147.1_4 Forward -318 -305 3.75586 0.181
NP_441550.1_8 Reverse -305 -315 17.6791 0.00754
NP_441550.1_8 Forward -318 -308 6.0761 0.214
NP_441916.1_7 Reverse -307 -317 18.4663 0.00144
NP_441916.1_7 Forward -316 -306 16.893 0.00407
NP_441916.1_7 Reverse -232 -242 16.4013 0.00539
NP_441916.1_10 Forward -261 -242 17.0107 0.0888
NP_441916.1_10 Forward -92 -73 0.392778 0.285
NP_441041.1_4 Forward -187 -168 -4.6221 0.14
NP_441041.1_7 Reverse -304 -316 18.01 0.00663
NP_441041.1_7 Forward -319 -307 10.916 0.0864
NP_442396.1_5 Forward -320 -307 6.90245 0.215
NP_442004.1_6 Forward -316 -302 6.09611 0.181
NP_442004.1_6 Reverse -232 -246 5.40779 0.191
NP_441725.1_5 Forward -315 -305 11.7798 0.0247
NP_441725.1_5 Reverse -308 -318 11.2881 0.0247
NP_441725.1_5 Reverse -233 -243 1.35667 0.137
NP_439966.1_7 Forward -318 -308 18.4657 0.00473
NP_439966.1_7 Reverse -230 -240 5.28945 0.232
NP_439966.1_7 Forward -243 -233 5.09279 0.243
NP_439966.1_9 Forward -318 -309 0.983037 0.253
NP_442941.1_3 Reverse -308 -318 11.4848 0.0116
NP_442941.1_3 Reverse -233 -243 10.1081 0.024
NP_442941.1_3 Forward -240 -230 7.64985 0.0628
NP_442941.1_3 Forward -315 -305 2.53664 0.14
NP_440289.1_2 Forward -319 -306 24.2087 0.00201
NP_440289.1_2 Reverse -304 -317 -2.34066 0.254
NP_440983.1_9 Forward -204 -185 6.29264 0.28
NP_440260.1_8 Reverse -243 -261 -5.58572 0.275
NP_441514.1_4 Forward -137 -118 12.1147 0.294
NP_442281.1_1 Forward -321 -307 19.0751 0.00329
NP_442281.1_1 Reverse -302 -316 12.9786 0.0319
NP_442281.1_1 Forward -246 -232 8.84875 0.075
NP_442281.1_1 Reverse -227 -241 7.07881 0.108
NP_441334.1_7 Reverse -230 -249 -4.32711 0.12
NP_440437.1_1 Forward -247 -228 1.37609 0.151
NP_440437.1_1 Reverse -301 -320 -0.983855 0.192
NP_442012.1_1 Forward -322 -303 3.6377 0.179
NP_442049.1_10 Reverse -342 -361 7.27595 0.289
NP_441556.1_7 Forward -223 -204 -0.591301 0.3
NP_441556.1_10 Reverse -302 -316 11.4872 0.225
NP_440498.1_1 Forward -325 -307 1.59244 0.204
NP_442982.1_4 Forward -96 -77 16.8132 0.15
NP_442982.1_5 Forward -326 -307 -0.197208 0.254
NP_442982.1_5 Forward -264 -245 -3.3438 0.297
NP_441644.1_6 Forward -316 -306 15.7125 0.0048
NP_441644.1_6 Reverse -307 -317 10.1076 0.0628
NP_441644.1_6 Reverse -232 -242 7.74772 0.117
NP_441644.1_6 Forward -267 -257 4.30615 0.242
NP_442215.1_2 Forward -318 -302 9.00665 0.0605
NP_442215.1_2 Reverse -305 -321 5.6634 0.0775
NP_442177.1_5 Reverse -235 -249 11.8976 0.22
NP_440253.1_2 Forward -241 -223 -3.42244 0.294
NP_440929.1_8 Forward -316 -307 19.2726 0.000701
NP_440929.1_8 Reverse -307 -316 19.2726 0.000701
NP_442933.1_10 Forward -316 -307 17.601 0.00325
NP_442933.1_10 Reverse -307 -316 17.601 0.00325
NP_442933.1_10 Reverse -232 -241 15.1427 0.00958
NP_442933.1_10 Forward -241 -232 7.96454 0.0937
NP_441751.2_8 Reverse -233 -247 -3.04867 0.134
NP_441751.2_8 Forward -315 -301 -3.147 0.134
NP_441751.2_8 Reverse -308 -322 -4.13031 0.163
NP_442926.1_5 Reverse -302 -321 17.8422 0.116
NP_442554.1_8 Forward -315 -305 14.238 0.0144
NP_442554.1_8 Reverse -308 -318 13.8447 0.0145
NP_442554.1_8 Reverse -233 -243 7.15819 0.0975
NP_442554.1_8 Reverse -259 -269 2.24165 0.276
NP_441762.1_7 Reverse -306 -318 11.4454 0.0142
NP_441762.1_7 Forward -317 -305 9.47875 0.0142
NP_442142.1_4 Reverse -304 -317 14.4733 0.0311
NP_442142.1_4 Forward -244 -231 9.26181 0.0998
NP_442142.1_4 Forward -319 -306 9.16348 0.101
NP_442142.1_4 Reverse -192 -205 4.93527 0.206
NP_442292.1_1 Reverse -308 -317 9.63616 0.0183
NP_442292.1_1 Forward -315 -306 9.53783 0.0183
NP_442292.1_1 Reverse -233 -242 7.66954 0.0634
NP_442292.1_1 Forward -240 -231 -0.196935 0.239
NP_442476.1_6 Reverse -308 -322 4.62115 0.142
NP_440895.1_6 Reverse -301 -314 10.4424 0.202
NP_442381.1_7 Forward -193 -180 17.5222 0.26
NP_443009.1_5 Reverse -306 -317 20.6093 0.001
NP_443009.1_5 Forward -317 -306 9.10461 0.0965
NP_443009.1_5 Forward -360 -349 8.61296 0.104
NP_441715.1_4 Reverse -308 -318 16.303 0.0117
NP_441715.1_4 Reverse -233 -243 4.40493 0.281
NP_440357.1_6 Forward -211 -192 5.99764 0.279
NP_440015.1_9 Reverse -307 -325 -0.0791831 0.255
NP_441088.1_1 Forward -204 -185 6.98095 0.243
NP_442076.1_5 Forward -350 -331 12.4875 0.186
NP_441198.1_8 Reverse -305 -315 12.5877 0.12
NP_440379.1_5 Forward -197 -178 -10.6203 0.281
NP_441468.1_1 Forward -315 -308 15.8704 0.0124
NP_441468.1_1 Reverse -308 -315 15.8704 0.0124
NP_441468.1_1 Forward -240 -233 6.13563 0.209
NP_441468.1_1 Reverse -233 -240 6.0373 0.223
NP_441020.2_6 Reverse -305 -322 13.6085 0.0708
NP_441673.1_1 Forward -316 -307 20.8459 0.000698
NP_441673.1_1 Reverse -307 -316 20.8459 0.000698
NP_441673.1_1 Forward -241 -232 1.27803 0.155
NP_441673.1_1 Reverse -232 -241 1.27803 0.155
NP_441826.1_2 Forward -322 -308 11.7993 0.0343
NP_441826.1_2 Forward -247 -233 -2.95034 0.28
NP_441826.1_2 Reverse -301 -315 -3.63866 0.286
NP_442490.1_9 Forward -253 -234 1.76941 0.165
NP_442868.1_6 Reverse -305 -315 9.12481 0.0539
NP_442868.1_6 Forward -361 -351 2.53664 0.205
NP_442868.1_6 Forward -318 -308 0.963343 0.205
NP_442719.1_2 Reverse -37 -55 -9.42131 0.264
NP_441251.1_8 Forward -135 -122 13.0487 0.254
NP_440051.1_5 Reverse -112 -126 15.7108 0.206
NP_441612.1_2 Forward -241 -231 6.70984 0.277
NP_442361.1_3 Forward -247 -234 19.0955 0.0363
NP_442808.1_1 Forward -317 -307 18.4657 0.00201
NP_442808.1_1 Reverse -306 -316 8.73102 0.0481
NP_440145.1_3 Reverse -297 -316 -0.39387 0.14
NP_442820.1_9 Reverse -135 -153 9.0656 0.245
NP_442542.1_9 Forward -248 -234 10.3237 0.119
NP_442542.1_9 Forward -323 -309 7.3738 0.198
NP_442113.1_10 Reverse -165 -184 -7.67036 0.27
NP_442050.1_5 Reverse -230 -240 11.5826 0.0915
NP_442050.1_5 Forward -318 -308 9.12434 0.193
NP_442050.1_5 Forward -243 -233 8.3377 0.234
NP_442050.1_5 Reverse -305 -315 6.96107 0.27
NP_442342.1_9 Forward -318 -302 7.43336 0.207
NP_441518.1_3 Reverse -222 -241 -14.9469 0.284
NP_441878.1_6 Reverse -306 -316 20.2362 0.0046
NP_441878.1_6 Forward -317 -307 10.4031 0.0176
NP_441036.1_8 Forward -317 -307 17.7779 0.000554
NP_441036.1_8 Forward -242 -232 10.6981 0.158
NP_441036.1_8 Reverse -306 -316 8.4365 0.174
NP_441036.1_8 Reverse -349 -359 6.07655 0.242
NP_441557.1_5 Forward -316 -307 19.9609 0.000699
NP_441557.1_5 Reverse -307 -316 19.9609 0.000699
NP_441557.1_5 Forward -241 -232 8.94785 0.0289
NP_441557.1_5 Reverse -232 -241 0.688044 0.128
NP_441520.1_5 Forward -153 -134 14.6508 0.148
NP_441445.1_1 Reverse -298 -317 -0.000545616 0.283
NP_441445.1_8 Forward -266 -247 -12.0953 0.277
NP_442066.2_9 Forward -320 -307 9.36073 0.175
NP_442777.1_1 Reverse -171 -190 9.63507 0.194
NP_442777.1_1 Forward -212 -193 4.91521 0.295
NP_440084.1_8 Forward -132 -118 16.7227 0.161
NP_440084.1_8 Reverse -120 -134 10.8022 0.26
NP_440084.1_8 Reverse -119 -133 10.2293 0.271
NP_441308.1_8 Forward -318 -308 10.1081 0.22
NP_441458.1_8 Reverse -115 -134 11.5187 0.229
NP_442192.1_7 Forward -181 -163 13.8838 0.299
NP_442183.1_1 Reverse -307 -321 13.4709 0.0423
NP_441459.1_8 Reverse -300 -313 11.524 0.286
NP_441467.1_9 Reverse -196 -210 20.9441 0.141
NP_442170.1_5 Forward -241 -222 0.294447 0.224
NP_442347.1_2 Reverse -308 -317 11.1111 0.056
NP_442347.1_2 Forward -358 -349 4.42462 0.284
NP_442347.1_2 Forward -315 -306 3.34298 0.284
NP_442347.1_2 Reverse -233 -242 3.14632 0.286
NP_441037.1_4 Reverse -305 -315 17.3558 0.0127
NP_441037.1_4 Forward -318 -308 7.02532 0.237
NP_441633.1_3 Forward -318 -305 5.72248 0.0481
NP_441633.1_3 Reverse -305 -318 1.29759 0.109
NP_441633.1_3 Reverse -177 -190 -6.86388 0.277
NP_440136.1_2 Forward -315 -308 15.9687 0.0123
NP_440136.1_2 Reverse -308 -315 15.9687 0.0123
NP_440136.1_2 Forward -240 -233 6.23397 0.171
NP_440136.1_2 Reverse -233 -240 6.13563 0.193
NP_442590.1_10 Forward -322 -303 9.0459 0.2
NP_442590.1_10 Forward -204 -185 3.34271 0.294
NP_442590.1_10 Reverse -192 -211 3.34271 0.294
NP_442998.1_5 Reverse -290 -300 9.81313 0.233
NP_442998.1_5 Forward -262 -252 9.81313 0.233
NP_442998.1_5 Reverse -213 -223 8.73149 0.261
NP_442998.1_5 Reverse -263 -273 7.35486 0.295
NP_442998.1_10 Forward -314 -307 15.5754 0.0102
NP_442998.1_10 Reverse -309 -316 15.5754 0.0102
NP_442998.1_10 Reverse -234 -241 15.5754 0.0102
NP_440899.1_2 Forward -252 -233 18.2882 0.0452
NP_440899.1_8 Forward -233 -214 -1.86883 0.215
NP_440899.1_8 Forward -284 -265 -2.36049 0.221
NP_440299.1_1 Reverse -303 -316 19.0949 0.00293
NP_440299.1_1 Forward -245 -232 9.45847 0.0709
NP_440299.1_1 Forward -320 -307 2.18201 0.294
NP_441799.1_1 Reverse -303 -317 12.3887 0.0441
NP_441799.1_1 Forward -320 -306 4.42388 0.25
NP_441007.1_10 Forward -321 -308 3.26421 0.182
NP_442333.2_5 Forward -252 -233 -5.70374 0.214
NP_442333.2_5 Forward -327 -308 -14.6519 0.278
NP_440256.1_1 Reverse -229 -248 4.22769 0.0459
NP_440256.1_1 Reverse -304 -323 2.55606 0.0625
NP_440256.1_1 Forward -244 -225 -5.21209 0.178
NP_440256.1_1 Reverse -192 -211 -5.9004 0.196
NP_441559.1_8 Reverse -302 -316 2.75286 0.143
NP_441559.1_8 Reverse -346 -360 -4.62196 0.231
NP_442756.1_2 Forward -255 -236 5.80098 0.27
NP_440915.1_6 Reverse -303 -317 5.60446 0.088
NP_440915.1_6 Forward -320 -306 4.52282 0.0953
NP_441704.1_8 Reverse -296 -315 5.99684 0.272
NP_440329.1_3 Forward -94 -75 14.4388 0.247
NP_442452.1_8 Forward -247 -233 17.8952 0.257
NP_442866.1_1 Forward -321 -302 -7.57203 0.266
NP_441464.1_10 Reverse -200 -214 11.3077 0.223
NP_440306.1_8 Reverse -163 -182 6.29183 0.204
NP_442993.1_1 Reverse -307 -323 9.89163 0.0172
NP_442993.1_1 Forward -241 -225 1.92682 0.0502
NP_442386.1_9 Forward -317 -308 15.7322 0.0144
NP_442386.1_9 Forward -248 -239 8.2591 0.205
NP_442386.1_9 Reverse -306 -315 6.39082 0.219
NP_442386.1_9 Reverse -231 -240 5.11253 0.266
NP_441750.1_4 Forward -216 -197 0.491109 0.298
NP_441340.1_5 Forward -315 -308 15.6737 0.0124
NP_441340.1_5 Reverse -308 -315 15.6737 0.0124
NP_441340.1_5 Forward -240 -233 6.23397 0.132
NP_441340.1_5 Reverse -233 -240 5.84064 0.208
NP_441340.1_9 Reverse -289 -299 9.21929 0.236
NP_441947.1_4 Reverse -296 -315 10.7175 0.283
NP_443028.1_4 Forward -137 -118 9.01981 0.293
NP_440327.1_6 Reverse -247 -266 12.9791 0.162
NP_440327.1_6 Reverse -78 -97 6.19431 0.246
NP_442240.1_2 Reverse -308 -327 -4.52377 0.0843
NP_442240.1_2 Reverse -233 -252 -6.1954 0.114
NP_440161.1_3 Reverse -193 -212 9.93088 0.237
NP_440161.1_3 Forward -318 -299 9.3409 0.249
NP_440586.1_8 Forward -240 -233 14.69 0.026
NP_440586.1_8 Forward -315 -308 13.2151 0.026
NP_440586.1_8 Reverse -308 -315 13.2151 0.026
NP_440586.1_8 Reverse -359 -366 7.21693 0.27
NP_442251.1_6 Forward -315 -308 15.2804 0.0124
NP_442251.1_6 Reverse -308 -315 15.2804 0.0124
NP_442251.1_6 Reverse -233 -240 12.0355 0.0627
NP_440684.1_9 Reverse -69 -83 6.78443 0.29
NP_441262.1_3 Reverse -307 -314 14.7888 0.0223
NP_441262.1_3 Forward -316 -309 14.7888 0.0223
NP_441262.1_3 Forward -241 -234 14.7888 0.0223
NP_440027.1_3 Forward -326 -308 11.8181 0.159
NP_443051.1_1 Reverse -306 -315 18.0926 0.00402
NP_443051.1_1 Forward -317 -308 10.4228 0.00754
NP_443051.1_1 Forward -242 -233 10.0295 0.0139
NP_439937.1_9 Forward -317 -300 0.92312 0.0951
NP_440439.1_1 Forward -319 -306 10.344 0.0369
NP_440439.1_1 Reverse -304 -317 0.412608 0.192
NP_440439.1_1 Forward -244 -231 0.314277 0.194
NP_440372.1_2 Forward -315 -308 16.3621 0.0124
NP_440372.1_2 Reverse -308 -315 16.3621 0.0124
NP_440372.1_2 Forward -240 -233 6.82395 0.0854
NP_440372.1_2 Reverse -233 -240 6.52896 0.188
NP_442783.1_2 Reverse -90 -109 11.2092 0.219
NP_441789.1_7 Reverse -177 -196 -3.63955 0.277
NP_440819.1_5 Forward -108 -100 7.98423 0.228
NP_440819.1_5 Forward -351 -343 6.41093 0.285
NP_440316.1_10 Reverse -194 -204 8.1415 0.24
NP_441803.1_2 Forward -321 -302 6.78429 0.149
NP_441803.1_2 Forward -246 -227 1.17943 0.238
NP_440139.1_1 Forward -322 -303 3.9319 0.194
NP_441572.1_7 Forward -322 -303 3.6377 0.114
NP_442384.1_10 Forward -316 -303 18.0139 0.00545
NP_442384.1_10 Reverse -307 -320 6.50913 0.0995
NP_442384.1_10 Reverse -232 -245 5.42749 0.13
NP_441604.1_4 Reverse -299 -318 -6.88371 0.293
NP_442262.1_10 Forward -315 -308 14.1988 0.0123
NP_442262.1_10 Reverse -308 -315 14.1988 0.0123
NP_442262.1_10 Forward -240 -233 12.9205 0.0422
NP_442262.1_10 Reverse -359 -366 10.7572 0.124
NP_441689.1_5 Reverse -230 -240 15.0242 0.0617
NP_441689.1_5 Forward -318 -308 8.53436 0.132
NP_441689.1_5 Forward -243 -233 8.3377 0.132
NP_440163.1_10 Forward -319 -309 15.2213 0.0762
NP_440344.1_10 Reverse -300 -317 14.4935 0.00561
NP_440531.1_6 Forward -324 -305 11.9958 0.0545
NP_440531.1_6 Forward -195 -176 -4.72043 0.286
NP_442910.1_1 Reverse -300 -319 -2.65548 0.254
NP_441965.1_10 Forward -319 -303 3.30346 0.266
NP_440297.1_9 Forward -315 -305 9.61647 0.0917
NP_440297.1_9 Reverse -308 -318 9.32148 0.0917
NP_440297.1_9 Reverse -233 -243 -0.609952 0.292
NP_442280.1_10 Reverse -248 -266 5.16222 0.29
NP_441592.1_4 Forward -241 -222 0.491109 0.23
NP_441896.1_3 Reverse -298 -317 -2.55715 0.284
NP_441896.1_5 Reverse -150 -157 12.2322 0.273
NP_440894.1_10 Reverse -302 -321 7.07928 0.209
NP_440894.1_10 Forward -321 -302 3.24438 0.276
NP_440937.1_5 Forward -274 -255 8.94757 0.275
NP_442067.1_4 Forward -327 -308 3.14605 0.289
NP_440999.1_9 Forward -320 -306 8.84938 0.0709
NP_440888.1_2 Reverse -307 -321 16.2235 0.00758
NP_440888.1_2 Reverse -232 -246 5.21053 0.288
NP_440888.1_4 Reverse -351 -365 15.5556 0.241
NP_440491.1_1 Forward -256 -237 8.0865 0.251
NP_440491.1_1 Reverse -229 -248 7.69667 0.261
NP_442033.1_10 Forward -318 -299 -7.37537 0.186
NP_440575.1_1 Forward -284 -265 5.40686 0.232
NP_441543.1_2 Reverse -308 -317 18.486 0.00236
NP_441543.1_2 Forward -240 -231 11.9961 0.047
NP_441543.1_2 Forward -315 -306 9.34117 0.0818
NP_441543.1_2 Reverse -233 -242 6.09625 0.153
NP_441543.1_3 Forward -215 -201 13.1753 0.163
NP_441178.1_6 Reverse -175 -194 1.27698 0.285
NP_441469.1_8 Forward -317 -308 16.126 0.00797
NP_441469.1_8 Reverse -306 -315 13.3727 0.073
NP_443064.1_6 Forward -316 -306 13.8273 0.0796
NP_442578.1_7 Forward -240 -233 14.6904 0.026
NP_442578.1_7 Forward -315 -308 14.5921 0.026
NP_442578.1_7 Reverse -308 -315 14.5921 0.026
NP_440710.1_1 Forward -324 -306 -2.0458 0.189
NP_440220.1_4 Forward -35 -16 -2.55791 0.279
NP_441462.1_2 Forward -316 -306 20.1379 0.000967
NP_441462.1_2 Reverse -307 -317 11.5831 0.00406
NP_441462.1_2 Forward -241 -231 1.25834 0.0964
NP_441462.1_2 Reverse -232 -242 0.668351 0.135
NP_441621.1_7 Forward -318 -304 -3.24533 0.188
NP_441621.1_7 Reverse -305 -319 -5.40861 0.252
NP_443062.1_1 Forward -204 -186 4.54812 0.258
NP_443062.1_6 Reverse -299 -318 14.3558 0.0862
NP_441410.1_4 Reverse -80 -99 7.57013 0.297
NP_440519.1_8 Reverse -232 -248 1.33684 0.288
NP_442204.1_1 Forward -245 -234 19.2332 0.0136
NP_442204.1_1 Reverse -303 -314 8.81013 0.0852
NP_442204.1_2 Forward -251 -232 8.75091 0.239
NP_442204.1_5 Forward -326 -307 14.5524 0.0486
NP_441560.1_8 Reverse -302 -321 19.0116 0.02
NP_440516.1_8 Forward -316 -307 16.9127 0.00442
NP_440516.1_8 Reverse -307 -316 16.9127 0.00442
NP_440516.1_8 Forward -241 -232 0.983037 0.13
NP_440516.1_8 Reverse -195 -204 -0.295266 0.232
NP_442428.1_5 Forward -315 -308 15.8704 0.0124
NP_442428.1_5 Reverse -308 -315 15.8704 0.0124
NP_442428.1_5 Forward -240 -233 6.13563 0.209
NP_442428.1_5 Reverse -233 -240 6.0373 0.212
NP_442120.1_10 Reverse -226 -245 -12.3902 0.273
NP_440673.1_3 Forward -314 -307 12.4288 0.0426
NP_440673.1_3 Reverse -309 -316 12.4288 0.0426
NP_440673.1_3 Reverse -234 -241 12.4288 0.0426
NP_441052.1_2 Reverse -307 -317 10.5014 0.0285
NP_441052.1_2 Forward -316 -306 10.4031 0.0285
NP_441052.1_2 Forward -241 -231 6.76487 0.0863
NP_442219.1_8 Forward -377 -358 10.4863 0.203
NP_442219.1_9 Forward -240 -231 8.75118 0.0681
NP_442219.1_9 Reverse -308 -317 8.35786 0.0681
NP_442219.1_9 Forward -315 -306 8.25953 0.0681
NP_440436.1_1 Forward -392 -374 18.702 0.0642
NP_440436.1_4 Reverse -308 -317 18.1905 0.00233
NP_440436.1_4 Forward -315 -306 15.9289 0.00508
NP_440436.1_4 Forward -240 -231 6.39082 0.162
NP_441884.1_9 Reverse -183 -202 -11.9969 0.135
NP_441884.1_9 Forward -319 -300 -22.42 0.278
NP_442864.1_7 Forward -195 -177 10.4422 0.274
NP_440314.1_9 Forward -83 -64 -5.11376 0.217
NP_441719.1_4 Forward -315 -308 16.3621 0.0124
NP_441719.1_4 Reverse -308 -315 16.3621 0.0124
NP_441719.1_4 Forward -240 -233 13.5105 0.026
NP_441719.1_4 Reverse -233 -240 6.52896 0.188
NP_441733.1_10 Forward -319 -306 8.47575 0.14
NP_441733.1_10 Reverse -304 -317 7.09911 0.156
NP_441004.1_4 Forward -262 -252 8.04317 0.282
NP_442366.1_3 Forward -317 -299 0.904127 0.161
NP_442366.1_3 Forward -242 -224 -2.3408 0.226
NP_442366.1_3 Reverse -306 -324 -5.68405 0.292
NP_442366.1_5 Reverse -304 -314 14.0409 0.0497
NP_441115.1_4 Reverse -306 -324 7.98318 0.266
NP_442206.1_10 Forward -246 -231 0.569883 0.254
NP_440328.1_4 Forward -322 -303 1.76941 0.217
NP_443054.1_2 Forward -318 -304 9.04604 0.102
NP_443054.1_2 Reverse -305 -319 5.1128 0.24
NP_443054.1_2 Reverse -349 -363 0.0979218 0.278
NP_443054.1_2 Reverse -177 -191 -0.590395 0.299
NP_441966.1_7 Reverse -297 -316 -1.57461 0.288
NP_441966.1_8 Reverse -301 -319 -1.45582 0.198
NP_441851.1_10 Reverse -306 -316 17.4829 0.0027
NP_441851.1_10 Forward -317 -307 16.008 0.00552
NP_441851.1_10 Reverse -349 -359 9.12481 0.114
NP_441851.1_10 Forward -242 -232 5.78156 0.2
NP_442515.1_1 Reverse -306 -320 3.93283 0.11
NP_442515.1_1 Reverse -363 -377 1.17956 0.168
NP_440593.1_3 Forward -321 -302 -6.68705 0.28
NP_440593.1_3 Forward -372 -353 -7.67036 0.298
NP_441349.1_10 Reverse -297 -316 -9.44032 0.292
NP_441409.1_6 Reverse -301 -320 1.57275 0.0595
NP_441409.1_6 Forward -247 -228 -9.53865 0.187
NP_442843.1_1 Forward -203 -184 -1.27885 0.192
NP_442843.1_1 Forward -390 -371 -9.14533 0.264
NP_439960.1_10 Forward -188 -170 -2.63579 0.257
NP_439960.1_10 Reverse -169 -187 -4.50408 0.293
NP_440474.1_8 Reverse -308 -322 7.3738 0.207
NP_440474.1_8 Reverse -41 -55 4.42388 0.279
NP_442450.1_5 Reverse -305 -315 17.3846 0.0267
NP_442450.1_5 Forward -318 -308 9.32148 0.115
NP_442450.1_5 Forward -243 -233 6.17489 0.197
NP_440588.1_2 Reverse -298 -317 13.8641 0.0175
NP_440588.1_5 Forward -132 -118 17.024 0.174
NP_442006.1_2 Forward -187 -170 -17.7591 0.282
NP_442006.1_2 Forward -268 -251 -18.939 0.296
NP_441570.1_1 Reverse -307 -325 -6.56903 0.0807
NP_441570.1_1 Reverse -232 -250 -10.8956 0.181
NP_440078.1_4 Reverse -296 -315 14.7491 0.19
NP_441078.1_4 Forward -316 -307 19.6659 0.0007
NP_441078.1_4 Reverse -307 -316 19.6659 0.0007
NP_441078.1_4 Reverse -232 -241 0.0980582 0.205
NP_441078.1_4 Forward -241 -232 0.0980582 0.205
NP_441078.1_4 Forward -359 -350 -1.96689 0.282
NP_442729.1_8 Forward -320 -307 9.45906 0.125
NP_440526.1_3 Forward -315 -304 8.71129 0.116
NP_440526.1_3 Reverse -308 -319 1.92649 0.267
NP_441432.1_8 Reverse -306 -315 8.35786 0.0755
NP_441432.1_8 Forward -317 -308 8.25953 0.0755
NP_441432.1_8 Forward -242 -233 7.27622 0.101
NP_441432.1_8 Forward -145 -136 2.75299 0.287
NP_441333.1_1 Reverse -122 -132 17.2143 0.153
NP_442320.1_8 Forward -322 -308 4.71948 0.0472
NP_442320.1_8 Reverse -226 -240 3.73617 0.0578
NP_441732.1_2 Reverse -303 -319 -7.51295 0.0859
NP_441732.1_2 Forward -245 -229 -8.20127 0.124
NP_442343.1_1 Forward -214 -195 22.0256 0.0356
NP_440760.1_1 Forward -316 -297 -5.31042 0.0493
NP_442797.1_6 Forward -278 -259 10.455 0.238
NP_440199.1_10 Forward -319 -309 14.533 0.0861
NP_440913.1_1 Forward -392 -374 3.3624 0.299
NP_442407.1_7 Reverse -166 -185 13.8633 0.281
NP_442489.1_7 Forward -316 -307 20.1576 0.000695
NP_442489.1_7 Reverse -307 -316 20.1576 0.000695
NP_442489.1_7 Reverse -232 -241 7.57121 0.057
NP_442489.1_7 Forward -241 -232 0.589713 0.17
NP_442489.1_7 Reverse -350 -359 -1.86856 0.259
NP_442079.1_7 Reverse -233 -252 5.50599 0.172
NP_440559.1_1 Forward -315 -306 17.306 0.00658
NP_440559.1_1 Forward -240 -231 14.4544 0.0174
NP_440559.1_1 Reverse -308 -317 8.75118 0.0586
NP_441659.2_8 Forward -316 -306 19.3512 0.000966
NP_441659.2_8 Reverse -307 -317 11.9764 0.0147
NP_441659.2_8 Reverse -232 -242 9.02648 0.037
NP_440426.1_7 Forward -251 -232 0.786102 0.256
NP_442749.1_5 Forward -346 -329 10.0554 0.195
NP_441040.1_2 Reverse -305 -324 -15.4385 0.286
NP_442008.1_2 Forward -195 -176 10.7175 0.139
NP_442776.1_1 Forward -252 -233 5.99764 0.239
NP_442346.1_5 Reverse -306 -316 17.9746 0.00128
NP_442346.1_5 Forward -317 -307 9.02648 0.118
NP_442346.1_5 Forward -242 -232 6.66654 0.195
NP_442346.1_5 Reverse -231 -241 4.69992 0.276
NP_440352.1_5 Forward -314 -295 15.0891 0.13
NP_440545.1_3 Reverse -303 -320 11.2486 0.0268
NP_441856.1_3 Forward -319 -300 -0.39387 0.22
NP_440250.1_4 Reverse -143 -162 3.44025 0.268
NP_441653.1_2 Reverse -184 -203 5.94546 0.235
NP_441653.1_2 Forward -212 -193 2.17674 0.299
NP_441943.1_5 Forward -144 -125 15.2219 0.261
NP_440847.1_3 Forward -211 -197 12.6836 0.234
NP_440847.1_3 Forward -215 -201 10.717 0.283
NP_442603.1_7 Forward -316 -302 9.6354 0.144
NP_442828.1_7 Forward -182 -163 -3.3438 0.276
NP_441585.1_6 Reverse -187 -206 16.4199 0.205
NP_440449.1_6 Forward -368 -350 9.03394 0.188
NP_441948.1_4 Forward -366 -348 2.18243 0.127
NP_441948.1_4 Reverse -300 -318 0.609134 0.136
NP_441948.1_4 Forward -204 -186 -5.97904 0.282
NP_441833.1_4 Forward -315 -308 15.9687 0.0124
NP_441833.1_4 Reverse -308 -315 15.9687 0.0124
NP_441833.1_4 Reverse -233 -240 6.52896 0.0924
NP_441833.1_4 Forward -240 -233 6.23397 0.163
NP_443040.1_1 Forward -136 -122 9.99066 0.291
NP_441895.1_2 Forward -159 -140 -17.9951 0.234
NP_442162.1_9 Forward -315 -308 16.2637 0.0124
NP_442162.1_9 Reverse -308 -315 16.2637 0.0124
NP_442162.1_9 Forward -240 -233 6.62729 0.142
NP_442162.1_9 Reverse -233 -240 6.52896 0.178
NP_440671.1_4 Reverse -301 -315 8.16106 0.202
NP_440671.1_4 Forward -322 -308 8.16106 0.202
NP_440671.1_4 Forward -247 -233 7.17775 0.226
NP_440224.1_1 Forward -252 -233 6.68596 0.119
NP_440224.1_4 Reverse -36 -55 1.57275 0.244
NP_440204.1_4 Reverse -241 -260 2.94938 0.238
NP_442140.1_3 Forward -315 -305 13.5497 0.0542
NP_442140.1_3 Forward -203 -193 9.7148 0.103
NP_442140.1_3 Reverse -308 -318 8.33817 0.119
NP_440875.1_2 Reverse -173 -192 8.45592 0.203
NP_440875.1_9 Reverse -309 -319 8.37203 0.233
NP_440875.1_9 Reverse -234 -244 8.27469 0.233
NP_440875.1_9 Forward -202 -192 7.39866 0.267
NP_441813.1_5 Forward -318 -308 17.188 0.00979
NP_441813.1_5 Reverse -305 -315 8.82982 0.0367
NP_441813.1_5 Forward -243 -233 6.17489 0.1
NP_441813.1_5 Reverse -230 -240 5.48657 0.123
NP_442028.1_1 Reverse -121 -134 7.03268 0.292
NP_440590.1_4 Forward -315 -302 4.54251 0.0601
NP_440590.1_4 Reverse -308 -321 3.36254 0.0746
NP_440567.1_1 Reverse -233 -247 9.63603 0.0422
NP_440567.1_1 Forward -315 -301 6.78443 0.0803
NP_440567.1_1 Reverse -308 -322 6.3911 0.0837
NP_442497.1_10 Forward -315 -306 19.8626 0.00532
NP_442497.1_10 Reverse -308 -317 10.4228 0.0087
NP_442497.1_10 Reverse -233 -242 7.76787 0.0731
NP_442497.1_10 Forward -240 -231 -1.18024 0.256
NP_440821.1_4 Forward -318 -308 19.0562 0.00399
NP_440821.1_4 Reverse -305 -315 10.9931 0.0146
NP_440821.1_4 Forward -243 -233 1.35667 0.137
NP_440821.1_4 Reverse -230 -240 -0.314959 0.251
NP_441239.1_9 Forward -318 -306 16.8536 0.0155
NP_441239.1_9 Reverse -305 -317 13.3137 0.037
NP_441239.1_9 Reverse -380 -392 7.02048 0.173
NP_441239.1_9 Forward -206 -194 4.8572 0.239
NP_442639.1_1 Forward -378 -359 16.0265 0.299
NP_441892.1_1 Forward -250 -233 8.7903 0.0763
NP_441892.1_1 Reverse -298 -315 -2.22277 0.219
NP_441892.1_1 Forward -325 -308 -4.97604 0.271
NP_442669.1_1 Forward -177 -158 4.62101 0.125
NP_442044.1_1 Reverse -358 -377 -12.9802 0.273
NP_442083.1_9 Forward -191 -172 8.84924 0.283
NP_440354.1_7 Forward -373 -355 6.214 0.286
NP_442052.1_8 Reverse -305 -315 12.7631 0.253
NP_440546.1_4 Forward -316 -306 12.8578 0.0572
NP_440546.1_4 Reverse -307 -317 11.8882 0.0679
NP_440055.1_2 Reverse -199 -218 9.24257 0.276
NP_440462.1_6 Forward -318 -308 15.418 0.0142
NP_440462.1_6 Forward -243 -233 13.648 0.0266
NP_440462.1_6 Reverse -348 -358 2.43831 0.287
NP_440462.1_6 Reverse -305 -315 1.455 0.294
NP_440868.1_4 Forward -320 -308 10.7571 0.0364
NP_440868.1_4 Reverse -303 -315 -0.551008 0.274
NP_440401.1_9 Forward -250 -243 12.6251 0.287
NP_442479.1_9 Reverse -216 -235 -13.8652 0.293
NP_441474.1_1 Forward -214 -195 2.45694 0.247
NP_440341.1_1 Forward -195 -176 6.98095 0.224
NP_441848.1_4 Reverse -284 -300 9.556 0.277
NP_442039.1_4 Forward -315 -308 15.1821 0.0124
NP_442039.1_4 Reverse -308 -315 15.1821 0.0124
NP_442829.1_2 Forward -164 -148 9.68723 0.287
NP_442829.1_2 Forward -126 -110 9.5906 0.287
NP_442829.1_2 Forward -224 -208 7.85119 0.295
NP_440825.1_6 Reverse -67 -86 8.65258 0.285
NP_440825.1_7 Forward -315 -305 11.8361 0.2
NP_442696.1_6 Forward -217 -198 16.0274 0.0134
NP_442837.1_3 Forward -315 -308 15.7721 0.0124
NP_442837.1_3 Reverse -308 -315 15.7721 0.0124
NP_442837.1_3 Reverse -233 -240 12.1338 0.0702
NP_442837.1_3 Forward -240 -233 6.0373 0.25
NP_442053.1_1 Forward -316 -307 18.3876 0.0007
NP_442053.1_1 Reverse -307 -316 18.3876 0.0007
NP_442053.1_1 Reverse -232 -241 6.8829 0.111
NP_440505.1_3 Forward -318 -308 13.8447 0.0247
NP_440505.1_3 Forward -243 -233 6.27322 0.187
NP_441102.1_1 Reverse -233 -252 13.0775 0.108
NP_441203.1_1 Reverse -233 -252 3.93269 0.0456
NP_441203.1_1 Reverse -308 -327 -10.6203 0.137
NP_441203.1_1 Forward -315 -296 -19.3717 0.297
NP_440914.1_1 Reverse -307 -317 8.6151 0.186
NP_440914.1_1 Forward -316 -306 8.51751 0.186
NP_441699.1_7 Reverse -40 -59 3.14526 0.255
NP_441011.1_8 Reverse -308 -317 16.9127 0.00602
NP_441011.1_8 Forward -315 -306 14.356 0.0249
NP_441011.1_8 Reverse -233 -242 6.78456 0.184
NP_442101.1_10 Forward -324 -305 -12.4886 0.27
NP_442533.1_6 Forward -316 -307 17.2076 0.00137
NP_442533.1_6 Reverse -307 -316 17.2076 0.00137
NP_442533.1_6 Forward -241 -232 5.40793 0.14
NP_442533.1_6 Forward -267 -258 4.22796 0.186
NP_440263.1_5 Reverse -220 -234 10.6193 0.294
NP_442229.1_1 Forward -318 -304 9.83206 0.184
NP_441482.1_7 Reverse -301 -315 0.88457 0.0554
NP_441482.1_7 Forward -247 -233 -1.5737 0.0755
NP_441482.1_7 Forward -322 -308 -9.04686 0.193
NP_439944.1_9 Reverse -308 -318 10.3048 0.0887
NP_439944.1_9 Forward -315 -305 8.82982 0.101
NP_439944.1_9 Forward -240 -230 8.04317 0.121
NP_439944.1_9 Reverse -233 -243 7.84651 0.127
NP_441697.1_5 Forward -134 -115 -10.1703 0.278
NP_440816.1_2 Forward -146 -127 8.95209 0.235
NP_441527.1_4 Forward -105 -86 -8.45146 0.244
NP_440115.1_6 Reverse -304 -314 9.61647 0.115
NP_440115.1_6 Forward -244 -234 7.45319 0.147
NP_440007.1_9 Forward -245 -231 2.5562 0.277
NP_442492.1_2 Forward -241 -222 1.96607 0.224
NP_441972.1_5 Reverse -233 -252 -3.14714 0.197
NP_441972.1_5 Forward -315 -296 -6.1954 0.229
NP_441106.1_1 Forward -317 -308 18.191 0.0028
NP_441106.1_1 Reverse -306 -315 9.73449 0.0311
NP_441106.1_1 Forward -242 -233 8.75118 0.0469
NP_440429.1_9 Forward -159 -140 0.884433 0.296
NP_442306.1_10 Reverse -174 -193 -21.83 0.291
NP_441286.1_1 Forward -317 -305 5.93884 0.0258
NP_441286.1_1 Reverse -306 -318 5.05386 0.0259
NP_441286.1_1 Reverse -74 -86 -1.73098 0.145
NP_441286.1_1 Reverse -231 -243 -4.58258 0.165
NP_441286.1_1 Forward -242 -230 -6.74586 0.278
NP_440670.1_8 Forward -316 -307 18.3876 0.000699
NP_440670.1_8 Reverse -307 -316 18.3876 0.000699
NP_441705.1_3 Reverse -271 -290 4.916 0.21
NP_441930.1_1 Reverse -303 -322 7.07928 0.239
NP_440886.1_7 Forward -317 -307 17.7774 0.0011
NP_440886.1_7 Reverse -306 -316 8.04271 0.0805
NP_442614.1_2 Forward -316 -302 9.34103 0.242
NP_442614.1_2 Reverse -307 -321 7.07942 0.275
NP_442072.1_9 Reverse -306 -324 -3.91409 0.0388
NP_440907.2_8 Forward -315 -305 16.2041 0.0161
NP_440907.2_8 Reverse -308 -318 7.84605 0.117
NP_442264.1_2 Reverse -228 -245 6.72535 0.25
NP_442264.1_2 Forward -377 -360 4.56207 0.298
NP_441021.1_8 Reverse -302 -320 5.32902 0.215
NP_440841.1_4 Forward -243 -224 -8.35868 0.25
NP_442842.1_4 Reverse -233 -252 6.98095 0.223
NP_441626.1_2 Forward -315 -308 15.7721 0.0124
NP_441626.1_2 Reverse -308 -315 15.7721 0.0124
NP_441626.1_2 Forward -240 -233 6.13563 0.177
NP_441626.1_2 Reverse -233 -240 5.93897 0.231
NP_442211.1_2 Reverse -185 -204 17.2074 0.268
NP_442794.1_1 Reverse -303 -315 12.527 0.0721
NP_442615.1_1 Reverse -298 -316 5.32902 0.0393
NP_442615.1_1 Reverse -223 -241 0.0191479 0.109
NP_442615.1_1 Forward -325 -307 -6.56903 0.252
NP_441962.1_4 Reverse -302 -321 -10.7186 0.232
NP_440387.1_1 Reverse -307 -323 4.3851 0.0426
NP_440387.1_1 Forward -241 -225 -5.84132 0.254
NP_441431.1_2 Forward -319 -305 10.2254 0.166
NP_441431.1_2 Reverse -304 -318 6.29216 0.275
NP_441488.1_8 Reverse -302 -316 11.5037 0.146
NP_441993.1_1 Reverse -307 -326 3.11618 0.241
NP_440114.1_10 Reverse -307 -321 15.4376 0.0252
NP_440114.1_10 Reverse -195 -209 6.58777 0.263
NP_442698.1_10 Forward -148 -129 0.0977854 0.297
NP_441510.2_7 Forward -322 -308 12.5853 0.28
NP_441272.1_8 Forward -107 -89 12.7038 0.296
NP_440766.1_4 Reverse -303 -317 9.04604 0.0871
NP_440766.1_4 Forward -320 -306 5.70279 0.11
NP_440766.1_4 Forward -245 -231 1.27789 0.243
NP_439988.1_3 Reverse -234 -248 6.6861 0.278
NP_439988.1_3 Reverse -174 -188 3.73617 0.298
NP_440422.1_10 Reverse -107 -126 18.0525 0.0998
NP_440422.1_10 Reverse -204 -223 4.11145 0.298
NP_441237.1_9 Forward -315 -305 17.188 0.00445
NP_439910.1_2 Forward -324 -307 -13.4325 0.162
NP_439910.1_2 Reverse -224 -241 -21.9873 0.202
NP_440457.1_1 Reverse -303 -315 9.38042 0.0927
NP_440457.1_1 Forward -245 -233 8.10212 0.101
NP_440457.1_1 Forward -320 -308 -0.0593532 0.25
NP_440987.1_4 Forward -348 -329 5.60432 0.201
NP_440798.1_6 Forward -315 -302 2.77255 0.16
NP_441801.1_4 Forward -250 -240 2.63497 0.29
NP_442680.1_7 Forward -115 -96 -6.29373 0.265
NP_441984.1_6 Reverse -252 -264 15.2803 0.219
NP_441889.1_4 Forward -325 -306 -0.197208 0.296
NP_440473.1_9 Forward -189 -170 -5.50708 0.22
NP_442509.1_4 Reverse -185 -204 13.7658 0.26
NP_442509.1_9 Forward -316 -306 17.3841 0.00128
NP_442509.1_9 Reverse -307 -317 16.2041 0.00739
NP_442509.1_9 Forward -254 -244 7.64939 0.21
NP_440554.1_4 Reverse -308 -318 14.6313 0.02
NP_440554.1_4 Reverse -233 -243 6.46988 0.123
NP_441885.1_5 Reverse -307 -317 11.4848 0.00668
NP_441885.1_5 Forward -316 -306 11.3864 0.00668
NP_441885.1_5 Forward -241 -231 10.2065 0.012
NP_442341.1_7 Forward -317 -303 14.8476 0.026
NP_442341.1_7 Reverse -306 -320 13.7659 0.0334
NP_442341.1_9 Forward -318 -304 17.1085 0.0304
NP_442395.2_4 Forward -76 -57 4.03023 0.188
NP_440423.1_6 Reverse -187 -206 -11.9969 0.184
NP_440423.1_10 Forward -248 -229 13.3725 0.172
NP_443000.1_7 Forward -318 -308 8.73149 0.0437
NP_443000.1_7 Forward -243 -233 7.74818 0.0666
NP_443000.1_7 Reverse -230 -240 6.56821 0.123
NP_443000.1_7 Reverse -305 -315 2.04498 0.226
NP_441842.1_10 Forward -248 -234 8.75105 0.211
NP_440275.1_3 Reverse -305 -315 9.91146 0.046
NP_440275.1_3 Forward -318 -308 8.4365 0.0602
NP_440091.1_1 Forward -320 -308 10.7571 0.0429
NP_440091.1_1 Reverse -228 -240 9.28209 0.0567
NP_442451.1_2 Forward -324 -305 -1.18052 0.169
NP_442451.1_2 Reverse -356 -375 -10.9153 0.28
NP_441190.1_1 Reverse -204 -223 4.22769 0.241
NP_441207.1_7 Forward -136 -122 11.5789 0.241
NP_441207.1_7 Forward -135 -121 8.86815 0.282
NP_439962.1_4 Forward -196 -177 -4.91709 0.272
NP_440149.1_8 Reverse -307 -326 -4.42544 0.207
NP_440149.1_8 Reverse -232 -251 -7.08038 0.272
NP_440149.1_8 Reverse -16 -35 -7.17871 0.275
NP_441105.1_3 Reverse -296 -315 -1.7705 0.151
NP_440216.1_1 Reverse -307 -321 8.25939 0.0061
NP_440216.1_1 Forward -316 -302 -2.06536 0.0458
NP_440216.1_1 Reverse -350 -364 -4.32697 0.107
NP_440216.1_1 Forward -204 -190 -6.39192 0.143
NP_440216.1_1 Reverse -232 -246 -11.9968 0.236
NP_440216.1_9 Forward -157 -148 6.68623 0.289
NP_440172.1_1 Forward -316 -306 16.303 0.00854
NP_440172.1_1 Reverse -307 -317 8.73149 0.0586
NP_440172.1_1 Forward -241 -231 7.55152 0.0761
NP_442371.1_1 Forward -306 -296 13.8442 0.196
NP_442015.1_10 Reverse -303 -316 20.7671 0.00366
NP_442015.1_10 Forward -320 -307 0.805932 0.218
NP_441226.1_7 Forward -315 -308 14.4934 0.0123
NP_441226.1_7 Reverse -308 -315 14.4934 0.0123
NP_442834.1_9 Reverse -236 -255 3.53937 0.298
NP_441757.1_3 Reverse -231 -250 -0.885524 0.245
NP_441111.1_7 Forward -315 -307 18.7023 0.00294
NP_441111.1_7 Reverse -308 -316 18.7023 0.00294
NP_441111.1_7 Reverse -233 -241 8.86921 0.0589
NP_441766.1_2 Forward -316 -307 17.5026 0.00297
NP_441766.1_2 Reverse -307 -316 17.5026 0.00297
NP_441766.1_2 Forward -241 -232 8.1612 0.0645
NP_442417.1_5 Reverse -232 -246 8.16106 0.164
NP_440416.1_9 Forward -323 -304 -16.0285 0.206
NP_440416.1_9 Reverse -134 -153 -16.1268 0.208
NP_440416.1_9 Reverse -171 -190 -16.9135 0.226
NP_440416.1_9 Forward -367 -348 -20.7484 0.288
NP_443052.1_8 Reverse -222 -241 -4.42544 0.117
NP_443052.1_8 Forward -326 -307 -12.5869 0.259
NP_443052.1_9 Reverse -168 -187 -2.0655 0.233
NP_443052.1_9 Reverse -315 -334 -5.60541 0.271
NP_440845.1_1 Reverse -349 -368 -4.13045 0.222
NP_442154.1_1 Forward -186 -168 -16.7954 0.245
NP_440261.1_5 Forward -315 -302 6.90245 0.0316
NP_440261.1_5 Reverse -308 -321 -1.06236 0.0655
NP_440261.1_5 Reverse -233 -246 -10.9938 0.23
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGTTTAGCTGCCATTCGAGCTTTAGGTGCTGTTTCCATCGGTCAATCCCCGGAAAAGTTAACGGAGATTCTGGAACGACTAACGGCGATCGCCCAGGAAGAATTTTTCCTCACCCAAGTTTCTGTTACTTCTGCCCTTGGCCAAATGGAAACCCCCAAGGCGATCGATATTTCGCAAAATCTTGCCAACCAAACCCCCGATGGTCGGGTGCGGCGCATGGCGGAAGAGGCGGTTAAAAAAGTCCAAGCCAAAATTGGCAGTGACGAAAAAATTAAAAATTTGCAAACTAACCTGGAAAAACTCCAACAGGAAAATCAAGATCTCCAAAGTCGCCTTGCTAAATTGGAAACTGTGATTAAAGCATCAACCGATACATCCGTCACGAACCTTTAGAATAAT

CDS

GTGGACAGATGCAAATTCTCGAATGTAAAGACGATCGCCAAAATAAGCTACCAACACAAACAAAACCCCATGCGTACTTTTACCCTTGCCTTACTGGCGATCGGCACCCTGGCACCTTCAGCCAGCGCCCAAACGGAAGAATTTAATTGGTGGTTGGACTGGGTTAAATCTCGCACCAACAATGAACCGATACCAGTTCAGATTCGCTCTCCTCAAGCATTACCGGCGAAGTTTAACCAGCCTAGGCAAGATTTAGAACAATTACAAAGACAATACACTCCCTATAGATATCGCAGTAATTCCAATCAAGTTAACTCAATTCCAATCACCGTAGAAGAGCGATTTAGTAATACCCCAAACAGTAGCAATGGTGTGGTCATTCCATCCACCTCAACTTCGACCATTGCTCCCGTTTCTAGCCAACCACCCCAAATACGCCAGGGATTACAGAGAAATGACTACATTGAGATTGATTTTCCTTCCAGCCCTCCCAATCTCCCCACCAGGACAGAAGTAGAATTCATTCCTCGCTCTGCACTGCCGACCCCTCTCCGTACTCGCTACCCTGGTGGCCCAACAGTCAAAGAAACTGAGTCCCGCATAGTGAGAAGACTTTGCACTGAGTACAAGCGGGGATTAACGCCTGGTGAATTGGATGAATTAGCCCGTAATTTAGTGGAAAAGAACCGGCTGTATCTCAGTGGTGAGGGCAAAAGTCCCCGTGGCTATGCAATAGACGCAAGGAACACCAAGAAATGCTGA

Protein

MDRCKFSNVKTIAKISYQHKQNPMRTFTLALLAIGTLAPSASAQTEEFNWWLDWVKSRTNNEPIPVQIRSPQALPAKFNQPRQDLEQLQRQYTPYRYRSNSNQVNSIPITVEERFSNTPNSSNGVVIPSTSTSTIAPVSSQPPQIRQGLQRNDYIEIDFPSSPPNLPTRTEVEFIPRSALPTPLRTRYPGGPTVKETESRIVRRLCTEYKRGLTPGELDELARNLVEKNRLYLSGEGKSPRGYAIDARNTKKC