Your browser is old and dusty. Try Google Chrome!

Details for sll1340

ORF sll1340
Accession NP_442826.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -383 -397 -0.000409212 0.219
NP_440795.1_7 Forward -48 -41 12.2322 0.0614
NP_440795.1_7 Forward -390 -383 8.00392 0.218
NP_441453.1_4 Reverse -40 -48 14.4741 0.019
NP_442151.1_6 Reverse -382 -396 7.66941 0.192
NP_442151.1_6 Forward -49 -35 6.6861 0.224
NP_441818.1_1 Forward -214 -203 9.30127 0.246
NP_440348.1_6 Forward -247 -228 9.24257 0.158
NP_440150.1_1 Reverse -224 -243 5.211 0.122
NP_442287.1_5 Reverse -62 -72 16.6963 0.218
NP_442173.1_1 Forward -48 -40 5.62429 0.206
NP_442752.1_4 Forward -391 -384 12.1338 0.0546
NP_442752.1_4 Forward -219 -212 9.47889 0.109
NP_442752.1_4 Reverse -40 -47 4.26735 0.293
NP_442975.1_10 Forward -53 -39 1.76896 0.291
NP_440784.1_7 Forward -48 -41 6.23397 0.241
NP_440784.1_7 Reverse -41 -48 6.23397 0.241
NP_442861.1_1 Forward -46 -27 12.9791 0.26
NP_441250.1_3 Reverse -335 -354 0.982764 0.299
NP_441681.1_9 Reverse -311 -325 11.701 0.296
NP_440061.1_9 Forward -340 -326 8.94708 0.157
NP_440061.1_9 Reverse -204 -218 7.47213 0.205
NP_440061.1_9 Reverse -80 -94 4.91554 0.3
NP_441054.1_2 Forward -247 -228 12.5858 0.229
NP_441054.1_2 Reverse -277 -296 9.14423 0.299
NP_441476.1_5 Forward -89 -70 -8.16202 0.296
NP_442826.1_3 Forward -113 -94 18.289 0.0524
NP_442826.1_6 Forward -343 -324 20.059 0.0633
NP_441859.1_3 Forward -392 -373 1.27698 0.29
NP_440304.1_4 Reverse -327 -337 4.50326 0.261
NP_442242.1_4 Reverse -41 -48 11.8388 0.0776
NP_440011.1_1 Forward -399 -380 15.0441 0.19
NP_441208.1_9 Forward -394 -380 6.78443 0.229
NP_441594.1_6 Forward -117 -98 6.19431 0.193
NP_441594.1_6 Forward -388 -369 5.50599 0.209
NP_441594.1_6 Forward -94 -75 -0.197208 0.298
NP_440518.1_8 Reverse -293 -312 11.0117 0.288
NP_440300.1_1 Reverse -376 -395 8.84842 0.242
NP_441925.1_2 Reverse -136 -155 1.37609 0.278
NP_441083.1_5 Forward -49 -39 9.22315 0.0295
NP_441083.1_5 Reverse -382 -392 6.96153 0.0717
NP_442827.1_5 Reverse -173 -192 24.2872 0.0239
NP_441558.1_7 Forward -35 -16 18.584 0.0884
NP_441942.1_7 Forward -94 -75 13.0775 0.277
NP_440209.1_1 Reverse -40 -48 8.37755 0.0576
NP_440209.1_1 Forward -49 -41 5.32929 0.139
NP_440056.1_1 Reverse -295 -314 10.4225 0.205
NP_441713.1_4 Reverse -295 -314 23.4022 0.0268
NP_440178.1_7 Forward -248 -229 -23.01 0.287
NP_441716.1_1 Reverse -294 -308 4.42448 0.256
NP_441327.1_3 Reverse -130 -149 19.3698 0.176
NP_442111.1_4 Reverse -39 -53 7.17775 0.103
NP_441624.1_7 Reverse -181 -195 9.83269 0.217
NP_440343.1_3 Forward -295 -277 5.22993 0.257
NP_440906.1_5 Reverse -41 -48 12.0355 0.0724
NP_440906.1_5 Forward -48 -41 6.0373 0.262
NP_440747.1_1 Reverse -380 -398 8.67227 0.246
NP_440747.1_10 Forward -52 -40 -4.38592 0.0974
NP_440747.1_10 Reverse -37 -49 -4.48425 0.101
NP_441486.1_1 Reverse -37 -51 -2.16369 0.175
NP_441014.1_5 Forward -102 -84 11.8189 0.258
NP_441014.1_8 Reverse -82 -101 5.50599 0.19
NP_441014.1_10 Forward -333 -314 1.96529 0.221
NP_442848.1_5 Reverse -293 -311 -1.75081 0.276
NP_443018.1_3 Reverse -41 -48 5.84064 0.174
NP_443018.1_3 Forward -48 -41 5.54565 0.187
NP_443018.1_3 Forward -390 -383 4.07068 0.299
NP_441634.1_8 Forward -393 -379 4.52282 0.124
NP_441634.1_8 Reverse -61 -75 0.491246 0.228
NP_440376.1_1 Reverse -40 -49 7.86621 0.0583
NP_440376.1_1 Forward -391 -382 3.93297 0.188
NP_440376.1_1 Forward -247 -238 0.884706 0.259
NP_440376.1_1 Forward -49 -40 -0.196935 0.285
NP_441588.1_4 Forward -47 -37 8.33817 0.151
NP_442730.1_8 Reverse -179 -198 6.58682 0.228
NP_441846.1_10 Forward -197 -178 -23.1083 0.277
NP_441422.1_7 Reverse -97 -114 -0.846137 0.169
NP_441422.1_7 Reverse -198 -215 -8.61428 0.276
NP_441950.1_8 Reverse -101 -115 12.6843 0.165
NP_441763.1_10 Reverse -217 -236 7.66846 0.23
NP_440360.1_5 Forward -297 -278 1.86774 0.297
NP_442658.1_1 Reverse -327 -337 10.9926 0.098
NP_440141.1_8 Reverse -320 -339 9.24257 0.227
NP_440141.1_8 Forward -397 -378 5.11266 0.278
NP_441855.2_4 Forward -93 -74 14.729 0.138
NP_442782.1_2 Forward -309 -295 7.57108 0.202
NP_442782.1_2 Reverse -238 -252 0.88457 0.282
NP_442782.1_2 Reverse -40 -54 0.687908 0.286
NP_442782.1_2 Forward -252 -238 0.491246 0.289
NP_441414.1_9 Forward -391 -372 -7.96535 0.227
NP_441414.1_9 Forward -49 -30 -9.63698 0.264
NP_441487.1_7 Forward -312 -293 8.55425 0.238
NP_442937.1_5 Reverse -35 -54 8.06259 0.234
NP_441165.1_5 Reverse -85 -104 10.2259 0.264
NP_441958.1_5 Forward -50 -40 1.55333 0.095
NP_441958.1_5 Reverse -39 -49 -6.60814 0.283
NP_440651.1_9 Forward -86 -67 18.289 0.279
NP_441127.1_1 Forward -391 -377 10.9143 0.239
NP_441127.1_5 Forward -311 -292 13.8621 0.274
NP_442605.1_4 Forward -304 -285 12.3892 0.268
NP_440203.1_5 Reverse -385 -395 13.1559 0.129
NP_440984.1_7 Forward -396 -382 7.66941 0.166
NP_442064.1_4 Forward -235 -216 6.78348 0.246
NP_443055.1_6 Forward -296 -278 2.67334 0.205
NP_440934.1_2 Reverse -377 -396 1.0811 0.277
NP_442210.1_5 Reverse -368 -387 11.4058 0.22
NP_441646.1_1 Reverse -322 -341 1.37609 0.231
NP_441646.1_1 Reverse -288 -307 -0.4922 0.266
NP_441646.1_7 Forward -337 -323 14.5526 0.256
NP_442431.1_7 Forward -250 -231 8.25926 0.248
NP_440377.1_1 Forward -248 -231 11.0804 0.291
NP_440147.1_4 Forward -51 -38 1.9859 0.213
NP_441550.1_8 Reverse -123 -133 5.68278 0.236
NP_441550.1_8 Reverse -38 -48 4.89613 0.281
NP_441916.1_7 Reverse -40 -50 6.56821 0.0919
NP_441725.1_5 Forward -337 -327 4.89658 0.115
NP_439966.1_7 Reverse -380 -390 11.9759 0.0528
NP_442941.1_3 Forward -48 -38 1.25834 0.15
NP_440983.1_9 Reverse -92 -111 1.96607 0.292
NP_441514.1_6 Forward -87 -80 12.8221 0.252
NP_441514.1_6 Forward -254 -247 12.7238 0.29
NP_440177.1_1 Forward -396 -378 5.23069 0.272
NP_442256.1_2 Reverse -380 -398 1.00246 0.114
NP_440437.1_1 Forward -55 -36 -5.70374 0.292
NP_441087.1_6 Reverse -366 -384 -0.276578 0.258
NP_441644.1_6 Reverse -40 -50 6.0761 0.167
NP_441644.1_6 Forward -49 -39 5.28945 0.199
NP_441644.1_6 Forward -215 -205 4.20782 0.245
NP_441644.1_6 Reverse -382 -392 3.32285 0.288
NP_441644.1_6 Reverse -238 -248 3.22451 0.293
NP_443049.1_6 Forward -392 -382 13.6904 0.149
NP_442215.1_2 Reverse -380 -396 -4.46469 0.233
NP_442215.1_2 Forward -233 -217 -4.85801 0.24
NP_442029.1_1 Reverse -28 -47 -20.3551 0.297
NP_442029.1_6 Forward -96 -77 3.73603 0.277
NP_441751.2_8 Reverse -41 -55 -2.65535 0.133
NP_441751.2_8 Reverse -77 -91 -6.68692 0.277
NP_442554.1_8 Forward -48 -38 6.07655 0.126
NP_442554.1_8 Reverse -383 -393 4.40493 0.188
NP_441762.1_7 Forward -392 -380 -4.9759 0.185
NP_441762.1_7 Reverse -39 -51 -7.33585 0.287
NP_442142.1_4 Forward -52 -39 5.32859 0.194
NP_442292.1_1 Forward -48 -39 8.84951 0.0269
NP_442292.1_1 Reverse -383 -392 5.70292 0.135
NP_442301.1_2 Forward -82 -63 7.86512 0.236
NP_440015.1_9 Forward -49 -31 1.39578 0.237
NP_441448.1_1 Reverse -277 -296 15.5357 0.158
NP_441448.1_1 Forward -116 -97 10.0292 0.191
NP_441198.1_8 Reverse -327 -337 13.076 0.108
NP_440379.1_5 Forward -108 -89 -10.0303 0.273
NP_440464.1_10 Reverse -383 -393 13.1991 0.169
NP_440464.1_10 Forward -48 -38 12.7217 0.189
NP_441468.1_1 Forward -390 -383 10.2655 0.0906
NP_441468.1_1 Reverse -41 -48 6.43063 0.175
NP_441468.1_1 Forward -48 -41 6.0373 0.223
NP_441015.1_10 Forward -312 -293 -9.63698 0.282
NP_441673.1_1 Reverse -40 -49 1.37636 0.114
NP_441673.1_1 Forward -49 -40 1.1797 0.163
NP_441339.1_1 Forward -389 -370 19.8919 0.159
NP_441339.1_4 Forward -344 -325 5.70265 0.166
NP_442253.1_5 Forward -341 -324 -0.944468 0.234
NP_440286.1_2 Forward -327 -314 15.6539 0.296
NP_441876.1_9 Reverse -121 -131 14.3359 0.267
NP_442868.1_6 Reverse -327 -337 0.865012 0.205
NP_442868.1_6 Reverse -38 -48 0.0783647 0.248
NP_442719.1_2 Forward -303 -285 -0.473239 0.162
NP_442719.1_2 Reverse -24 -42 -9.7163 0.267
NP_442808.1_1 Reverse -381 -391 13.7459 0.047
NP_442808.1_1 Forward -73 -63 2.92952 0.252
NP_442542.1_2 Forward -99 -86 13.1956 0.114
NP_442342.1_9 Reverse -88 -104 5.76173 0.233
NP_442747.1_1 Forward -102 -83 -16.3235 0.236
NP_441114.1_3 Forward -336 -327 7.57121 0.231
NP_441114.1_3 Reverse -330 -339 7.37455 0.239
NP_440558.1_2 Forward -341 -322 -2.0655 0.222
NP_440558.1_2 Reverse -72 -91 -2.26216 0.225
NP_440558.1_2 Forward -94 -75 -2.75381 0.229
NP_440111.2_8 Reverse -207 -223 15.0048 0.125
NP_442789.1_4 Reverse -70 -89 -0.295539 0.199
NP_441878.1_6 Forward -304 -294 -6.41148 0.191
NP_441878.1_6 Reverse -328 -338 -7.49312 0.231
NP_441878.1_6 Reverse -39 -49 -7.49312 0.231
NP_441557.1_5 Reverse -40 -49 1.08137 0.0794
NP_441557.1_5 Forward -49 -40 0.589713 0.134
NP_441590.1_4 Reverse -296 -315 15.2399 0.144
NP_442066.2_9 Reverse -378 -391 7.49244 0.224
NP_441116.1_9 Forward -144 -130 18.5841 0.111
NP_441549.1_9 Reverse -234 -252 -8.04399 0.219
NP_441549.1_9 Forward -342 -324 -10.5023 0.279
NP_442347.1_2 Reverse -383 -392 5.89959 0.21
NP_441411.1_3 Forward -207 -188 4.22769 0.297
NP_442594.1_8 Forward -93 -74 6.39097 0.233
NP_441633.1_3 Forward -340 -327 -4.01229 0.179
NP_442764.1_3 Reverse -328 -338 15.418 0.295
NP_440136.1_2 Reverse -41 -48 6.52896 0.116
NP_440136.1_2 Forward -48 -41 6.13563 0.193
NP_440136.1_2 Forward -390 -383 4.26735 0.218
NP_442998.1_5 Forward -298 -288 13.1564 0.158
NP_442998.1_10 Forward -47 -40 13.5105 0.0225
NP_441799.1_1 Forward -53 -39 6.29216 0.176
NP_440256.1_1 Reverse -92 -111 -6.88371 0.223
NP_440256.1_1 Forward -164 -145 -8.752 0.266
NP_441559.1_8 Reverse -71 -85 2.45787 0.143
NP_441559.1_8 Forward -342 -328 -4.4253 0.223
NP_441270.1_5 Forward -322 -303 13.287 0.231
NP_441296.1_9 Reverse -77 -90 10.1468 0.273
NP_441464.1_10 Forward -393 -379 8.84938 0.267
NP_440695.1_6 Reverse -133 -147 11.8657 0.265
NP_442993.1_1 Reverse -105 -121 -10.5612 0.222
NP_442386.1_9 Reverse -381 -390 13.4706 0.0358
NP_442386.1_9 Forward -392 -383 10.2257 0.136
NP_441340.1_5 Reverse -41 -48 13.2155 0.0437
NP_441340.1_5 Forward -48 -41 6.13563 0.175
NP_442714.1_7 Reverse -329 -348 -2.16383 0.294
NP_442959.1_4 Reverse -289 -308 7.07928 0.224
NP_441262.1_3 Reverse -40 -47 5.25066 0.215
NP_440027.1_3 Reverse -200 -218 4.04996 0.262
NP_443051.1_1 Reverse -39 -48 0.688044 0.134
NP_443051.1_1 Forward -50 -41 0.29472 0.195
NP_440408.1_7 Forward -196 -177 7.07928 0.292
NP_440372.1_2 Reverse -41 -48 6.62729 0.151
NP_440372.1_2 Forward -48 -41 6.52896 0.188
NP_442783.1_9 Forward -242 -223 20.4514 0.0734
NP_439977.1_5 Reverse -376 -395 9.24257 0.0937
NP_442572.1_7 Reverse -223 -242 12.0942 0.29
NP_442262.1_10 Reverse -41 -48 10.4622 0.145
NP_440163.1_10 Forward -117 -107 13.648 0.118
NP_440344.1_10 Reverse -375 -392 -9.99092 0.163
NP_440344.1_10 Forward -79 -62 -10.8759 0.194
NP_440282.1_10 Forward -313 -294 -9.73531 0.288
NP_441060.1_4 Reverse -12 -30 3.26407 0.252
NP_441965.1_10 Reverse -379 -395 11.6616 0.107
NP_441640.1_8 Forward -214 -195 -3.14714 0.249
NP_440297.1_9 Reverse -158 -168 -0.0199663 0.282
NP_440650.1_5 Forward -36 -17 13.3725 0.274
NP_440999.1_1 Reverse -293 -312 2.55527 0.249
NP_440999.1_9 Reverse -378 -392 -0.0987402 0.199
NP_440888.1_2 Reverse -382 -396 8.55376 0.156
NP_442033.1_10 Forward -51 -32 -13.1769 0.283
NP_442033.1_10 Reverse -380 -399 -14.5535 0.299
NP_441543.1_2 Forward -48 -39 15.3394 0.00889
NP_441543.1_2 Reverse -383 -392 5.01461 0.209
NP_442845.1_2 Forward -397 -383 5.80112 0.224
NP_442845.1_2 Forward -97 -83 5.1128 0.243
NP_441304.1_10 Forward -146 -137 14.7494 0.164
NP_441178.1_6 Reverse -379 -398 11.995 0.188
NP_441178.1_6 Reverse -177 -196 1.96529 0.276
NP_441319.1_3 Reverse -282 -301 12.8808 0.256
NP_441319.1_5 Reverse -201 -220 9.3409 0.27
NP_441469.1_8 Reverse -381 -390 13.9627 0.066
NP_441469.1_8 Reverse -328 -337 9.4395 0.227
NP_442337.1_6 Reverse -62 -81 12.763 0.277
NP_441306.1_10 Reverse -218 -232 15.1419 0.247
NP_442578.1_7 Reverse -41 -48 11.3472 0.102
NP_441462.1_2 Reverse -40 -50 8.23984 0.0392
NP_441621.1_7 Reverse -38 -52 -5.50694 0.254
NP_440255.1_3 Forward -141 -131 14.918 0.298
NP_440516.1_8 Reverse -40 -49 9.24284 0.0264
NP_440516.1_8 Forward -391 -382 -0.491928 0.262
NP_442428.1_5 Reverse -41 -48 6.52896 0.109
NP_442428.1_5 Forward -48 -41 6.0373 0.212
NP_442428.1_5 Forward -390 -383 4.66067 0.244
NP_441353.1_8 Reverse -372 -391 17.0029 0.245
NP_442120.1_10 Reverse -105 -124 -14.0619 0.288
NP_440673.1_2 Reverse -95 -114 8.82876 0.263
NP_441714.1_3 Forward -56 -38 14.8663 0.169
NP_441052.1_2 Forward -49 -39 17.2863 0.00566
NP_441052.1_2 Reverse -382 -392 15.6147 0.0106
NP_442219.1_8 Reverse -378 -397 10.0998 0.213
NP_442219.1_9 Forward -48 -39 7.96454 0.0696
NP_442219.1_9 Reverse -383 -392 5.01461 0.193
NP_440436.1_4 Reverse -383 -392 11.3073 0.0574
NP_440436.1_4 Forward -48 -39 7.57079 0.124
NP_440436.1_4 Reverse -301 -310 6.39082 0.162
NP_441884.1_9 Reverse -379 -398 -21.7317 0.261
NP_442907.1_9 Forward -90 -71 -2.36049 0.255
NP_441719.1_4 Reverse -41 -48 6.62729 0.151
NP_441719.1_4 Forward -48 -41 6.52896 0.188
NP_441004.1_1 Forward -397 -378 -17.2085 0.29
NP_441004.1_1 Forward -126 -107 -18.1918 0.298
NP_441004.1_2 Reverse -318 -337 6.58763 0.179
NP_441004.1_4 Reverse -326 -336 9.91146 0.259
NP_441004.1_5 Forward -395 -381 6.58777 0.298
NP_442813.1_4 Forward -400 -381 -7.96535 0.299
NP_442873.1_5 Forward -286 -267 7.37347 0.278
NP_442206.1_10 Reverse -329 -344 0.569883 0.254
NP_440508.1_4 Reverse -89 -108 10.3242 0.298
NP_440864.1_3 Forward -231 -212 8.16093 0.297
NP_441851.1_10 Forward -392 -382 5.5849 0.207
NP_441851.1_10 Reverse -328 -338 4.20827 0.282
NP_442208.1_5 Forward -312 -293 1.67108 0.248
NP_442515.1_1 Reverse -379 -393 -3.73699 0.297
NP_441349.1_10 Reverse -30 -49 2.94938 0.0715
NP_441349.1_10 Forward -59 -40 -5.80207 0.212
NP_441409.1_6 Forward -55 -36 -13.8652 0.244
NP_440726.1_8 Forward -297 -278 11.5042 0.233
NP_440588.1_2 Forward -58 -39 -1.96717 0.158
NP_440588.1_2 Reverse -291 -310 -7.08038 0.299
NP_442006.1_2 Forward -99 -82 -6.64766 0.167
NP_442006.1_2 Reverse -270 -287 -15.0058 0.214
NP_440483.1_1 Forward -310 -291 -6.78538 0.252
NP_441078.1_4 Forward -49 -40 8.25953 0.0387
NP_441078.1_4 Reverse -40 -49 7.37455 0.0688
NP_441078.1_4 Reverse -382 -391 -2.06522 0.295
NP_441078.1_4 Forward -391 -382 -2.06522 0.295
NP_442729.1_5 Reverse -62 -72 7.84651 0.261
NP_442729.1_7 Forward -242 -224 6.214 0.286
NP_442348.1_2 Forward -241 -232 6.5879 0.299
NP_440707.1_9 Forward -312 -293 10.9142 0.198
NP_442443.1_1 Reverse -280 -299 5.30933 0.157
NP_440526.1_3 Reverse -201 -212 1.6315 0.267
NP_440526.1_3 Forward -48 -37 1.6315 0.267
NP_440526.1_3 Reverse -383 -394 0.54986 0.275
NP_441432.1_8 Reverse -39 -48 7.27622 0.101
NP_441432.1_8 Forward -50 -41 5.70292 0.144
NP_441432.1_8 Forward -392 -383 4.32629 0.223
NP_441432.1_8 Forward -338 -329 2.65466 0.292
NP_442797.1_7 Reverse -381 -399 -0.570838 0.284
NP_441072.1_2 Reverse -29 -48 12.2908 0.173
NP_440280.1_4 Forward -311 -297 15.2409 0.298
NP_442400.1_10 Reverse -10 -23 8.65605 0.278
NP_440713.1_4 Forward -257 -238 8.45592 0.17
NP_440713.1_4 Forward -194 -175 5.70265 0.204
NP_440713.1_4 Forward -114 -95 5.70265 0.204
NP_442489.1_7 Reverse -40 -49 1.1797 0.101
NP_442489.1_7 Forward -49 -40 0.491382 0.178
NP_442489.1_7 Forward -391 -382 -1.57357 0.213
NP_441452.1_1 Reverse -345 -364 13.4708 0.292
NP_442079.1_7 Forward -390 -371 8.45592 0.121
NP_440559.1_1 Forward -48 -39 7.76787 0.0918
NP_441659.2_8 Reverse -238 -248 3.02829 0.177
NP_441659.2_8 Reverse -40 -50 1.65166 0.233
NP_442346.1_5 Forward -50 -40 8.73149 0.128
NP_440025.1_3 Forward -300 -286 17.8717 0.107
NP_440555.1_1 Forward -60 -41 0.294447 0.294
NP_440459.1_2 Reverse -31 -48 8.10198 0.27
NP_440847.1_3 Reverse -347 -361 10.717 0.283
NP_442603.1_7 Reverse -382 -396 7.57046 0.202
NP_441948.1_4 Forward -398 -380 -3.71743 0.203
NP_441833.1_4 Reverse -41 -48 6.23397 0.163
NP_441833.1_4 Forward -48 -41 6.13563 0.198
NP_442060.1_9 Forward -399 -380 18.3873 0.0428
NP_442699.1_8 Forward -305 -286 -11.8986 0.238
NP_442162.1_9 Reverse -41 -48 6.62729 0.142
NP_442162.1_9 Forward -48 -41 6.43063 0.208
NP_442140.1_3 Forward -390 -380 8.53483 0.119
NP_442140.1_3 Reverse -41 -51 4.89658 0.238
NP_442723.1_1 Forward -82 -63 3.83357 0.278
NP_440875.1_9 Forward -102 -92 10.4161 0.216
NP_440590.1_4 Forward -48 -35 1.49425 0.122
NP_440590.1_4 Reverse -383 -396 -0.177378 0.179
NP_442497.1_10 Forward -48 -39 0.589713 0.153
NP_442497.1_10 Reverse -41 -50 -1.18024 0.256
NP_440821.1_4 Reverse -38 -48 -0.314959 0.251
NP_441239.1_9 Reverse -178 -190 7.11881 0.169
NP_441239.1_9 Reverse -380 -392 6.52882 0.185
NP_441951.1_4 Forward -397 -378 3.53937 0.275
NP_440156.1_4 Reverse -135 -145 13.2542 0.176
NP_440400.1_1 Reverse -125 -144 -2.06626 0.285
NP_440833.1_6 Reverse -229 -243 9.53707 0.261
NP_440833.1_6 Reverse -133 -147 8.3571 0.277
NP_442216.1_4 Reverse -78 -86 8.08217 0.255
NP_442052.1_8 Reverse -198 -208 12.8614 0.253
NP_442809.1_1 Forward -208 -189 8.75009 0.299
NP_440546.1_4 Reverse -40 -50 11.8882 0.0679
NP_440546.1_4 Forward -391 -381 9.17338 0.151
NP_440546.1_6 Reverse -278 -297 6.68596 0.296
NP_442592.1_3 Reverse -37 -56 8.55425 0.278
NP_440868.1_4 Forward -53 -41 4.66053 0.114
NP_441848.1_7 Forward -295 -276 3.63691 0.217
NP_442039.1_4 Reverse -41 -48 12.1338 0.063
NP_441811.1_8 Reverse -323 -337 7.57108 0.241
NP_440825.1_6 Reverse -277 -296 13.0775 0.244
NP_442837.1_3 Reverse -41 -48 6.0373 0.25
NP_442837.1_3 Forward -48 -41 5.93897 0.265
NP_440160.1_2 Reverse -226 -245 -8.85033 0.291
NP_442053.1_1 Reverse -40 -49 7.86621 0.0863
NP_442053.1_1 Forward -49 -40 6.39124 0.136
NP_442053.1_1 Forward -391 -382 4.52295 0.242
NP_440505.1_3 Reverse -38 -48 7.74818 0.151
NP_440505.1_7 Forward -240 -221 11.0125 0.146
NP_441252.1_6 Reverse -326 -333 11.9372 0.25
NP_442532.1_4 Forward -40 -22 8.06189 0.289
NP_442532.1_7 Forward -391 -377 4.22782 0.178
NP_440914.1_1 Reverse -329 -339 11.6404 0.0843
NP_441011.1_8 Forward -48 -39 5.50626 0.256
NP_441011.1_8 Reverse -41 -50 5.40793 0.263
NP_442533.1_6 Reverse -382 -391 6.98123 0.0992
NP_442533.1_6 Reverse -295 -304 3.63797 0.206
NP_442541.1_10 Reverse -294 -308 0.883986 0.295
NP_442541.1_10 Forward -338 -324 0.687325 0.3
NP_442322.1_4 Reverse -292 -309 0.136476 0.21
NP_442322.1_4 Reverse -178 -195 -8.12328 0.286
NP_441219.1_6 Reverse -293 -311 12.0155 0.193
NP_439944.1_9 Forward -48 -38 7.74818 0.131
NP_440116.1_8 Forward -48 -29 -9.24366 0.271
NP_442673.1_5 Reverse -98 -116 21.062 0.0866
NP_441286.1_1 Reverse -39 -51 -4.77924 0.175
NP_441286.1_1 Forward -392 -380 -5.66422 0.213
NP_441286.1_1 Forward -339 -327 -6.45087 0.265
NP_441479.1_1 Reverse -37 -56 10.2259 0.211
NP_441930.1_2 Reverse -328 -338 13.0581 0.248
NP_440886.1_7 Reverse -381 -391 14.8275 0.0394
NP_440886.1_7 Forward -50 -40 7.45273 0.093
NP_442614.1_2 Reverse -40 -54 6.78443 0.285
NP_442072.1_9 Forward -167 -149 -23.0886 0.277
NP_442213.1_6 Forward -399 -380 6.68596 0.254
NP_441753.1_10 Forward -106 -87 4.52268 0.198
NP_440223.1_7 Forward -302 -288 12.0943 0.26
NP_440907.2_8 Forward -48 -38 4.40448 0.266
NP_442264.1_2 Forward -219 -202 10.7569 0.185
NP_442264.1_2 Reverse -372 -389 10.2653 0.188
NP_441463.1_3 Reverse -372 -391 -9.14533 0.277
NP_441463.1_6 Forward -393 -379 5.54623 0.287
NP_441626.1_2 Reverse -41 -48 14.2971 0.0271
NP_441626.1_2 Forward -48 -41 5.93897 0.231
NP_442615.1_1 Forward -58 -40 -0.865831 0.122
NP_442615.1_1 Reverse -31 -49 -2.63579 0.146
NP_441962.1_4 Reverse -324 -343 -0.590531 0.117
NP_441962.1_4 Forward -220 -201 -11.3086 0.239
NP_441962.1_4 Forward -396 -377 -14.5535 0.29
NP_440387.1_1 Reverse -40 -56 -3.97304 0.171
NP_440855.1_9 Reverse -293 -312 17.9932 0.22
NP_441193.1_1 Reverse -225 -244 13.5683 0.229
NP_442224.1_1 Forward -374 -355 -3.3438 0.233
NP_440467.1_3 Forward -337 -318 11.5492 0.274
NP_442698.1_10 Forward -118 -99 -0.983855 0.297
NP_442698.1_10 Forward -395 -376 -1.47551 0.299
NP_441510.2_7 Reverse -383 -397 10.8154 0.28
NP_440293.1_3 Reverse -321 -340 -3.3438 0.244
NP_439988.1_3 Forward -308 -294 14.4542 0.185
NP_441237.1_9 Forward -337 -327 13.4514 0.0805
NP_441237.1_9 Forward -48 -38 12.8614 0.102
NP_442930.1_1 Reverse -134 -144 11.9759 0.242
NP_439910.1_2 Forward -122 -105 -22.2823 0.22
NP_442867.1_8 Forward -232 -213 7.47261 0.244
NP_440457.1_1 Forward -193 -181 -0.846001 0.278
NP_441981.1_8 Forward -250 -236 12.7826 0.28
NP_441332.1_6 Reverse -381 -391 14.7447 0.141
NP_442862.1_3 Forward -258 -241 7.11867 0.258
NP_441885.1_5 Forward -49 -39 9.81313 0.0199
NP_441885.1_5 Reverse -382 -392 -0.41329 0.197
NP_442341.1_9 Forward -51 -37 7.27547 0.202
NP_443000.1_7 Reverse -38 -48 0.57002 0.294
NP_441842.1_10 Forward -398 -384 9.04604 0.2
NP_440091.1_1 Reverse -36 -48 -0.846001 0.293
NP_442275.1_1 Reverse -285 -304 1.27776 0.284
NP_441190.1_2 Reverse -316 -335 10.2259 0.17
NP_441105.1_3 Reverse -289 -308 -0.0988766 0.132
NP_440216.1_1 Reverse -40 -54 -12.6851 0.296
NP_440701.1_5 Reverse -58 -77 11.6025 0.259
NP_440172.1_1 Reverse -40 -50 9.22315 0.0586
NP_442015.1_10 Forward -395 -382 5.72248 0.134
NP_441226.1_7 Reverse -383 -390 11.2485 0.0971
NP_441226.1_7 Reverse -389 -396 6.52862 0.253
NP_441226.1_7 Forward -48 -41 5.54531 0.289
NP_440198.1_3 Reverse -79 -98 15.2399 0.253
NP_441111.1_7 Forward -48 -40 8.86921 0.0589
NP_441766.1_2 Forward -49 -40 8.45619 0.0593
NP_443052.1_9 Forward -289 -270 -0.39387 0.209
NP_442154.1_1 Forward -399 -381 -16.2055 0.236
NP_440261.1_7 Forward -305 -286 -5.40875 0.237
NP_440988.1_10 Reverse -380 -394 8.57771 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATCCCGTTGGGGATGGCGGCAAATATCACAGACAGGCTCAGCGGATAAATGGAAGCATACTTGGCATTGCCCCACCCGTTTTTTTGCGTCGAGGAGGGCTTGGGCCAAATTCTCCACCTCCGCATCAGGACGTTTAAGCAGATGCAGGGCAAGACGTTGGGCAGTTTTTGGCCCCACACTGGGGAGCCGTTGCAATTGTTCAATGAGACGGGCTAGGGGAGGAGTATAAATAGTGCCAAGACCTCTCTTTTGTAGGGGAAATTTTACTGATGGGGCCAAGTAAACAGCCGTGGAAACCAAGGGCCTGTGGGCAGGGGAATTGACAGCCACCTTCCCCATATATTGTGCTACGCTATCGCCAATTATCGGCAAACCTTTCTGGGGTAGTCTTCATTCACC

CDS

GTGGATAGACCACCAGTTTTAACTATATCTATTCTTCGTCCATCAGTACGTCCTATGCCTCAAACCAAAGCCCACCTGAGAGTGACTACCCATTCTTGGCCTGGAGGTTTTCTGGCGGGGGAAGTGCGGGCTGGGGACTATGAGTGGCAATTTCACTGGAATTTTCGGGGGGGGAAATTACGAGTGCAACCATCCCTCGGGCGATCGCTTATTTTTGAACCCCTGGGACGTTTTTTGGAACGCAGTGATTATCAATTGGAACCCGGTGGGGATTATGAATTCACTCTCCGTAGCCGACTGTAG

Protein

MDRPPVLTISILRPSVRPMPQTKAHLRVTTHSWPGGFLAGEVRAGDYEWQFHWNFRGGKLRVQPSLGRSLIFEPLGRFLERSDYQLEPGGDYEFTLRSRL