Your browser is old and dusty. Try Google Chrome!

Details for sll1333

ORF sll1333
Accession NP_442833.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -240 -233 9.77388 0.169
NP_441453.1_4 Reverse -250 -258 5.0343 0.209
NP_441453.1_7 Reverse -44 -51 12.9205 0.23
NP_442151.1_6 Forward -241 -227 10.7177 0.118
NP_441054.1_6 Forward -316 -297 11.5042 0.298
NP_442062.1_8 Reverse -250 -260 6.46988 0.125
NP_440761.1_9 Forward -37 -18 12.9791 0.195
NP_441859.1_3 Reverse -249 -268 2.85027 0.254
NP_442207.1_4 Forward -244 -225 12.0942 0.285
NP_441594.1_6 Forward -244 -225 4.32602 0.221
NP_442742.1_9 Reverse -16 -35 -13.5702 0.274
NP_442276.1_2 Forward -57 -38 11.3075 0.273
NP_440132.1_1 Forward -393 -375 8.37728 0.272
NP_440856.1_4 Reverse -243 -262 0.786102 0.164
NP_442827.1_8 Forward -267 -248 4.71854 0.131
NP_441942.1_5 Forward -86 -67 15.8307 0.146
NP_442136.1_4 Forward -257 -238 11.2084 0.25
NP_440447.1_5 Forward -54 -44 14.4347 0.277
NP_441327.1_1 Reverse -363 -382 3.63672 0.277
NP_441327.1_5 Reverse -54 -63 16.2243 0.164
NP_441598.1_1 Reverse -35 -54 5.80098 0.295
NP_442111.1_3 Forward -227 -214 12.1892 0.294
NP_442111.1_4 Reverse -249 -263 13.4709 0.0383
NP_440343.1_3 Reverse -226 -244 2.47668 0.298
NP_440747.1_10 Reverse -46 -58 -12.0557 0.199
NP_440747.1_10 Reverse -247 -259 -12.1541 0.227
NP_442634.1_2 Forward -316 -297 4.52268 0.27
NP_443018.1_3 Reverse -251 -258 9.47889 0.127
NP_442530.1_2 Reverse -54 -64 15.2213 0.203
NP_440642.1_10 Reverse -366 -380 2.5556 0.277
NP_441746.1_4 Reverse -151 -170 19.5664 0.149
NP_440667.1_2 Forward -244 -225 -9.24366 0.299
NP_440360.1_5 Reverse -77 -96 -2.26216 0.297
NP_442782.1_2 Forward -213 -199 3.14618 0.267
NP_442496.1_5 Reverse -343 -361 5.23069 0.288
NP_441487.1_9 Reverse -27 -46 0.884433 0.215
NP_439959.1_3 Forward -247 -228 16.5191 0.148
NP_441127.1_1 Reverse -303 -317 11.406 0.227
NP_441137.1_4 Forward -141 -122 10.6192 0.178
NP_442690.1_1 Forward -143 -124 -15.6352 0.28
NP_442911.1_2 Forward -269 -250 -1.86883 0.091
NP_440153.1_8 Reverse -232 -245 -3.71729 0.299
NP_443044.1_1 Forward -321 -302 3.53937 0.286
NP_439975.1_3 Forward -387 -374 15.3589 0.285
NP_442013.1_10 Forward -248 -229 8.45592 0.174
NP_441646.1_1 Forward -65 -46 0.294447 0.252
NP_441550.1_8 Reverse -248 -258 5.58445 0.242
NP_439966.1_9 Forward -261 -252 9.14451 0.253
NP_442941.1_3 Forward -258 -248 -0.314959 0.256
NP_441514.1_6 Reverse -355 -362 14.2971 0.248
NP_442281.1_1 Reverse -245 -259 8.84875 0.075
NP_441334.1_7 Forward -261 -242 -11.4069 0.122
NP_442982.1_5 Reverse -39 -58 0.982764 0.233
NP_441644.1_6 Forward -241 -231 6.0761 0.167
NP_442501.1_2 Reverse -239 -258 -3.3438 0.259
NP_442215.1_2 Forward -60 -44 -6.03799 0.263
NP_442029.1_6 Forward -164 -145 9.24257 0.191
NP_440929.1_8 Reverse -250 -259 4.91628 0.162
NP_441751.2_8 Forward -258 -244 1.76955 0.0968
NP_442554.1_8 Forward -258 -248 5.09324 0.161
NP_442143.1_9 Forward -334 -315 15.4366 0.275
NP_442016.1_10 Reverse -210 -229 4.52268 0.288
NP_442301.1_5 Reverse -25 -44 20.5498 0.0511
NP_440464.1_2 Reverse -310 -329 21.2381 0.0684
NP_441618.1_3 Forward -259 -240 5.89931 0.156
NP_439939.1_9 Reverse -240 -259 20.5464 0.159
NP_440265.1_8 Forward -228 -210 14.9655 0.219
NP_442811.1_2 Forward -255 -236 -2.45882 0.281
NP_442227.1_2 Reverse -234 -253 17.109 0.105
NP_442227.1_2 Reverse -231 -250 7.17762 0.198
NP_442820.1_10 Forward -241 -223 16.1454 0.152
NP_442542.1_2 Forward -243 -230 10.7374 0.122
NP_442113.1_10 Reverse -228 -247 -6.39206 0.261
NP_442593.1_9 Reverse -219 -238 14.4242 0.278
NP_441878.1_6 Forward -242 -232 -7.0998 0.204
NP_441036.1_8 Forward -260 -250 6.17489 0.242
NP_441036.1_8 Forward -246 -236 5.5849 0.271
NP_441557.1_8 Forward -57 -47 13.2542 0.224
NP_441590.1_4 Reverse -233 -252 12.0933 0.246
NP_441590.1_4 Reverse -225 -244 4.03023 0.29
NP_441308.1_8 Reverse -191 -201 10.4031 0.22
NP_442347.1_2 Reverse -19 -28 3.7363 0.284
NP_442998.1_10 Forward -257 -250 5.84064 0.235
NP_440899.1_2 Reverse -239 -258 13.2733 0.104
NP_440810.1_8 Forward -296 -277 20.9431 0.0787
NP_441799.1_1 Reverse -246 -260 3.53891 0.295
NP_441007.1_10 Forward -246 -233 7.29578 0.145
NP_442333.2_5 Reverse -239 -258 -14.1602 0.272
NP_441559.1_8 Reverse -198 -212 -5.70361 0.27
NP_440915.1_6 Forward -263 -249 4.71948 0.0953
NP_441464.1_1 Reverse -242 -261 6.68596 0.285
NP_441494.1_6 Reverse -298 -311 9.06573 0.227
NP_442386.1_9 Reverse -48 -57 8.16077 0.209
NP_440570.1_5 Reverse -39 -58 -0.688862 0.263
NP_441271.1_8 Reverse -45 -55 13.648 0.272
NP_442791.1_5 Reverse -31 -50 -7.86702 0.279
NP_440586.1_8 Reverse -251 -258 10.9535 0.119
NP_443051.1_1 Reverse -249 -258 0.196389 0.213
NP_440398.1_2 Forward -250 -231 7.07928 0.231
NP_440439.1_1 Forward -248 -235 -0.767364 0.236
NP_440439.1_1 Reverse -247 -260 -1.75067 0.281
NP_440316.1_10 Forward -242 -232 6.56821 0.257
NP_440316.1_10 Forward -166 -156 6.07655 0.271
NP_441604.1_4 Forward -349 -330 -6.58872 0.293
NP_441604.1_8 Forward -92 -73 13.6675 0.191
NP_442790.1_4 Forward -268 -249 -15.6352 0.295
NP_442262.1_10 Reverse -251 -258 11.9372 0.0736
NP_440531.1_6 Reverse -242 -261 -3.44213 0.266
NP_442123.1_3 Forward -259 -240 12.6841 0.196
NP_442280.1_10 Forward -62 -44 6.81803 0.268
NP_441896.1_3 Forward -268 -249 7.07928 0.0974
NP_441103.1_9 Forward -363 -353 14.3451 0.216
NP_443036.1_1 Forward -308 -289 13.0766 0.224
NP_443036.1_8 Forward -252 -233 15.4374 0.219
NP_440834.1_8 Reverse -86 -105 19.764 0.126
NP_440888.1_2 Forward -58 -44 5.30886 0.284
NP_440052.1_8 Forward -249 -230 8.65258 0.274
NP_439969.1_3 Forward -264 -245 -1.18052 0.271
NP_441949.1_6 Reverse -236 -255 7.66846 0.289
NP_440575.1_4 Forward -164 -145 12.2379 0.288
NP_440982.1_1 Reverse -241 -260 3.73524 0.294
NP_441469.1_8 Forward -242 -233 7.17789 0.227
NP_442315.1_5 Reverse -353 -363 15.8113 0.3
NP_441462.1_2 Forward -259 -249 -1.19994 0.291
NP_441621.1_7 Forward -261 -247 -4.81863 0.246
NP_443062.1_1 Forward -259 -241 6.79079 0.192
NP_443062.1_6 Forward -349 -330 3.14605 0.243
NP_442204.1_1 Reverse -246 -257 1.82863 0.266
NP_442204.1_6 Forward -257 -238 4.916 0.286
NP_441560.1_8 Forward -346 -327 13.0709 0.232
NP_440516.1_8 Reverse -250 -259 -0.983583 0.299
NP_442846.1_8 Reverse -246 -265 20.944 0.114
NP_441443.1_7 Forward -253 -234 -1.37718 0.258
NP_440603.1_9 Reverse -292 -311 1.86774 0.278
NP_442219.1_8 Forward -245 -226 12.3223 0.158
NP_442219.1_8 Reverse -222 -241 7.78057 0.263
NP_442219.1_9 Forward -57 -48 2.06468 0.289
NP_441004.1_1 Forward -256 -237 -11.6036 0.24
NP_441004.1_1 Forward -391 -372 -16.2252 0.283
NP_441004.1_1 Forward -218 -199 -18.2901 0.299
NP_441004.1_5 Forward -254 -240 6.98109 0.295
NP_440050.1_5 Forward -325 -306 18.289 0.128
NP_442430.1_7 Reverse -157 -176 15.9788 0.273
NP_441851.1_10 Reverse -48 -58 10.3048 0.0962
NP_441851.1_10 Forward -214 -204 4.50326 0.266
NP_441668.1_4 Forward -251 -232 -2.95047 0.299
NP_441668.1_5 Reverse -301 -320 6.68596 0.28
NP_441396.1_5 Forward -249 -240 9.24284 0.21
NP_440593.1_3 Forward -311 -292 -3.83545 0.242
NP_442843.1_1 Forward -258 -239 -10.0303 0.274
NP_440396.1_1 Reverse -39 -58 -6.39206 0.285
NP_440431.1_3 Forward -20 -1 -8.26035 0.229
NP_440431.1_3 Reverse -290 -309 -8.752 0.236
NP_442006.1_2 Forward -53 -36 -16.2841 0.247
NP_442243.1_1 Reverse -43 -61 7.3932 0.178
NP_441570.1_1 Forward -41 -23 -11.9772 0.206
NP_442443.1_4 Reverse -52 -62 16.4991 0.148
NP_440629.1_4 Reverse -156 -175 7.57094 0.289
NP_440760.1_7 Forward -67 -48 7.76679 0.192
NP_441945.1_10 Reverse -204 -223 6.98095 0.291
NP_440713.1_4 Forward -58 -39 2.65439 0.26
NP_440565.1_7 Forward -218 -199 0.786102 0.246
NP_442079.1_7 Forward -258 -239 1.76941 0.241
NP_442763.1_1 Forward -248 -229 17.5024 0.0949
NP_442913.1_10 Reverse -40 -59 -2.16383 0.182
NP_441800.1_7 Reverse -227 -245 8.67227 0.113
NP_442776.1_1 Reverse -239 -258 11.4058 0.157
NP_440025.1_3 Reverse -221 -235 9.83628 0.29
NP_440486.1_6 Forward -392 -373 11.4058 0.207
NP_440459.1_2 Forward -222 -205 7.31533 0.296
NP_442900.1_10 Reverse -37 -56 13.9625 0.0619
NP_442311.1_6 Forward -78 -59 8.16093 0.285
NP_440847.1_3 Reverse -375 -389 11.1104 0.274
NP_441233.1_1 Forward -249 -230 3.44104 0.28
NP_442140.1_3 Reverse -251 -261 7.15819 0.149
NP_441609.1_1 Forward -175 -156 -2.95047 0.298
NP_440875.1_9 Forward -257 -247 6.91198 0.294
NP_441813.1_5 Reverse -248 -258 5.28991 0.138
NP_440821.1_10 Reverse -1 -19 17.837 0.229
NP_440665.1_1 Reverse -205 -224 -10.227 0.244
NP_440665.1_1 Forward -256 -237 -16.1268 0.28
NP_442643.1_5 Forward -304 -285 0.392778 0.257
NP_441017.1_8 Reverse -358 -373 8.53469 0.244
NP_440833.1_6 Reverse -302 -316 13.077 0.175
NP_442138.1_1 Reverse -196 -215 3.63691 0.24
NP_441119.1_10 Forward -44 -25 11.7008 0.1
NP_440546.1_6 Forward -242 -223 8.55425 0.256
NP_442349.1_3 Reverse -110 -129 10.7175 0.158
NP_440462.1_6 Reverse -248 -258 12.5664 0.0348
NP_441474.1_1 Reverse -240 -259 5.11187 0.212
NP_442402.1_4 Reverse -317 -336 -6.58946 0.259
NP_442402.1_4 Reverse -10 -29 -8.45774 0.282
NP_442402.1_4 Reverse -196 -215 -8.6544 0.284
NP_442402.1_10 Reverse -205 -215 15.1225 0.18
NP_441848.1_7 Forward -370 -351 0.490334 0.228
NP_441848.1_7 Reverse -57 -76 -4.72118 0.298
NP_441926.1_3 Forward -147 -131 2.71347 0.257
NP_440160.1_7 Reverse -32 -51 20.649 0.0579
NP_442360.1_5 Reverse -44 -54 13.2547 0.28
NP_440914.1_1 Reverse -49 -59 6.85846 0.263
NP_442533.1_6 Forward -241 -232 1.67135 0.293
NP_442541.1_10 Reverse -239 -253 1.47397 0.286
NP_441482.1_7 Reverse -244 -258 -6.68692 0.193
NP_441028.1_6 Reverse -206 -216 17.1874 0.132
NP_441028.1_6 Reverse -40 -50 6.76441 0.23
NP_441028.1_6 Reverse -19 -29 5.78111 0.243
NP_441028.1_6 Reverse -379 -389 5.48612 0.255
NP_441527.1_4 Reverse -333 -352 -6.25514 0.215
NP_441972.1_5 Reverse -37 -56 1.96607 0.123
NP_442306.1_10 Reverse -245 -264 -21.0434 0.242
NP_440670.1_8 Forward -235 -226 7.66954 0.0766
NP_440670.1_8 Forward -259 -250 5.60459 0.149
NP_440670.1_8 Reverse -250 -259 4.91628 0.179
NP_442401.1_2 Reverse -225 -244 10.3234 0.178
NP_440907.2_8 Reverse -251 -261 10.5993 0.103
NP_441463.1_2 Forward -76 -58 0.947315 0.262
NP_442794.1_1 Reverse -213 -225 4.07055 0.279
NP_441962.1_4 Reverse -298 -317 -13.2752 0.271
NP_440387.1_1 Reverse -250 -266 -5.93965 0.258
NP_441174.1_1 Forward -393 -378 10.3046 0.296
NP_442323.1_7 Reverse -211 -230 5.80018 0.202
NP_442833.1_1 Forward -145 -131 19.2055 0.0771
NP_442833.1_2 Forward -81 -63 18.4062 0.138
NP_440766.1_4 Forward -263 -249 1.67122 0.22
NP_441436.1_8 Forward -170 -151 10.4225 0.262
NP_440473.1_9 Forward -252 -233 -5.50708 0.22
NP_442509.1_9 Reverse -193 -203 8.73102 0.192
NP_442514.1_5 Forward -60 -41 -8.55607 0.285
NP_441440.1_8 Forward -37 -24 14.9656 0.299
NP_440554.1_4 Reverse -251 -261 2.53664 0.261
NP_441173.1_9 Reverse -207 -215 11.3271 0.226
NP_440191.1_4 Reverse -372 -382 15.0872 0.254
NP_443000.1_3 Forward -385 -366 15.7886 0.228
NP_443000.1_7 Reverse -248 -258 0.766681 0.29
NP_440275.1_3 Forward -261 -251 5.87989 0.13
NP_440679.1_10 Forward -257 -238 -6.39206 0.161
NP_440641.1_5 Reverse -146 -165 10.4225 0.244
NP_442495.1_3 Forward -252 -234 11.6222 0.259
NP_440216.1_9 Forward -304 -295 5.50626 0.292
NP_442290.1_9 Forward -251 -232 12.2908 0.287
NP_442015.1_3 Reverse -240 -259 15.8299 0.167
NP_442015.1_10 Reverse -45 -58 4.05085 0.178
NP_442015.1_10 Forward -304 -291 3.75586 0.178
NP_441177.1_3 Reverse -30 -49 21.6323 0.0105
NP_443052.1_9 Forward -359 -340 -6.1954 0.279
NP_442154.1_1 Forward -249 -231 -6.4707 0.139
NP_442154.1_1 Forward -252 -234 -18.3687 0.281
NP_440988.1_10 Reverse -230 -244 7.12552 0.221
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTATTTACGGTCTGCGGGAAAGGTGGAAAGTAAAATTCCTTCCCCTTCTACTACTTCTGGACTGTTGCTGTTAAAAACGGGTATTTGGTCAAGTTGCCCCGGCAAAGGTCTTATTTCCTGCGGCTGCACAATATAATCTGCTTCGATCGGCTGGATGGGGGCGGTGACGATTTGAGCCAACATCATGGGGGAAAGCAGTGGGATCATAGTTTGTCCGCTGAAATAGAATTTGACAGGCTGTTGGGAGTCATAAGGAAATTAGCTTTTACTTAGAGTGCTATTTGGAACTTGTCTTGTCAAGTTGCCGTCTCGGACTATTTGACTTTGTGGGTAGAGAATTTTTGCCTTCCCCAGGGGTCAGTGACCGGATTCTGGGGTTAAAACCGTTGATAGAGGGGTT

CDS

ATGACTGTGATTTTTCGTGGTTGGCTGAGTTTGTTACCTTCTAGCTTGGTTATTTTTTCGGCGATCGCCAGTGTAGGGAGTGTAGGGGCCCAGGAGCCGGGGGAAAACCCGTTAGATTTGGAGCCTGCCATGGTGGAAAGTAGTCCTACTTTGCAACGGTGGTGGGAGGAAACCCCCGATTTATTTGAGCAAAATAACAATGATCCAGCTTTTTTAACGAGGGTGCGCTTGGGTTATAACTATTTTCCCGACGATGACCAATCCAGTGGGGCGGCGATCGGCGTGGAAGACTTATTTGTTGGCCAATCCCCTTTGAGTGTGAGCGGTGACTATTACACCAATTTTGCTGGACAACAGGGGGGCGGGGCGAATCTGCAATACTATCTCTTGCCTCTGGGTTGGTACGTCAATGTCACTCCCCTGCTTGGTTACCGGGCGATCGCCCAAAATGATTACCACAGTGAGGGGTTTAATGTGGGGGGCAAAGTGGTCTTGGCCCTTTCCCGCACCGGAGCGGCGGACATCAGCTTCAGCCAAAATTTTGTTGCTCCTGGGGGCACAGCAGAAGTGGGCGTTAGCACCCTTTCCGTGGGCTATGCGTTGACTCCCCAATGGCGCATTGCCACAGATGTACAACGGCAAAATTCCCCCGCCTACCGGGAAAGTCGCTTTGGAGTTTATCTGGAGTGGCAACCCCAGCAACGTTAG

Protein

MTVIFRGWLSLLPSSLVIFSAIASVGSVGAQEPGENPLDLEPAMVESSPTLQRWWEETPDLFEQNNNDPAFLTRVRLGYNYFPDDDQSSGAAIGVEDLFVGQSPLSVSGDYYTNFAGQQGGGANLQYYLLPLGWYVNVTPLLGYRAIAQNDYHSEGFNVGGKVVLALSRTGAADISFSQNFVAPGGTAEVGVSTLSVGYALTPQWRIATDVQRQNSPAYRESRFGVYLEWQPQQR