Your browser is old and dusty. Try Google Chrome!

Details for sll1325

ORF sll1325
Accession NP_440056.1
Symbol atpD
Category ATP synthase
Definition ATP synthase delta chain of CF(1)
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -266 -252 3.04785 0.168
NP_441061.1_2 Reverse -85 -99 2.06454 0.179
NP_441061.1_2 Forward -284 -270 -0.197071 0.223
NP_441061.1_2 Forward -379 -365 -1.08205 0.249
NP_441061.1_3 Reverse -374 -393 21.7297 0.024
NP_440795.1_7 Forward -379 -372 14.6904 0.0123
NP_440795.1_7 Reverse -372 -379 14.6904 0.0123
NP_440795.1_7 Forward -70 -63 14.6904 0.0123
NP_440795.1_7 Reverse -63 -70 14.6904 0.0123
NP_440795.1_7 Forward -98 -91 7.80726 0.232
NP_441418.1_6 Reverse -62 -81 -10.227 0.0328
NP_441418.1_6 Reverse -371 -390 -20.65 0.121
NP_440815.1_2 Forward -286 -272 18.9768 0.162
NP_440897.1_6 Forward -71 -52 0.883656 0.175
NP_440897.1_6 Forward -380 -361 -1.27961 0.187
NP_441453.1_1 Reverse -364 -382 5.22993 0.251
NP_441453.1_4 Reverse -371 -379 16.539 0.00633
NP_441453.1_4 Reverse -62 -70 16.539 0.00633
NP_441453.1_4 Forward -380 -372 16.539 0.00633
NP_441453.1_4 Forward -71 -63 7.8859 0.0536
NP_442151.1_6 Reverse -371 -385 18.7808 0.00618
NP_442151.1_6 Reverse -62 -76 7.76774 0.19
NP_442151.1_6 Forward -380 -366 7.37441 0.2
NP_441818.1_1 Reverse -202 -213 11.0712 0.203
NP_441818.1_1 Reverse -127 -138 11.0712 0.203
NP_440226.1_1 Forward -380 -361 5.60432 0.151
NP_440226.1_1 Reverse -371 -390 2.3594 0.267
NP_442623.1_3 Forward -209 -190 -19.2734 0.284
NP_440996.1_3 Forward -393 -375 10.8356 0.247
NP_443002.1_5 Forward -284 -266 14.0797 0.202
NP_442173.1_1 Forward -379 -371 15.4574 0.00633
NP_442173.1_1 Forward -70 -62 15.4574 0.00633
NP_442173.1_1 Reverse -372 -380 15.4574 0.00633
NP_442173.1_1 Forward -10 -2 10.4425 0.0695
NP_442173.1_1 Reverse -63 -71 8.27922 0.101
NP_442173.1_1 Forward -134 -126 5.0343 0.24
NP_442752.1_4 Forward -380 -373 13.8055 0.0199
NP_442752.1_4 Reverse -371 -378 13.8055 0.0199
NP_442752.1_4 Reverse -62 -69 13.8055 0.0199
NP_443027.1_4 Reverse -369 -379 13.943 0.0452
NP_443027.1_4 Reverse -60 -70 13.2547 0.0521
NP_441812.1_3 Forward -381 -367 13.2743 0.167
NP_442975.1_10 Reverse -367 -381 12.0937 0.0477
NP_442975.1_10 Forward -293 -279 5.1122 0.233
NP_442975.1_10 Forward -75 -61 2.75226 0.269
NP_441225.1_4 Forward -384 -365 -3.14714 0.246
NP_440784.1_7 Forward -379 -372 15.9687 0.0123
NP_440784.1_7 Reverse -372 -379 15.9687 0.0123
NP_440784.1_7 Forward -70 -63 15.9687 0.0123
NP_440784.1_7 Reverse -63 -70 15.9687 0.0123
NP_440061.1_3 Reverse -225 -244 11.6025 0.235
NP_440061.1_9 Forward -382 -368 13.6669 0.0775
NP_440928.1_5 Reverse -85 -103 23.5203 0.0299
NP_440928.1_5 Reverse -271 -289 17.6204 0.075
NP_440110.1_8 Forward -26 -7 -0.295539 0.22
NP_441476.1_5 Reverse -340 -359 -1.96717 0.214
NP_441476.1_5 Reverse -79 -98 -2.95047 0.231
NP_440878.1_9 Reverse -80 -99 4.62101 0.174
NP_440878.1_9 Reverse -215 -234 -2.65548 0.273
NP_442062.1_8 Forward -380 -370 19.4496 0.000558
NP_442062.1_8 Reverse -371 -381 17.3846 0.00193
NP_442062.1_8 Reverse -62 -72 9.41981 0.0625
NP_442062.1_8 Forward -135 -125 7.74818 0.0897
NP_440761.1_4 Reverse -366 -385 -13.4719 0.257
NP_441859.1_3 Reverse -61 -80 8.06178 0.146
NP_441859.1_3 Forward -381 -362 5.01354 0.209
NP_441859.1_3 Reverse -370 -389 1.17865 0.293
NP_440304.1_4 Reverse -60 -70 10.8948 0.051
NP_440304.1_4 Reverse -369 -379 9.91146 0.051
NP_440304.1_4 Forward -382 -372 1.84832 0.299
NP_442242.1_4 Forward -379 -372 14.3954 0.0124
NP_442242.1_4 Reverse -372 -379 14.3954 0.0124
NP_442242.1_4 Forward -70 -63 14.3954 0.0124
NP_442242.1_4 Reverse -63 -70 14.3954 0.0124
NP_441581.1_3 Forward -196 -177 17.109 0.276
NP_439902.1_10 Forward -245 -226 13.5691 0.164
NP_439918.1_2 Reverse -264 -283 8.16093 0.143
NP_439918.1_2 Forward -165 -146 0.0977854 0.227
NP_441352.1_2 Forward -142 -123 2.26107 0.222
NP_441352.1_4 Forward -83 -64 12.7825 0.238
NP_441208.1_9 Forward -383 -369 16.4209 0.0669
NP_441208.1_9 Forward -74 -60 7.37441 0.222
NP_441594.1_6 Reverse -365 -384 -0.0988766 0.297
NP_442196.1_10 Forward -281 -262 17.6007 0.133
NP_440370.1_10 Forward -389 -370 8.45592 0.241
NP_442742.1_9 Reverse -142 -161 -10.522 0.269
NP_442110.1_7 Reverse -371 -385 1.76955 0.222
NP_442110.1_7 Reverse -78 -92 1.17956 0.236
NP_442726.1_1 Reverse -271 -290 11.9958 0.179
NP_440856.1_4 Forward -42 -23 -4.6221 0.265
NP_441083.1_5 Reverse -371 -381 20.3345 0.00053
NP_441083.1_5 Forward -380 -370 11.3864 0.0159
NP_441083.1_5 Forward -71 -61 10.0098 0.0214
NP_441083.1_5 Reverse -62 -72 9.61647 0.0243
NP_441083.1_5 Reverse -185 -195 2.33998 0.195
NP_441149.1_9 Reverse -290 -309 11.0117 0.0964
NP_441738.1_2 Forward -378 -371 15.28 0.0102
NP_441738.1_2 Reverse -373 -380 15.28 0.0102
NP_441738.1_2 Forward -69 -62 15.28 0.0102
NP_441558.1_5 Reverse -369 -388 14.6508 0.0482
NP_441645.1_9 Forward -193 -174 17.2074 0.273
NP_440209.1_1 Reverse -371 -379 18.1123 0.00295
NP_440209.1_1 Reverse -62 -70 18.1123 0.00295
NP_440209.1_1 Forward -380 -372 18.1123 0.00295
NP_440209.1_1 Forward -71 -63 15.1624 0.00583
NP_442889.1_8 Reverse -368 -382 13.372 0.0588
NP_440056.1_1 Forward -284 -265 32.0554 0.00000332
NP_440056.1_1 Forward -359 -340 19.5673 0.0555
NP_440056.1_1 Forward -98 -79 14.2574 0.146
NP_440056.1_2 Forward -353 -334 23.2056 0.0407
NP_440056.1_3 Forward -308 -289 20.4523 0.205
NP_440056.1_4 Forward -38 -19 25.4217 0.00398
NP_440056.1_5 Forward -182 -163 19.764 0.231
NP_440056.1_6 Forward -140 -121 27.8114 0.0000139
NP_440056.1_9 Forward -397 -378 18.069 0.152
NP_441713.1_1 Reverse -365 -384 -4.42544 0.113
NP_441713.1_1 Forward -386 -367 -14.2585 0.257
NP_442570.1_3 Reverse -267 -286 3.04771 0.177
NP_442570.1_3 Forward -244 -225 -6.98204 0.265
NP_442445.1_2 Reverse -347 -366 17.5024 0.19
NP_441716.1_1 Reverse -371 -385 13.1759 0.0689
NP_441716.1_1 Reverse -62 -76 6.3911 0.198
NP_441716.1_1 Forward -380 -366 5.1128 0.24
NP_441598.1_3 Forward -284 -265 14.4242 0.161
NP_442111.1_4 Forward -72 -58 10.816 0.0518
NP_442111.1_4 Forward -381 -367 9.93102 0.0575
NP_442111.1_4 Reverse -61 -75 8.16106 0.0794
NP_442111.1_4 Reverse -370 -384 2.94952 0.259
NP_441163.1_1 Forward -79 -62 8.00291 0.233
NP_441163.1_1 Reverse -363 -380 5.93797 0.267
NP_441387.1_7 Forward -278 -259 9.63589 0.209
NP_440343.1_3 Reverse -152 -170 12.5064 0.132
NP_440343.1_3 Reverse -134 -152 12.1131 0.134
NP_440906.1_5 Forward -379 -372 15.8704 0.0124
NP_440906.1_5 Reverse -372 -379 15.8704 0.0124
NP_440906.1_5 Forward -70 -63 15.8704 0.0124
NP_440906.1_5 Reverse -63 -70 15.8704 0.0124
NP_440747.1_7 Reverse -264 -282 16.0471 0.28
NP_440747.1_10 Forward -383 -371 24.7201 0.00036
NP_440747.1_10 Forward -74 -62 5.44718 0.0137
NP_440747.1_10 Reverse -368 -380 -2.02597 0.0196
NP_440747.1_10 Reverse -59 -71 -2.4193 0.0434
NP_440747.1_10 Reverse -87 -99 -4.38592 0.0974
NP_441130.1_10 Forward -382 -368 9.14437 0.128
NP_441130.1_10 Reverse -66 -80 7.86607 0.146
NP_441486.1_1 Reverse -368 -382 14.1593 0.00654
NP_441486.1_1 Forward -383 -369 4.52282 0.0432
NP_442634.1_4 Reverse -60 -74 -0.000409212 0.149
NP_442634.1_4 Reverse -369 -383 -2.85201 0.156
NP_440403.1_10 Forward -80 -61 5.30933 0.243
NP_440403.1_10 Reverse -90 -109 1.67108 0.288
NP_440057.1_1 Forward -284 -265 20.2556 0.0754
NP_440057.1_1 Forward -98 -79 17.2074 0.13
NP_440057.1_4 Forward -284 -265 17.5056 0.113
NP_441695.1_8 Reverse -90 -104 12.8809 0.22
NP_442848.1_1 Forward -386 -372 -0.393733 0.263
NP_442848.1_5 Forward -286 -268 6.60732 0.232
NP_443018.1_3 Forward -379 -372 14.8871 0.0123
NP_443018.1_3 Reverse -372 -379 14.8871 0.0123
NP_443018.1_3 Forward -70 -63 14.8871 0.0123
NP_443018.1_3 Reverse -63 -70 14.8871 0.0123
NP_443018.1_3 Forward -353 -346 8.49558 0.141
NP_441316.1_7 Reverse -369 -384 1.45486 0.17
NP_441316.1_7 Forward -73 -58 -0.905081 0.218
NP_441634.1_8 Forward -382 -368 15.6342 0.0248
NP_441634.1_9 Reverse -265 -284 10.52 0.252
NP_440376.1_1 Forward -380 -371 19.4693 0.000692
NP_440376.1_1 Reverse -371 -380 19.4693 0.000692
NP_440376.1_1 Reverse -62 -71 9.73449 0.0365
NP_440376.1_1 Forward -71 -62 9.63616 0.0385
NP_440376.1_1 Reverse -90 -99 5.50626 0.131
NP_440376.1_1 Forward -241 -232 0.491382 0.273
NP_441588.1_4 Reverse -373 -383 9.02648 0.14
NP_440266.1_6 Forward -391 -372 6.98015 0.27
NP_442687.1_7 Reverse -370 -380 15.8113 0.0125
NP_442687.1_7 Forward -72 -62 15.8113 0.0125
NP_442687.1_7 Forward -381 -371 8.92815 0.0994
NP_442687.1_7 Forward -136 -126 6.96153 0.147
NP_442687.1_7 Forward -242 -232 4.60159 0.243
NP_442485.1_3 Reverse -259 -278 -1.67217 0.26
NP_442485.1_3 Forward -382 -363 -5.31042 0.289
NP_441846.1_10 Forward -153 -134 -20.7484 0.256
NP_441846.1_10 Forward -243 -224 -22.5183 0.261
NP_441846.1_10 Forward -242 -223 -23.5016 0.289
NP_441422.1_3 Forward -385 -366 14.3226 0.277
NP_441422.1_7 Reverse -369 -386 -0.747806 0.168
NP_441029.1_3 Forward -277 -258 0.294447 0.277
NP_440667.1_2 Reverse -258 -277 -8.06369 0.289
NP_441274.1_3 Forward -182 -163 5.40766 0.204
NP_442658.1_1 Reverse -369 -379 18.7607 0.00222
NP_442658.1_1 Reverse -60 -70 14.2375 0.0237
NP_442658.1_1 Forward -73 -63 12.6642 0.0497
NP_442658.1_1 Forward -382 -372 6.76441 0.214
NP_442198.1_3 Reverse -359 -378 4.32602 0.275
NP_441855.2_4 Forward -79 -60 11.5476 0.211
NP_442782.1_2 Reverse -270 -284 7.37441 0.202
NP_442205.1_2 Forward -340 -321 11.9368 0.26
NP_442205.1_9 Reverse -365 -381 -3.57971 0.287
NP_441414.1_9 Forward -71 -52 15.7324 0.0106
NP_441414.1_9 Forward -380 -361 0.491109 0.0814
NP_441414.1_9 Reverse -371 -390 -1.86883 0.106
NP_441414.1_9 Forward -135 -116 -8.35868 0.234
NP_442300.1_10 Forward -80 -61 16.4207 0.153
NP_439959.1_9 Forward -104 -86 18.997 0.204
NP_442937.1_5 Forward -385 -366 11.2092 0.144
NP_442937.1_5 Forward -98 -79 8.84924 0.209
NP_442321.1_1 Reverse -60 -79 3.73603 0.126
NP_441958.1_5 Forward -381 -371 12.2714 0.00183
NP_441958.1_5 Reverse -370 -380 12.2714 0.00183
NP_441958.1_5 Reverse -61 -71 12.0747 0.00222
NP_441958.1_5 Forward -72 -62 10.6981 0.0112
NP_441958.1_5 Forward -12 -2 0.0783647 0.168
NP_441958.1_5 Forward -136 -126 -0.41329 0.205
NP_441127.1_1 Forward -234 -220 10.6193 0.244
NP_441127.1_1 Forward -29 -15 9.43936 0.275
NP_441127.1_1 Reverse -368 -382 7.9644 0.3
NP_441127.1_7 Forward -282 -263 19.5673 0.143
NP_442836.1_10 Forward -160 -150 15.9097 0.212
NP_440203.1_5 Reverse -374 -384 14.2375 0.0886
NP_439905.1_1 Forward -379 -366 19.3905 0.0174
NP_439905.1_1 Forward -70 -57 9.06573 0.224
NP_439905.1_2 Reverse -79 -93 10.816 0.208
NP_440984.1_7 Reverse -366 -380 12.7826 0.122
NP_440984.1_7 Reverse -57 -71 11.406 0.122
NP_439990.1_5 Forward -385 -372 20.7671 0.00296
NP_439990.1_5 Reverse -57 -70 7.09911 0.212
NP_442376.1_2 Forward -76 -57 -12.5869 0.286
NP_442911.1_2 Reverse -361 -380 11.3075 0.0131
NP_442911.1_2 Forward -390 -371 6.68596 0.0279
NP_442911.1_2 Reverse -116 -135 -9.73531 0.262
NP_440153.1_8 Reverse -84 -97 4.44418 0.2
NP_440153.1_8 Reverse -222 -235 -2.34066 0.235
NP_440993.1_4 Forward -284 -267 22.065 0.106
NP_440138.1_6 Forward -70 -51 7.27514 0.213
NP_442995.1_5 Reverse -57 -76 13.0775 0.197
NP_441348.1_3 Forward -199 -180 17.8957 0.0811
NP_441099.1_5 Reverse -191 -210 1.47442 0.0647
NP_441099.1_5 Forward -81 -62 -7.67036 0.179
NP_441099.1_5 Forward -390 -371 -7.76869 0.18
NP_442002.1_1 Forward -244 -226 -10.3056 0.292
NP_442002.1_9 Reverse -370 -377 10.7572 0.185
NP_440809.1_9 Reverse -362 -380 -7.94566 0.225
NP_441294.1_7 Reverse -367 -381 10.5945 0.181
NP_440411.1_10 Reverse -261 -280 11.9207 0.26
NP_441646.1_1 Forward -387 -368 2.85105 0.211
NP_441646.1_1 Forward -78 -59 -0.197208 0.259
NP_441646.1_1 Reverse -161 -180 -0.590531 0.269
NP_441646.1_1 Reverse -77 -96 -1.27885 0.281
NP_441646.1_1 Forward -248 -229 -1.86883 0.296
NP_441646.1_1 Reverse -119 -138 -1.96717 0.298
NP_442438.1_10 Forward -236 -222 5.70279 0.129
NP_442438.1_10 Reverse -366 -380 4.71948 0.142
NP_442438.1_10 Forward -385 -371 0.786239 0.213
NP_442885.1_1 Reverse -148 -167 11.9958 0.282
NP_441000.1_6 Forward -72 -58 -1.47537 0.213
NP_441000.1_6 Forward -381 -367 -4.13031 0.227
NP_440484.1_3 Reverse -60 -74 9.43936 0.263
NP_440147.1_1 Reverse -365 -384 10.9142 0.189
NP_440147.1_4 Forward -382 -369 19.4888 0.00276
NP_440147.1_4 Reverse -124 -137 12.9006 0.0326
NP_440147.1_4 Forward -73 -60 10.8357 0.0353
NP_440147.1_4 Reverse -369 -382 3.46087 0.187
NP_440147.1_4 Reverse -60 -73 1.29759 0.233
NP_440147.1_4 Reverse -220 -233 0.510939 0.252
NP_441175.1_7 Reverse -371 -390 8.45592 0.21
NP_441550.1_8 Reverse -60 -70 15.8108 0.0132
NP_441550.1_8 Forward -382 -372 14.6309 0.0132
NP_441550.1_8 Forward -73 -63 14.0409 0.0194
NP_441550.1_8 Reverse -369 -379 10.501 0.066
NP_441550.1_8 Forward -137 -127 5.78111 0.23
NP_441916.1_7 Forward -380 -370 18.4663 0.00144
NP_441916.1_7 Forward -71 -61 10.6981 0.0261
NP_441916.1_7 Reverse -371 -381 10.3048 0.0261
NP_441916.1_7 Reverse -62 -72 7.55152 0.0639
NP_441916.1_7 Reverse -2 -12 6.27322 0.102
NP_441916.1_7 Reverse -90 -100 4.60159 0.169
NP_441916.1_10 Forward -302 -283 0.491109 0.281
NP_441041.1_4 Reverse -371 -390 13.7658 0.0221
NP_441041.1_4 Reverse -258 -277 -4.32711 0.135
NP_441041.1_4 Forward -171 -152 -7.37537 0.186
NP_441041.1_4 Forward -183 -164 -11.9969 0.256
NP_441041.1_7 Forward -74 -62 15.3862 0.0264
NP_441041.1_7 Reverse -368 -380 10.2357 0.1
NP_441041.1_7 Forward -383 -371 8.58373 0.133
NP_441041.1_7 Reverse -59 -71 6.25147 0.216
NP_441041.1_7 Forward -219 -207 6.25147 0.216
NP_441041.1_7 Forward -138 -126 5.37687 0.26
NP_442004.1_6 Reverse -371 -385 5.80112 0.181
NP_441725.1_4 Reverse -57 -71 13.1753 0.0693
NP_441725.1_5 Reverse -63 -73 9.81313 0.0462
NP_441725.1_5 Forward -379 -369 9.02648 0.0553
NP_441725.1_5 Reverse -372 -382 2.04498 0.115
NP_441725.1_5 Forward -70 -60 1.94665 0.115
NP_439966.1_7 Reverse -369 -379 17.4824 0.00636
NP_439966.1_7 Reverse -60 -70 14.3359 0.0203
NP_439966.1_7 Forward -382 -372 7.25606 0.15
NP_439966.1_9 Reverse -369 -378 10.7178 0.0863
NP_442941.1_3 Forward -70 -60 19.2529 0.00262
NP_442941.1_3 Reverse -372 -382 11.0914 0.0116
NP_442941.1_3 Forward -379 -369 2.53664 0.14
NP_440289.1_2 Reverse -368 -381 10.2457 0.0272
NP_440289.1_2 Reverse -59 -72 4.73917 0.0649
NP_440289.1_2 Forward -74 -61 -2.83231 0.262
NP_440260.1_8 Reverse -261 -279 -2.0458 0.243
NP_440260.1_8 Reverse -267 -285 -7.749 0.3
NP_441678.1_9 Forward -392 -373 -0.885524 0.235
NP_442281.1_1 Forward -76 -62 13.372 0.0277
NP_442281.1_1 Forward -385 -371 9.53707 0.0685
NP_440177.1_9 Reverse -54 -73 15.6341 0.19
NP_442256.1_2 Forward -73 -55 9.0656 0.0965
NP_440437.1_1 Forward -386 -367 5.40766 0.0868
NP_440647.1_9 Forward -73 -55 4.83737 0.23
NP_442012.1_1 Reverse -365 -384 6.58763 0.125
NP_442012.1_1 Forward -386 -367 1.67108 0.213
NP_442012.1_5 Reverse -263 -282 -0.39387 0.288
NP_441556.1_10 Reverse -366 -380 14.6993 0.161
NP_441556.1_10 Forward -385 -371 13.4339 0.178
NP_440498.1_1 Forward -203 -185 -3.22577 0.259
NP_442982.1_5 Forward -204 -185 -3.04881 0.293
NP_441644.1_6 Reverse -371 -381 17.3841 0.00127
NP_441644.1_6 Forward -71 -61 16.4008 0.00405
NP_441644.1_6 Reverse -62 -72 11.9759 0.0408
NP_441644.1_6 Forward -380 -370 10.1076 0.0628
NP_441644.1_6 Reverse -232 -242 7.0594 0.137
NP_441644.1_6 Forward -99 -89 3.61784 0.272
NP_443049.1_6 Reverse -61 -71 11.7385 0.24
NP_442215.1_2 Reverse -369 -385 13.1366 0.0251
NP_442215.1_5 Reverse -69 -88 13.4708 0.276
NP_442029.1_6 Reverse -264 -283 4.916 0.259
NP_442247.1_8 Reverse -60 -74 10.816 0.247
NP_442247.1_8 Forward -382 -368 8.75105 0.266
NP_440253.1_2 Reverse -371 -389 -1.35749 0.238
NP_440253.1_2 Forward -380 -362 -1.65248 0.245
NP_440929.1_8 Forward -380 -371 19.2726 0.000701
NP_440929.1_8 Reverse -371 -380 19.2726 0.000701
NP_440929.1_8 Reverse -62 -71 9.93116 0.0249
NP_440929.1_8 Forward -71 -62 9.83282 0.0254
NP_442933.1_10 Forward -380 -371 17.601 0.00325
NP_442933.1_10 Reverse -371 -380 17.601 0.00325
NP_442933.1_10 Reverse -62 -71 9.04618 0.063
NP_442933.1_10 Forward -71 -62 8.94785 0.0643
NP_442933.1_10 Forward -135 -126 4.22796 0.267
NP_440430.1_3 Forward -296 -278 19.7837 0.217
NP_441751.2_8 Forward -70 -56 4.32615 0.0511
NP_441751.2_8 Reverse -63 -77 -1.5737 0.129
NP_441751.2_8 Reverse -372 -386 -2.45868 0.132
NP_441751.2_8 Forward -379 -365 -5.50694 0.214
NP_442554.1_8 Forward -70 -60 17.2863 0.00543
NP_442554.1_8 Forward -379 -369 16.008 0.0065
NP_442554.1_8 Reverse -372 -382 15.3197 0.00882
NP_442554.1_8 Reverse -85 -95 6.37155 0.12
NP_442554.1_8 Reverse -63 -73 4.69992 0.176
NP_440435.1_4 Forward -98 -79 19.764 0.24
NP_442075.1_9 Reverse -287 -306 11.7983 0.253
NP_441762.1_7 Forward -381 -369 12.4287 0.0142
NP_441762.1_7 Reverse -370 -382 9.57708 0.0142
NP_441762.1_7 Reverse -61 -73 2.49725 0.0676
NP_441762.1_7 Forward -72 -60 -5.76255 0.238
NP_442313.1_3 Forward -164 -145 7.96426 0.234
NP_442142.1_4 Forward -74 -61 15.1616 0.0289
NP_442142.1_4 Forward -383 -370 14.7683 0.0302
NP_442142.1_4 Reverse -368 -381 6.0169 0.175
NP_442292.1_1 Reverse -372 -381 18.486 0.00229
NP_442292.1_1 Forward -70 -61 17.5026 0.00435
NP_442292.1_1 Forward -379 -370 9.63616 0.0183
NP_442292.1_1 Reverse -63 -72 0.688044 0.23
NP_442476.1_6 Forward -379 -365 16.9125 0.0367
NP_442476.1_6 Forward -70 -56 1.86788 0.202
NP_440895.1_6 Forward -386 -373 11.4257 0.202
NP_443009.1_5 Forward -381 -370 18.3477 0.00265
NP_443009.1_5 Forward -136 -125 11.8579 0.0602
NP_443009.1_5 Reverse -61 -72 8.4163 0.109
NP_443009.1_5 Forward -72 -61 7.03967 0.141
NP_441715.1_4 Forward -70 -60 16.7946 0.0106
NP_441715.1_4 Forward -379 -369 9.32148 0.097
NP_441715.1_4 Reverse -372 -382 7.94484 0.107
NP_440620.1_4 Forward -400 -386 13.8579 0.281
NP_443034.1_4 Forward -86 -67 18.3873 0.196
NP_440379.1_5 Reverse -75 -94 -9.73531 0.264
NP_440379.1_5 Forward -96 -77 -10.7186 0.283
NP_440379.1_5 Reverse -261 -280 -10.9153 0.285
NP_440379.1_5 Forward -108 -89 -11.7019 0.3
NP_440464.1_10 Reverse -372 -382 13.0082 0.169
NP_441468.1_1 Forward -379 -372 15.8704 0.0124
NP_441468.1_1 Reverse -372 -379 15.8704 0.0124
NP_441468.1_1 Forward -70 -63 15.8704 0.0124
NP_441468.1_1 Reverse -63 -70 15.8704 0.0124
NP_441468.1_1 Forward -10 -3 3.67736 0.282
NP_441020.2_6 Forward -73 -56 12.9202 0.0824
NP_441015.1_10 Forward -98 -79 -0.0988766 0.168
NP_441015.1_10 Reverse -366 -385 -4.13045 0.199
NP_441673.1_1 Forward -380 -371 20.8459 0.000698
NP_441673.1_1 Reverse -371 -380 20.8459 0.000698
NP_441673.1_1 Reverse -62 -71 11.1111 0.0121
NP_441673.1_1 Forward -71 -62 11.0128 0.018
NP_441731.1_3 Reverse -54 -73 1.57275 0.215
NP_441826.1_2 Forward -77 -63 10.816 0.044
NP_441826.1_2 Forward -386 -372 4.91614 0.0979
NP_441330.1_1 Forward -284 -265 -4.52377 0.0983
NP_441330.1_1 Reverse -57 -76 -5.21209 0.113
NP_441330.1_1 Forward -371 -352 -7.67036 0.183
NP_441330.1_1 Forward -359 -340 -15.5368 0.285
NP_441330.1_1 Forward -104 -85 -15.6352 0.289
NP_441637.1_8 Forward -238 -221 11.3469 0.231
NP_442063.1_2 Reverse -215 -234 -2.0655 0.234
NP_442063.1_9 Forward -255 -236 3.04771 0.267
NP_442868.1_6 Reverse -60 -70 10.4031 0.038
NP_442868.1_6 Forward -382 -372 9.81313 0.038
NP_442868.1_6 Forward -73 -63 8.82982 0.0555
NP_442868.1_6 Reverse -369 -379 8.53483 0.0555
NP_440785.1_3 Reverse -342 -361 16.8132 0.113
NP_441517.1_6 Forward -360 -341 16.4207 0.238
NP_441612.1_2 Reverse -371 -381 8.54929 0.21
NP_441911.1_10 Forward -231 -212 8.17337 0.267
NP_442808.1_1 Reverse -370 -380 18.4657 0.00201
NP_442808.1_1 Forward -72 -62 9.12434 0.0481
NP_442808.1_1 Forward -381 -371 8.63269 0.0481
NP_441101.1_10 Forward -384 -365 1.17943 0.173
NP_441290.1_1 Reverse -161 -180 13.7658 0.0933
NP_440145.1_3 Forward -390 -371 8.65258 0.0446
NP_440145.1_3 Forward -289 -270 -2.65548 0.176
NP_442542.1_2 Reverse -369 -382 11.9173 0.114
NP_442050.1_5 Reverse -60 -70 15.9091 0.0091
NP_442050.1_5 Reverse -369 -379 8.23937 0.234
NP_442050.1_5 Forward -382 -372 7.64939 0.243
NP_442342.1_9 Reverse -369 -385 9.39998 0.162
NP_441493.2_10 Forward -391 -372 7.07928 0.249
NP_441114.1_3 Reverse -234 -243 15.1427 0.193
NP_441114.1_3 Forward -259 -250 14.5527 0.193
NP_441114.1_3 Forward -25 -16 7.27622 0.247
NP_440558.1_2 Forward -288 -269 -6.58872 0.277
NP_441878.1_6 Forward -381 -371 10.4031 0.0176
NP_441878.1_6 Reverse -370 -380 10.4031 0.0176
NP_441878.1_6 Forward -72 -62 10.4031 0.0176
NP_441878.1_6 Reverse -61 -71 0.766681 0.134
NP_441878.1_6 Forward -100 -90 -6.60814 0.193
NP_441878.1_6 Forward -242 -232 -7.19813 0.21
NP_441878.1_6 Forward -136 -126 -7.68978 0.255
NP_441878.1_10 Forward -94 -80 11.111 0.289
NP_441036.1_8 Reverse -370 -380 17.7779 0.000554
NP_441036.1_8 Reverse -25 -35 8.53483 0.174
NP_441036.1_8 Forward -381 -371 8.33817 0.174
NP_441036.1_8 Forward -48 -38 7.84651 0.183
NP_441036.1_8 Forward -72 -62 6.07655 0.242
NP_441036.1_8 Reverse -61 -71 6.07655 0.242
NP_442650.1_2 Reverse -371 -385 8.25939 0.13
NP_442503.1_9 Forward -261 -242 4.916 0.29
NP_441557.1_5 Forward -380 -371 19.9609 0.000699
NP_441557.1_5 Reverse -371 -380 19.9609 0.000699
NP_441557.1_5 Reverse -62 -71 10.8161 0.00464
NP_441557.1_5 Forward -71 -62 10.4228 0.00915
NP_441557.1_5 Forward -11 -2 -0.491928 0.193
NP_441557.1_5 Forward -135 -126 -0.983583 0.272
NP_441445.1_1 Reverse -362 -381 9.24257 0.108
NP_441445.1_1 Forward -389 -370 7.17762 0.138
NP_441445.1_1 Forward -144 -125 3.14605 0.218
NP_441590.1_4 Forward -283 -264 2.6536 0.293
NP_442267.1_4 Reverse -274 -293 9.93088 0.111
NP_442066.2_9 Reverse -58 -71 20.0788 0.00699
NP_442066.2_9 Reverse -367 -380 10.934 0.154
NP_442419.1_2 Forward -98 -79 -3.44213 0.264
NP_440738.1_5 Forward -376 -357 1.0811 0.297
NP_441308.1_8 Reverse -369 -379 9.22315 0.226
NP_440101.1_3 Reverse -366 -385 8.06259 0.17
NP_440101.1_10 Forward -171 -152 2.75272 0.245
NP_441458.1_10 Reverse -75 -94 12.3892 0.091
NP_441458.1_10 Reverse -81 -100 7.27595 0.196
NP_441458.1_10 Forward -288 -269 4.52268 0.23
NP_441564.1_10 Forward -110 -91 10.5209 0.146
NP_442192.1_8 Reverse -80 -99 11.0125 0.259
NP_442183.1_1 Forward -380 -366 10.816 0.0784
NP_442183.1_1 Reverse -62 -76 8.75105 0.109
NP_442183.1_1 Forward -71 -57 4.12949 0.277
NP_441407.1_5 Forward -109 -90 10.2259 0.147
NP_440276.1_8 Reverse -266 -285 21.4356 0.0379
NP_442347.1_2 Reverse -372 -381 12.4878 0.056
NP_442347.1_2 Forward -379 -370 11.1111 0.056
NP_442347.1_2 Forward -34 -25 4.32629 0.284
NP_442347.1_2 Forward -70 -61 3.34298 0.284
NP_442645.1_2 Forward -388 -369 -3.93378 0.0525
NP_442645.1_2 Forward -143 -124 -9.53865 0.142
NP_442645.1_2 Forward -101 -82 -16.3235 0.23
NP_442965.1_2 Forward -300 -281 -8.752 0.294
NP_441037.1_4 Reverse -369 -379 16.2838 0.0168
NP_441037.1_4 Forward -73 -63 8.19481 0.237
NP_441037.1_4 Forward -382 -372 7.9999 0.237
NP_441037.1_4 Reverse -60 -70 7.22024 0.237
NP_442594.1_8 Forward -161 -142 5.50599 0.247
NP_442317.1_6 Reverse -121 -140 3.6377 0.262
NP_441633.1_3 Forward -382 -369 18.3088 0.00715
NP_441633.1_3 Reverse -173 -186 4.64084 0.0699
NP_441633.1_3 Reverse -124 -137 2.37923 0.0969
NP_441633.1_3 Reverse -369 -382 -3.71729 0.177
NP_441633.1_3 Reverse -60 -73 -4.01229 0.179
NP_440136.1_1 Reverse -278 -294 16.0857 0.206
NP_440136.1_2 Forward -379 -372 15.9687 0.0123
NP_440136.1_2 Reverse -372 -379 15.9687 0.0123
NP_440136.1_2 Forward -70 -63 15.9687 0.0123
NP_440136.1_2 Reverse -63 -70 15.9687 0.0123
NP_442590.1_10 Reverse -185 -204 8.84924 0.204
NP_442998.1_5 Forward -394 -384 10.2065 0.222
NP_442998.1_10 Forward -378 -371 15.5754 0.0102
NP_442998.1_10 Reverse -373 -380 15.5754 0.0102
NP_442998.1_10 Forward -69 -62 15.5754 0.0102
NP_442998.1_10 Reverse -64 -71 5.84064 0.235
NP_440731.1_2 Forward -392 -373 4.52268 0.293
NP_440299.1_1 Forward -384 -371 22.3398 0.000547
NP_440299.1_1 Reverse -86 -99 14.7683 0.0223
NP_440299.1_1 Forward -75 -62 9.85179 0.0646
NP_440299.1_1 Reverse -218 -231 8.08184 0.098
NP_440299.1_1 Reverse -367 -380 7.59019 0.109
NP_440299.1_1 Forward -97 -84 2.18201 0.294
NP_441799.1_1 Reverse -367 -381 15.0436 0.0206
NP_441799.1_1 Forward -384 -370 11.4053 0.0589
NP_441799.1_1 Forward -75 -61 7.66879 0.136
NP_441799.1_1 Reverse -58 -72 6.39049 0.174
NP_442504.1_3 Forward -94 -75 5.70265 0.254
NP_441007.1_10 Reverse -57 -70 10.2457 0.0723
NP_441007.1_10 Reverse -366 -379 4.44418 0.182
NP_442201.1_10 Forward -82 -63 -6.78538 0.184
NP_442201.1_10 Forward -146 -127 -8.35868 0.216
NP_440256.1_1 Reverse -87 -106 0.982764 0.0791
NP_440256.1_1 Forward -383 -364 -1.96717 0.111
NP_440256.1_1 Forward -282 -263 -3.83545 0.14
NP_440256.1_1 Forward -74 -55 -4.91709 0.169
NP_441957.1_1 Reverse -244 -263 4.71934 0.279
NP_441559.1_8 Forward -385 -371 2.65453 0.143
NP_441559.1_8 Reverse -366 -380 2.45787 0.143
NP_441559.1_8 Forward -265 -251 -7.08024 0.283
NP_440915.1_6 Reverse -58 -72 6.88276 0.0779
NP_440915.1_6 Forward -75 -61 5.21113 0.0924
NP_440915.1_6 Forward -384 -370 3.73617 0.1
NP_440915.1_6 Reverse -367 -381 -2.16369 0.26
NP_442158.1_4 Reverse -320 -330 13.5497 0.231
NP_441704.1_8 Reverse -196 -215 7.66846 0.233
NP_442555.1_5 Forward -362 -343 24.9755 0.0151
NP_442866.1_1 Reverse -57 -76 1.96607 0.158
NP_442866.1_1 Reverse -366 -385 -7.67036 0.268
NP_442866.1_4 Reverse -270 -289 4.42435 0.249
NP_440748.1_5 Reverse -353 -372 -0.197208 0.256
NP_441464.1_8 Forward -380 -366 9.2427 0.192
NP_441464.1_8 Reverse -105 -119 3.93283 0.283
NP_440787.1_5 Forward -367 -353 9.93102 0.256
NP_441939.1_3 Forward -70 -51 7.17762 0.21
NP_441199.1_6 Forward -75 -56 3.53937 0.179
NP_442993.1_1 Forward -380 -364 -9.77456 0.194
NP_442993.1_1 Reverse -377 -393 -12.7245 0.278
NP_442386.1_5 Forward -176 -157 3.83357 0.29
NP_442386.1_9 Reverse -370 -379 15.7322 0.0144
NP_442386.1_9 Forward -381 -372 13.8639 0.0289
NP_442386.1_9 Forward -72 -63 8.35743 0.201
NP_442386.1_9 Forward -94 -85 8.2591 0.205
NP_442386.1_9 Reverse -61 -70 6.39082 0.219
NP_440570.1_5 Reverse -241 -260 -0.688862 0.263
NP_440570.1_5 Forward -283 -264 -2.0655 0.277
NP_441750.1_1 Forward -165 -146 -13.1769 0.3
NP_441340.1_5 Forward -379 -372 15.6737 0.0124
NP_441340.1_5 Reverse -372 -379 15.6737 0.0124
NP_441340.1_5 Forward -70 -63 15.6737 0.0124
NP_441340.1_5 Reverse -63 -70 15.6737 0.0124
NP_442484.1_2 Reverse -79 -98 -1.7705 0.298
NP_442791.1_5 Reverse -158 -177 -4.52377 0.279
NP_440168.1_2 Reverse -82 -101 -3.04881 0.276
NP_440168.1_8 Reverse -365 -384 3.73603 0.244
NP_440168.1_9 Forward -73 -54 -4.42544 0.296
NP_440327.1_6 Reverse -264 -283 19.9606 0.0485
NP_440327.1_6 Reverse -258 -277 8.94757 0.214
NP_442506.1_9 Reverse -264 -283 6.78429 0.287
NP_442240.1_2 Reverse -372 -391 -19.2734 0.295
NP_440161.1_3 Forward -73 -54 11.0125 0.221
NP_442950.1_1 Forward -302 -283 6.39097 0.157
NP_440586.1_1 Reverse -364 -383 -3.73712 0.273
NP_440586.1_8 Forward -379 -372 13.2151 0.026
NP_440586.1_8 Forward -70 -63 13.2151 0.026
NP_440586.1_8 Reverse -372 -379 13.2151 0.026
NP_440586.1_8 Reverse -63 -70 13.2151 0.026
NP_440586.1_8 Forward -331 -324 5.93863 0.283
NP_442251.1_6 Forward -379 -372 15.2804 0.0124
NP_442251.1_6 Reverse -372 -379 15.2804 0.0124
NP_442251.1_6 Forward -70 -63 15.2804 0.0124
NP_442251.1_6 Reverse -63 -70 15.2804 0.0124
NP_440192.1_4 Forward -218 -199 9.78569 0.264
NP_442959.1_5 Forward -325 -306 9.0459 0.224
NP_440684.1_9 Forward -77 -63 6.58777 0.298
NP_441262.1_3 Reverse -371 -378 14.7888 0.0223
NP_441262.1_3 Reverse -62 -69 14.7888 0.0223
NP_441262.1_3 Forward -380 -373 14.7888 0.0223
NP_441262.1_3 Forward -71 -64 6.52896 0.0809
NP_441262.1_3 Reverse -26 -33 5.34899 0.181
NP_440027.1_3 Forward -241 -223 9.6548 0.184
NP_440027.1_8 Reverse -266 -285 8.55343 0.246
NP_443051.1_1 Reverse -61 -70 19.5676 0.00335
NP_443051.1_1 Reverse -370 -379 10.4228 0.00754
NP_443051.1_1 Forward -381 -372 10.4228 0.00754
NP_443051.1_1 Forward -72 -63 8.65285 0.029
NP_443051.1_1 Forward -12 -3 -1.08191 0.281
NP_439937.1_9 Forward -381 -364 12.6244 0.0317
NP_439937.1_9 Forward -262 -245 -16.4814 0.287
NP_441595.1_2 Reverse -310 -323 8.94252 0.278
NP_440439.1_1 Reverse -368 -381 11.9173 0.0288
NP_440439.1_1 Forward -197 -184 5.13249 0.0934
NP_440439.1_1 Reverse -59 -72 4.64084 0.0998
NP_440439.1_1 Forward -383 -370 0.314277 0.194
NP_440372.1_2 Forward -379 -372 16.3621 0.0124
NP_440372.1_2 Reverse -372 -379 16.3621 0.0124
NP_440372.1_2 Forward -70 -63 16.3621 0.0124
NP_440372.1_2 Reverse -63 -70 16.3621 0.0124
NP_440271.1_2 Forward -250 -231 1.86774 0.284
NP_440171.1_3 Forward -138 -119 1.27776 0.294
NP_441789.1_7 Reverse -176 -195 -3.93454 0.28
NP_440316.1_10 Reverse -61 -71 12.1731 0.214
NP_440316.1_10 Forward -100 -90 5.68323 0.29
NP_442488.1_7 Reverse -369 -388 9.3409 0.277
NP_441803.1_2 Forward -385 -366 5.40766 0.17
NP_439977.1_5 Reverse -365 -384 5.01433 0.15
NP_439977.1_6 Forward -282 -264 17.7187 0.271
NP_440139.1_1 Reverse -56 -75 4.71854 0.174
NP_440139.1_1 Forward -141 -122 0.686995 0.284
NP_441572.1_7 Reverse -365 -384 -6.1954 0.284
NP_442384.1_10 Reverse -371 -384 17.4239 0.00585
NP_442384.1_10 Forward -380 -367 9.36073 0.054
NP_442384.1_10 Forward -71 -58 8.37742 0.0656
NP_442384.1_10 Reverse -62 -75 8.27909 0.0674
NP_442114.1_4 Forward -380 -369 12.1534 0.107
NP_442114.1_4 Forward -71 -60 8.22014 0.214
NP_441018.1_7 Reverse -266 -285 9.3409 0.227
NP_442790.1_4 Forward -80 -61 -0.39387 0.0942
NP_442790.1_4 Reverse -53 -72 -5.70374 0.144
NP_442262.1_10 Forward -379 -372 14.1988 0.0123
NP_442262.1_10 Reverse -372 -379 14.1988 0.0123
NP_442262.1_10 Forward -70 -63 14.1988 0.0123
NP_442262.1_10 Reverse -63 -70 14.1988 0.0123
NP_442262.1_10 Forward -353 -346 8.59391 0.22
NP_441689.1_5 Reverse -60 -70 8.3377 0.132
NP_441689.1_5 Forward -382 -372 5.78111 0.197
NP_442244.1_6 Forward -267 -248 4.42435 0.291
NP_440344.1_10 Reverse -364 -381 10.5603 0.00697
NP_440344.1_10 Forward -78 -61 -0.747806 0.0454
NP_440344.1_10 Forward -387 -370 -9.49926 0.147
NP_440531.1_6 Reverse -363 -382 1.47442 0.176
NP_441060.1_4 Forward -376 -358 2.96908 0.252
NP_442910.1_1 Forward -78 -59 2.45773 0.118
NP_442910.1_1 Reverse -322 -341 -8.55534 0.299
NP_441965.1_10 Reverse -368 -384 14.9065 0.0714
NP_441640.1_8 Forward -359 -340 -2.75381 0.238
NP_442529.1_4 Forward -80 -61 14.7491 0.172
NP_442556.1_10 Reverse -326 -345 9.40375 0.277
NP_440297.1_9 Reverse -63 -73 1.16001 0.282
NP_440297.1_9 Reverse -372 -382 -0.118297 0.282
NP_440297.1_9 Forward -379 -369 -0.216628 0.282
NP_440297.1_9 Forward -70 -60 -0.216628 0.282
NP_442187.1_3 Reverse -61 -71 15.0247 0.12
NP_442280.1_10 Reverse -266 -284 11.2011 0.213
NP_442280.1_10 Reverse -80 -98 11.2011 0.213
NP_442280.1_10 Reverse -260 -278 4.67522 0.296
NP_441592.1_4 Forward -71 -52 -3.63879 0.286
NP_441896.1_3 Reverse -362 -381 0.294447 0.229
NP_441896.1_3 Forward -193 -174 -3.24547 0.297
NP_441896.1_5 Reverse -275 -282 12.2322 0.273
NP_442378.1_4 Forward -154 -135 14.7491 0.251
NP_440894.1_10 Reverse -366 -385 8.84924 0.168
NP_440894.1_10 Forward -397 -378 4.32602 0.254
NP_440937.1_5 Forward -360 -341 8.55425 0.281
NP_440999.1_9 Reverse -367 -381 18.6825 0.0156
NP_440999.1_9 Forward -75 -61 0.786239 0.177
NP_440999.1_9 Forward -381 -367 -1.18038 0.229
NP_440888.1_2 Forward -380 -366 15.3386 0.0113
NP_440888.1_2 Forward -71 -57 10.3237 0.0974
NP_440888.1_2 Reverse -371 -385 9.04542 0.139
NP_440888.1_2 Reverse -84 -98 7.47213 0.194
NP_440888.1_2 Reverse -222 -236 7.3738 0.198
NP_440600.1_4 Forward -79 -61 8.96727 0.0635
NP_440052.1_5 Reverse -334 -353 -3.63879 0.24
NP_441748.1_3 Reverse -363 -382 18.7011 0.135
NP_442948.1_2 Forward -381 -362 5.40766 0.256
NP_442033.1_10 Reverse -369 -388 3.53937 0.0872
NP_442512.1_3 Reverse -204 -223 7.7676 0.3
NP_441543.1_2 Forward -379 -370 18.486 0.00236
NP_441543.1_2 Reverse -372 -381 16.9127 0.00359
NP_441543.1_2 Forward -70 -61 15.9293 0.00518
NP_441543.1_3 Reverse -148 -162 11.602 0.181
NP_442845.1_2 Forward -99 -85 6.78443 0.202
NP_442845.1_2 Reverse -365 -379 4.42448 0.259
NP_442845.1_2 Forward -386 -372 4.03116 0.271
NP_442845.1_2 Forward -77 -63 3.44117 0.29
NP_441834.1_7 Reverse -359 -378 16.2241 0.209
NP_441834.1_10 Reverse -378 -397 0.687771 0.287
NP_440208.1_1 Reverse -248 -267 -10.227 0.257
NP_441319.1_8 Forward -386 -368 5.62401 0.277
NP_441918.1_7 Reverse -370 -389 -0.295539 0.297
NP_441469.1_8 Reverse -370 -379 16.126 0.00797
NP_441469.1_8 Forward -72 -63 12.6844 0.0995
NP_441469.1_8 Forward -12 -3 9.73449 0.227
NP_441469.1_8 Reverse -61 -70 6.5879 0.227
NP_441469.1_8 Forward -381 -372 6.48957 0.227
NP_443064.1_6 Reverse -371 -381 12.5669 0.0796
NP_443064.1_6 Reverse -126 -136 11.3065 0.13
NP_442337.1_6 Forward -255 -236 15.4966 0.198
NP_442578.1_7 Forward -379 -372 14.5921 0.026
NP_442578.1_7 Forward -70 -63 14.5921 0.026
NP_442578.1_7 Reverse -372 -379 14.5921 0.026
NP_442578.1_7 Reverse -63 -70 14.5921 0.026
NP_442578.1_7 Reverse -27 -34 5.34899 0.2
NP_440710.1_1 Reverse -54 -72 -8.04399 0.254
NP_440710.1_1 Reverse -224 -242 -8.33898 0.262
NP_440148.1_3 Forward -103 -89 17.7975 0.208
NP_441462.1_2 Reverse -62 -72 17.8763 0.00406
NP_441462.1_2 Forward -380 -370 11.5831 0.00406
NP_441462.1_2 Reverse -371 -381 11.5831 0.00406
NP_441462.1_2 Forward -71 -61 10.4031 0.011
NP_441462.1_2 Reverse -90 -100 -0.806614 0.254
NP_441462.1_2 Reverse -2 -12 -0.904945 0.265
NP_441462.1_5 Forward -148 -129 4.22769 0.285
NP_441621.1_3 Forward -356 -338 14.9655 0.182
NP_441621.1_7 Reverse -369 -383 6.58777 0.068
NP_441621.1_7 Forward -382 -368 -3.44199 0.188
NP_443062.1_1 Forward -71 -53 16.1515 0.0321
NP_443062.1_1 Reverse -371 -389 3.57305 0.293
NP_443062.1_3 Forward -90 -74 16.6765 0.146
NP_443062.1_6 Forward -388 -369 16.6174 0.0638
NP_441601.1_4 Reverse -151 -170 -5.21209 0.293
NP_440349.1_2 Reverse -155 -174 19.2723 0.175
NP_442204.1_1 Forward -384 -373 8.7118 0.0852
NP_442204.1_1 Reverse -58 -69 1.82863 0.266
NP_442204.1_1 Forward -163 -152 -0.137991 0.286
NP_442204.1_5 Reverse -361 -380 6.68596 0.142
NP_441560.1_8 Forward -385 -366 15.5056 0.106
NP_441560.1_10 Forward -79 -60 8.35759 0.251
NP_440516.1_2 Reverse -365 -383 5.91901 0.122
NP_440516.1_2 Forward -386 -368 4.44404 0.138
NP_440516.1_8 Reverse -62 -71 18.9776 0.00442
NP_440516.1_8 Forward -380 -371 16.9127 0.00442
NP_440516.1_8 Reverse -371 -380 16.9127 0.00442
NP_440516.1_8 Forward -71 -62 7.07956 0.0867
NP_442428.1_4 Reverse -370 -389 5.50599 0.212
NP_442428.1_5 Forward -379 -372 15.8704 0.0124
NP_442428.1_5 Reverse -372 -379 15.8704 0.0124
NP_442428.1_5 Forward -70 -63 15.8704 0.0124
NP_442428.1_5 Reverse -63 -70 15.8704 0.0124
NP_442428.1_5 Forward -134 -127 3.67736 0.298
NP_442859.1_2 Reverse -85 -104 7.86593 0.199
NP_442859.1_2 Reverse -127 -146 3.24438 0.259
NP_442120.1_10 Reverse -351 -370 -15.0452 0.289
NP_442823.1_8 Forward -104 -85 14.1591 0.254
NP_442612.1_1 Forward -218 -203 14.8279 0.214
NP_441867.1_2 Forward -162 -143 -16.4218 0.291
NP_440603.1_9 Forward -278 -259 1.67108 0.278
NP_440673.1_2 Reverse -260 -279 11.7553 0.165
NP_440673.1_2 Reverse -74 -93 11.6578 0.167
NP_440673.1_3 Reverse -64 -71 13.1171 0.0426
NP_440673.1_3 Forward -378 -371 12.4288 0.0426
NP_440673.1_3 Forward -69 -62 12.4288 0.0426
NP_440673.1_3 Reverse -373 -380 12.4288 0.0426
NP_440673.1_3 Forward -133 -126 9.08556 0.202
NP_440673.1_3 Reverse -234 -241 6.23397 0.283
NP_441052.1_2 Reverse -371 -381 19.9412 0.00106
NP_441052.1_2 Forward -71 -61 10.9931 0.0285
NP_441052.1_2 Forward -380 -370 10.5014 0.0285
NP_441052.1_2 Forward -99 -89 4.10993 0.166
NP_441052.1_2 Reverse -62 -72 0.668351 0.256
NP_442219.1_9 Reverse -372 -381 17.7976 0.00718
NP_442219.1_9 Reverse -63 -72 8.84951 0.0681
NP_442219.1_9 Forward -379 -370 8.35786 0.0681
NP_442219.1_9 Forward -70 -61 8.25953 0.0681
NP_440436.1_4 Forward -379 -370 18.1905 0.00233
NP_440436.1_4 Reverse -372 -381 17.2072 0.00233
NP_440436.1_4 Forward -70 -61 9.24241 0.0871
NP_440436.1_4 Reverse -63 -72 6.78414 0.147
NP_441884.1_8 Reverse -269 -288 -11.9969 0.271
NP_441884.1_9 Reverse -368 -387 -22.5183 0.281
NP_442086.1_6 Forward -366 -347 10.8159 0.255
NP_440689.1_8 Forward -197 -178 12.1925 0.269
NP_440314.1_9 Forward -70 -51 -5.50708 0.224
NP_440648.1_1 Forward -71 -52 9.53756 0.184
NP_440648.1_1 Reverse -371 -390 3.93269 0.232
NP_442907.1_9 Forward -76 -57 -5.80207 0.284
NP_441719.1_4 Forward -379 -372 16.3621 0.0124
NP_441719.1_4 Reverse -372 -379 16.3621 0.0124
NP_441719.1_4 Forward -70 -63 16.3621 0.0124
NP_441719.1_4 Reverse -63 -70 16.3621 0.0124
NP_441719.1_4 Reverse -27 -34 3.97235 0.231
NP_441733.1_10 Forward -383 -370 7.39411 0.153
NP_441733.1_10 Reverse -59 -72 6.01747 0.203
NP_441004.1_1 Forward -99 -80 -6.78538 0.19
NP_441004.1_1 Forward -246 -227 -15.9302 0.279
NP_441004.1_1 Forward -159 -140 -16.2252 0.283
NP_441004.1_3 Forward -168 -149 2.3594 0.266
NP_441004.1_5 Reverse -248 -262 7.07942 0.292
NP_442366.1_3 Reverse -370 -388 5.32902 0.0878
NP_442366.1_3 Forward -136 -118 -5.19239 0.284
NP_442366.1_5 Forward -383 -373 14.0409 0.0497
NP_440129.1_4 Forward -288 -270 13.1947 0.291
NP_440296.1_10 Forward -74 -55 -7.17871 0.23
NP_441115.1_4 Reverse -370 -388 11.8181 0.127
NP_441115.1_4 Reverse -61 -79 9.16315 0.223
NP_442206.1_10 Forward -71 -56 5.87976 0.178
NP_442206.1_10 Reverse -371 -386 1.15987 0.236
NP_442206.1_10 Forward -359 -344 0.471552 0.259
NP_440328.1_4 Forward -386 -367 4.62101 0.162
NP_440094.1_2 Forward -359 -340 5.89931 0.13
NP_443054.1_2 Forward -382 -368 2.94952 0.24
NP_442430.1_7 Forward -326 -307 18.3164 0.179
NP_441851.1_2 Reverse -349 -368 4.32602 0.186
NP_441851.1_10 Reverse -370 -380 16.008 0.00552
NP_441851.1_10 Forward -381 -371 15.8113 0.00552
NP_441851.1_10 Forward -72 -62 8.1415 0.122
NP_441851.1_10 Forward -136 -126 7.64985 0.135
NP_442622.1_8 Forward -71 -53 -18.6637 0.243
NP_442011.1_1 Reverse -61 -80 7.66927 0.186
NP_441668.1_4 Forward -81 -62 2.45773 0.198
NP_441668.1_4 Forward -390 -371 -1.37718 0.273
NP_442515.1_1 Forward -381 -367 13.6676 0.0278
NP_442515.1_1 Forward -72 -58 3.63784 0.115
NP_442515.1_1 Reverse -1 -15 -3.93365 0.298
NP_440593.1_3 Forward -98 -79 9.24257 0.107
NP_440593.1_3 Reverse -79 -98 5.211 0.125
NP_440593.1_9 Forward -383 -369 10.0294 0.24
NP_440165.1_5 Reverse -61 -80 -3.63879 0.22
NP_441349.1_10 Reverse -361 -380 -6.88371 0.238
NP_441349.1_10 Forward -81 -62 -7.76869 0.258
NP_441409.1_6 Reverse -365 -384 -6.29373 0.124
NP_441409.1_6 Reverse -195 -214 -9.14533 0.18
NP_441409.1_6 Forward -77 -58 -14.3569 0.255
NP_440389.1_3 Forward -180 -161 14.1591 0.232
NP_440389.1_5 Forward -255 -236 15.8859 0.194
NP_440389.1_5 Reverse -364 -383 13.765 0.254
NP_440432.1_9 Forward -70 -55 6.17475 0.0477
NP_440432.1_9 Reverse -3 -18 -0.511758 0.164
NP_440432.1_9 Reverse -91 -106 -5.7233 0.263
NP_439960.1_10 Forward -208 -190 -1.45582 0.242
NP_440474.1_8 Forward -379 -365 13.1753 0.0735
NP_440474.1_8 Forward -34 -20 5.21053 0.254
NP_440474.1_8 Forward -70 -56 4.8172 0.266
NP_440474.1_8 Reverse -346 -360 4.42388 0.279
NP_440396.1_1 Forward -257 -238 2.65439 0.156
NP_440431.1_3 Reverse -370 -389 -2.85214 0.175
NP_442450.1_5 Forward -73 -63 17.6796 0.0267
NP_442450.1_5 Forward -382 -372 7.55152 0.13
NP_440588.1_2 Reverse -53 -72 7.96426 0.0479
NP_440588.1_2 Reverse -362 -381 5.89931 0.0609
NP_440588.1_2 Reverse -117 -136 -2.55715 0.167
NP_440588.1_2 Forward -80 -61 -2.65548 0.17
NP_440943.1_4 Reverse -10 -22 14.9853 0.213
NP_442006.1_2 Forward -207 -190 2.59545 0.094
NP_442006.1_2 Forward -93 -76 1.12048 0.124
NP_442006.1_2 Forward -279 -262 -17.4641 0.276
NP_442006.1_2 Forward -20 -3 -18.2507 0.289
NP_443047.1_7 Reverse -127 -146 11.5042 0.157
NP_441570.1_1 Reverse -62 -80 -7.55234 0.0914
NP_441570.1_1 Reverse -371 -389 -17.0904 0.264
NP_440078.1_10 Reverse -371 -390 15.2408 0.123
NP_441078.1_4 Forward -380 -371 19.6659 0.0007
NP_441078.1_4 Reverse -371 -380 19.6659 0.0007
NP_441078.1_4 Reverse -62 -71 9.93116 0.0203
NP_441078.1_4 Forward -71 -62 9.83282 0.0226
NP_441078.1_4 Forward -99 -90 6.39124 0.0775
NP_441078.1_4 Reverse -90 -99 -1.77023 0.266
NP_442729.1_8 Reverse -367 -380 9.75405 0.125
NP_441663.1_8 Reverse -56 -75 2.3594 0.203
NP_441663.1_8 Forward -77 -58 -1.86883 0.253
NP_442443.1_1 Forward -167 -148 4.22769 0.16
NP_440526.1_3 Reverse -372 -383 8.02298 0.126
NP_440526.1_3 Forward -379 -368 2.41814 0.267
NP_440526.1_3 Reverse -127 -138 0.156538 0.297
NP_441432.1_8 Reverse -61 -70 16.8143 0.00595
NP_441432.1_8 Forward -381 -372 16.8143 0.00595
NP_441432.1_8 Reverse -370 -379 8.25953 0.0755
NP_441432.1_8 Forward -100 -91 3.53964 0.244
NP_442320.1_8 Reverse -365 -379 -0.295402 0.0817
NP_442344.1_7 Forward -34 -15 -5.50708 0.168
NP_441732.1_2 Forward -384 -368 12.0549 0.00594
NP_441732.1_2 Reverse -367 -383 -16.2644 0.165
NP_441732.1_2 Forward -252 -236 -16.7561 0.195
NP_441732.1_2 Forward -75 -59 -17.2477 0.247
NP_440629.1_6 Forward -386 -367 12.115 0.297
NP_442003.1_6 Forward -173 -154 15.9291 0.242
NP_440760.1_1 Reverse -371 -390 -13.8652 0.115
NP_440760.1_1 Reverse -62 -81 -21.3384 0.234
NP_440760.1_1 Forward -71 -52 -21.535 0.238
NP_440760.1_1 Forward -380 -361 -22.715 0.267
NP_442797.1_6 Forward -81 -62 7.74025 0.279
NP_440131.1_10 Forward -241 -222 19.0757 0.0402
NP_440199.1_6 Forward -351 -334 18.5251 0.239
NP_442489.1_7 Forward -380 -371 20.1576 0.000695
NP_442489.1_7 Reverse -371 -380 20.1576 0.000695
NP_442489.1_7 Reverse -62 -71 10.4228 0.0151
NP_442489.1_7 Forward -71 -62 10.3245 0.0193
NP_442489.1_7 Forward -99 -90 -1.37691 0.195
NP_442489.1_7 Forward -135 -126 -2.06522 0.288
NP_442079.1_7 Forward -70 -51 3.34271 0.212
NP_440559.1_1 Reverse -372 -381 17.4043 0.00658
NP_440559.1_1 Reverse -63 -72 9.14451 0.0586
NP_440559.1_1 Forward -379 -370 8.75118 0.0586
NP_440559.1_1 Forward -70 -61 8.65285 0.0586
NP_440559.1_1 Reverse -127 -136 4.32629 0.288
NP_441659.2_8 Reverse -371 -381 18.1713 0.00133
NP_441659.2_8 Forward -380 -370 11.9764 0.0147
NP_441659.2_8 Forward -71 -61 11.3864 0.0184
NP_441659.2_8 Reverse -62 -72 9.81313 0.0269
NP_441659.2_8 Reverse -90 -100 6.17489 0.084
NP_441659.2_8 Reverse -2 -12 4.3066 0.139
NP_441092.1_3 Reverse -373 -392 2.16274 0.19
NP_440363.1_9 Forward -269 -251 14.7688 0.212
NP_441040.1_2 Reverse -224 -243 -16.3235 0.295
NP_442008.1_2 Forward -74 -55 6.19431 0.223
NP_440708.1_4 Reverse -265 -284 5.40766 0.259
NP_442346.1_1 Forward -153 -134 10.9142 0.27
NP_442346.1_2 Forward -391 -372 3.53937 0.293
NP_442346.1_5 Forward -381 -371 16.6963 0.00248
NP_442346.1_5 Forward -72 -62 14.1397 0.0164
NP_442346.1_5 Reverse -370 -380 9.02648 0.118
NP_442346.1_5 Reverse -61 -71 7.84651 0.156
NP_442346.1_5 Forward -94 -84 4.89658 0.269
NP_440545.1_3 Forward -384 -367 20.9833 0.00658
NP_440545.1_3 Forward -75 -58 3.28376 0.0859
NP_440545.1_3 Reverse -86 -103 -4.18939 0.22
NP_440545.1_3 Reverse -367 -384 -5.95935 0.265
NP_440831.1_1 Reverse -258 -277 11.1109 0.277
NP_441629.1_3 Reverse -225 -244 -2.95123 0.276
NP_440459.1_2 Forward -243 -226 8.39697 0.264
NP_440010.1_4 Forward -81 -62 6.58682 0.199
NP_440010.1_10 Forward -23 -4 1.47442 0.299
NP_442603.1_7 Reverse -371 -385 11.307 0.117
NP_442603.1_7 Forward -380 -366 9.04542 0.158
NP_442603.1_7 Reverse -62 -76 8.55376 0.171
NP_441585.1_5 Reverse -155 -174 3.63691 0.255
NP_441888.1_7 Reverse -57 -71 2.85119 0.225
NP_441888.1_7 Forward -76 -62 0.88457 0.276
NP_441948.1_4 Forward -387 -369 0.412472 0.136
NP_441833.1_3 Forward -347 -333 16.9125 0.213
NP_441833.1_4 Forward -379 -372 15.9687 0.0124
NP_441833.1_4 Reverse -372 -379 15.9687 0.0124
NP_441833.1_4 Forward -70 -63 15.9687 0.0124
NP_441833.1_4 Reverse -63 -70 15.9687 0.0124
NP_441112.1_6 Forward -226 -207 -0.197208 0.288
NP_441112.1_6 Forward -109 -90 -3.93378 0.296
NP_442162.1_9 Forward -379 -372 16.2637 0.0124
NP_442162.1_9 Reverse -372 -379 16.2637 0.0124
NP_442162.1_9 Forward -70 -63 16.2637 0.0124
NP_442162.1_9 Reverse -63 -70 16.2637 0.0124
NP_442796.1_2 Forward -283 -264 18.1523 0.177
NP_442796.1_10 Forward -285 -266 7.57094 0.278
NP_440671.1_4 Forward -77 -63 9.34103 0.184
NP_440671.1_4 Forward -386 -372 8.84938 0.188
NP_442404.1_9 Forward -377 -363 12.9786 0.263
NP_440204.1_1 Reverse -265 -284 2.3594 0.278
NP_441915.1_4 Reverse -260 -279 10.3234 0.273
NP_442199.1_5 Forward -362 -343 -6.39206 0.273
NP_442199.1_6 Reverse -361 -380 10.7175 0.274
NP_442140.1_3 Forward -379 -369 17.4829 0.0159
NP_442140.1_3 Reverse -63 -73 15.3197 0.0412
NP_442140.1_3 Reverse -372 -382 12.2714 0.0632
NP_442140.1_3 Forward -70 -60 4.69992 0.238
NP_442021.1_3 Reverse -264 -283 -3.63879 0.251
NP_441671.1_10 Forward -110 -91 -0.000545616 0.288
NP_440875.1_9 Forward -378 -368 15.2829 0.0295
NP_440875.1_9 Reverse -158 -168 8.66404 0.233
NP_440875.1_9 Forward -69 -59 7.69067 0.255
NP_442547.1_7 Forward -103 -84 18.4959 0.141
NP_441813.1_5 Reverse -60 -70 18.1713 0.00743
NP_441813.1_5 Reverse -369 -379 10.0098 0.0208
NP_441813.1_5 Forward -73 -63 8.82982 0.0367
NP_441813.1_5 Forward -382 -372 8.63316 0.0367
NP_440594.1_8 Forward -70 -57 10.9334 0.153
NP_440594.1_8 Forward -379 -366 9.95012 0.173
NP_442254.1_1 Reverse -78 -97 -5.21209 0.282
NP_442089.1_6 Reverse -270 -289 16.3224 0.0715
NP_440590.1_4 Forward -379 -366 14.2773 0.011
NP_440590.1_4 Reverse -372 -385 12.9006 0.013
NP_440590.1_4 Forward -193 -180 0.904263 0.14
NP_440590.1_4 Forward -70 -57 -5.68391 0.286
NP_440567.1_1 Forward -379 -365 12.291 0.0241
NP_440567.1_1 Reverse -63 -77 11.7993 0.0267
NP_440567.1_1 Forward -70 -56 3.63784 0.139
NP_440567.1_1 Reverse -27 -41 3.34284 0.145
NP_442497.1_10 Forward -70 -61 17.601 0.00813
NP_442497.1_10 Reverse -63 -72 10.8161 0.0087
NP_442497.1_10 Forward -379 -370 10.4228 0.0087
NP_442497.1_10 Reverse -372 -381 10.4228 0.0087
NP_442497.1_10 Reverse -3 -12 0.491382 0.162
NP_442497.1_10 Reverse -127 -136 0.393051 0.175
NP_440821.1_4 Reverse -369 -379 18.7612 0.00422
NP_440821.1_4 Forward -382 -372 9.41981 0.0286
NP_440821.1_4 Forward -73 -63 8.63316 0.0454
NP_440821.1_4 Reverse -60 -70 2.24165 0.131
NP_440821.1_4 Reverse -24 -34 -0.806614 0.296
NP_441239.1_9 Reverse -369 -381 16.0669 0.0175
NP_441239.1_9 Forward -73 -61 10.4621 0.0783
NP_441239.1_9 Reverse -60 -72 7.02048 0.173
NP_441239.1_9 Forward -382 -370 5.93884 0.202
NP_441239.1_10 Forward -291 -272 14.1591 0.208
NP_441892.1_1 Forward -80 -63 17.8367 0.0226
NP_441892.1_1 Forward -389 -372 -4.77938 0.268
NP_441892.1_1 Forward -20 -3 -5.56602 0.283
NP_440604.1_6 Forward -71 -52 0.491109 0.166
NP_442044.1_1 Forward -385 -366 -11.9969 0.271
NP_442270.1_9 Reverse -265 -284 -7.86702 0.214
NP_442643.1_3 Forward -170 -151 -6.98204 0.263
NP_441874.1_1 Reverse -272 -286 9.04604 0.28
NP_440876.1_5 Forward -69 -50 12.6841 0.233
NP_442138.1_9 Forward -285 -266 7.27514 0.299
NP_442052.1_8 Reverse -160 -170 11.8781 0.297
NP_440546.1_4 Reverse -62 -72 14.0213 0.0459
NP_440546.1_4 Forward -380 -370 11.8882 0.0679
NP_440546.1_4 Forward -71 -61 10.8217 0.104
NP_440546.1_4 Reverse -371 -381 10.046 0.109
NP_439974.1_4 Forward -176 -157 15.2408 0.159
NP_442041.1_5 Forward -272 -253 -1.47551 0.286
NP_441230.1_5 Forward -104 -85 5.89931 0.182
NP_440462.1_6 Reverse -60 -70 18.7612 0.00454
NP_440462.1_6 Reverse -369 -379 17.9746 0.00578
NP_440462.1_6 Forward -382 -372 1.35667 0.294
NP_442340.1_3 Forward -352 -333 1.27776 0.144
NP_442340.1_3 Forward -97 -78 -9.14533 0.271
NP_440868.1_4 Reverse -367 -379 21.5735 0.00629
NP_440868.1_4 Reverse -58 -70 9.97041 0.0405
NP_440868.1_4 Forward -384 -372 6.1355 0.0878
NP_440868.1_4 Forward -75 -63 0.727295 0.201
NP_441582.1_5 Forward -382 -363 10.52 0.16
NP_441269.1_10 Forward -104 -87 17.0501 0.228
NP_442402.1_4 Reverse -375 -394 -3.34455 0.214
NP_441848.1_4 Forward -302 -286 12.2298 0.208
NP_441084.1_6 Forward -281 -267 9.63499 0.273
NP_440696.1_3 Reverse -260 -278 9.16393 0.149
NP_440696.1_3 Reverse -74 -92 1.69077 0.217
NP_440696.1_3 Reverse -367 -385 -0.964162 0.249
NP_440696.1_3 Reverse -276 -294 -3.52077 0.287
NP_440696.1_6 Forward -98 -79 2.94938 0.296
NP_442039.1_4 Forward -379 -372 15.1821 0.0124
NP_442039.1_4 Reverse -372 -379 15.1821 0.0124
NP_442039.1_4 Forward -70 -63 15.1821 0.0124
NP_442039.1_4 Reverse -63 -70 15.1821 0.0124
NP_440825.1_3 Reverse -334 -353 3.34271 0.187
NP_440825.1_7 Forward -134 -124 14.1783 0.152
NP_440825.1_7 Reverse -372 -382 12.9096 0.152
NP_442837.1_3 Forward -379 -372 15.7721 0.0124
NP_442837.1_3 Reverse -372 -379 15.7721 0.0124
NP_442837.1_3 Forward -70 -63 15.7721 0.0124
NP_442837.1_3 Reverse -63 -70 15.7721 0.0124
NP_442053.1_1 Forward -380 -371 18.3876 0.0007
NP_442053.1_1 Reverse -371 -380 18.3876 0.0007
NP_442053.1_1 Reverse -62 -71 17.601 0.00138
NP_442053.1_1 Forward -71 -62 16.2243 0.00451
NP_440505.1_3 Reverse -60 -70 17.188 0.00332
NP_440505.1_3 Reverse -369 -379 14.1397 0.0235
NP_440505.1_3 Forward -382 -372 9.22315 0.122
NP_440505.1_7 Forward -163 -144 -0.295539 0.269
NP_441252.1_6 Reverse -15 -22 14.3954 0.168
NP_441252.1_6 Reverse -102 -109 11.6422 0.288
NP_441203.1_1 Reverse -372 -391 -20.3551 0.297
NP_442532.1_7 Forward -380 -366 6.58777 0.171
NP_442532.1_7 Reverse -345 -359 1.47456 0.285
NP_441408.2_7 Forward -101 -82 13.5691 0.0649
NP_441408.2_7 Forward -287 -268 10.7175 0.0989
NP_441408.2_7 Forward -95 -76 10.1275 0.0989
NP_441408.2_7 Forward -281 -262 9.73422 0.0989
NP_441408.2_7 Forward -356 -337 -2.95047 0.272
NP_440914.1_1 Reverse -371 -381 17.5935 0.000537
NP_440914.1_1 Forward -71 -61 13.7874 0.0256
NP_440914.1_1 Forward -380 -370 8.6151 0.186
NP_440914.1_1 Forward -278 -268 7.5416 0.232
NP_440914.1_1 Reverse -62 -72 7.24882 0.242
NP_441011.1_8 Forward -379 -370 16.9127 0.00602
NP_441011.1_8 Forward -70 -61 16.6177 0.00602
NP_441011.1_8 Reverse -63 -72 12.7828 0.0397
NP_441011.1_8 Reverse -372 -381 8.25953 0.144
NP_441011.1_8 Forward -134 -125 5.70292 0.237
NP_442533.1_6 Forward -380 -371 17.2076 0.00137
NP_442533.1_6 Reverse -371 -380 17.2076 0.00137
NP_442533.1_6 Reverse -62 -71 7.86621 0.0862
NP_442533.1_6 Forward -71 -62 7.37455 0.0898
NP_442533.1_6 Forward -93 -84 5.21127 0.15
NP_442533.1_6 Forward -99 -90 4.91628 0.165
NP_442533.1_6 Forward -11 -2 2.75299 0.241
NP_442533.1_6 Reverse -232 -241 2.65466 0.246
NP_441089.1_5 Reverse -262 -281 19.2723 0.241
NP_442232.1_3 Forward -79 -60 -12.7836 0.282
NP_442229.1_1 Reverse -369 -383 10.8154 0.18
NP_443016.1_1 Reverse -56 -75 -6.09707 0.254
NP_441482.1_7 Reverse -56 -70 2.75286 0.0554
NP_441482.1_7 Forward -386 -372 0.982901 0.0554
NP_441482.1_7 Forward -77 -63 -1.27871 0.0666
NP_439944.1_9 Reverse -372 -382 10.5014 0.0887
NP_439944.1_9 Forward -379 -369 10.4031 0.0887
NP_439944.1_9 Forward -70 -60 9.12481 0.1
NP_442202.1_10 Forward -72 -58 3.93283 0.278
NP_441527.1_8 Forward -233 -214 7.37428 0.279
NP_440115.1_6 Reverse -368 -378 9.61647 0.115
NP_440115.1_6 Forward -383 -373 9.32148 0.115
NP_440115.1_6 Reverse -59 -69 4.79825 0.282
NP_440007.1_9 Forward -282 -268 0.88457 0.29
NP_440007.1_9 Forward -276 -262 0.589577 0.294
NP_440007.1_9 Forward -363 -349 0.491246 0.297
NP_440007.1_9 Forward -90 -76 0.392915 0.298
NP_441602.1_3 Forward -98 -79 1.37609 0.214
NP_441972.1_5 Forward -98 -79 -7.76869 0.252
NP_441106.1_1 Reverse -61 -70 18.486 0.0028
NP_441106.1_1 Reverse -370 -379 18.191 0.0028
NP_441106.1_1 Forward -381 -372 9.63616 0.0311
NP_440646.1_3 Forward -200 -181 10.6192 0.276
NP_439903.1_1 Forward -238 -219 10.2259 0.214
NP_439903.1_6 Reverse -59 -78 12.6833 0.0859
NP_439903.1_6 Forward -389 -370 -0.00131823 0.275
NP_442588.1_6 Reverse -374 -393 -1.47551 0.268
NP_441286.1_1 Forward -381 -369 14.7886 0.00418
NP_441286.1_1 Reverse -61 -73 5.05386 0.0259
NP_441286.1_1 Reverse -370 -382 3.38223 0.0467
NP_440670.1_8 Forward -380 -371 18.3876 0.000699
NP_440670.1_8 Reverse -371 -380 18.3876 0.000699
NP_440670.1_8 Reverse -62 -71 9.04618 0.0606
NP_440670.1_8 Forward -71 -62 8.75118 0.0606
NP_440886.1_7 Reverse -370 -380 17.7774 0.0011
NP_440886.1_7 Forward -72 -62 8.04271 0.0805
NP_440886.1_7 Forward -381 -371 7.94438 0.0805
NP_440886.1_7 Reverse -61 -71 6.76441 0.114
NP_440886.1_7 Reverse -125 -135 5.87944 0.158
NP_440828.1_4 Forward -280 -261 -4.32786 0.246
NP_442614.1_2 Forward -242 -228 14.2576 0.104
NP_442614.1_2 Reverse -371 -385 8.25939 0.255
NP_442614.1_2 Forward -380 -366 7.76774 0.265
NP_442382.1_7 Forward -393 -374 7.57094 0.229
NP_439995.1_5 Reverse -361 -380 5.30933 0.276
NP_442072.1_9 Reverse -370 -388 -13.8455 0.123
NP_440513.1_4 Reverse -62 -81 12.2908 0.218
NP_440513.1_4 Forward -241 -222 8.25926 0.295
NP_440513.1_6 Forward -109 -90 11.995 0.222
NP_440028.1_6 Forward -192 -174 10.4422 0.279
NP_441808.1_2 Forward -356 -337 8.55425 0.235
NP_440907.2_8 Forward -379 -369 17.4824 0.00685
NP_440907.2_8 Forward -70 -60 9.616 0.103
NP_440907.2_8 Reverse -372 -382 7.64939 0.117
NP_440907.2_8 Reverse -63 -73 7.0594 0.132
NP_442264.1_2 Reverse -367 -384 5.34871 0.277
NP_441021.1_1 Reverse -85 -104 -9.34199 0.215
NP_441021.1_1 Forward -70 -51 -11.9969 0.279
NP_441021.1_1 Reverse -372 -391 -12.9802 0.3
NP_440841.1_4 Forward -73 -54 -7.17871 0.225
NP_441463.1_3 Reverse -16 -35 -8.26035 0.267
NP_441463.1_3 Reverse -52 -71 -8.85033 0.274
NP_441463.1_6 Forward -382 -368 6.02939 0.283
NP_441626.1_2 Forward -379 -372 15.7721 0.0124
NP_441626.1_2 Reverse -372 -379 15.7721 0.0124
NP_441626.1_2 Forward -70 -63 15.7721 0.0124
NP_441626.1_2 Reverse -63 -70 15.7721 0.0124
NP_441901.1_1 Forward -102 -83 4.32602 0.212
NP_442365.1_7 Forward -75 -56 -1.47551 0.191
NP_442794.1_1 Forward -384 -372 21.9668 0.00123
NP_442794.1_1 Forward -75 -63 13.5103 0.0721
NP_442615.1_1 Reverse -362 -380 10.8356 0.0193
NP_442615.1_1 Forward -44 -26 -0.0791831 0.111
NP_442615.1_1 Reverse -53 -71 -1.25915 0.127
NP_442615.1_1 Forward -389 -371 -1.75081 0.132
NP_442615.1_1 Reverse -29 -47 -5.38906 0.212
NP_442615.1_1 Forward -80 -62 -7.55234 0.296
NP_441962.1_4 Forward -385 -366 -5.99873 0.175
NP_441962.1_4 Forward -98 -79 -8.65367 0.203
NP_441962.1_4 Forward -76 -57 -11.7019 0.244
NP_440387.1_1 Reverse -371 -387 11.3666 0.017
NP_440387.1_1 Reverse -62 -78 -2.20308 0.147
NP_440387.1_1 Forward -380 -364 -2.30141 0.147
NP_440387.1_1 Forward -71 -55 -2.39974 0.147
NP_440855.1_1 Forward -210 -191 2.45773 0.205
NP_441431.1_2 Reverse -368 -382 20.0584 0.00685
NP_441431.1_2 Forward -282 -268 11.4053 0.138
NP_441431.1_2 Reverse -59 -73 6.58715 0.266
NP_441488.1_7 Reverse -56 -75 6.58763 0.139
NP_441488.1_8 Forward -385 -371 12.782 0.146
NP_441836.1_2 Reverse -365 -384 17.0107 0.0403
NP_441836.1_2 Forward -383 -364 1.27776 0.197
NP_441993.1_1 Forward -99 -80 5.65007 0.198
NP_441993.1_1 Reverse -84 -103 2.8238 0.25
NP_441993.1_1 Reverse -270 -289 2.53143 0.257
NP_441174.1_1 Forward -192 -177 14.7295 0.231
NP_440814.1_4 Forward -389 -370 -12.7836 0.244
NP_442805.1_5 Reverse -134 -153 -6.49113 0.284
NP_440467.1_3 Reverse -63 -82 12.4282 0.24
NP_440467.1_3 Reverse -346 -365 11.2562 0.281
NP_440114.1_10 Forward -71 -57 13.9626 0.0464
NP_440114.1_10 Forward -380 -366 11.0127 0.127
NP_440114.1_10 Reverse -126 -140 8.06273 0.217
NP_440114.1_10 Forward -47 -33 7.17775 0.243
NP_442698.1_10 Forward -384 -365 2.26107 0.284
NP_440754.1_8 Reverse -275 -294 16.9494 0.231
NP_440287.1_6 Forward -389 -370 5.99764 0.171
NP_440293.1_3 Reverse -268 -287 7.7676 0.184
NP_440293.1_3 Reverse -262 -281 -1.96717 0.239
NP_440293.1_3 Forward -167 -148 -6.88371 0.294
NP_440766.1_4 Forward -384 -370 8.75105 0.0871
NP_439988.1_3 Reverse -271 -285 7.86607 0.273
NP_439988.1_3 Forward -246 -232 5.89945 0.278
NP_441237.1_9 Reverse -63 -73 16.7946 0.0141
NP_441237.1_9 Reverse -372 -382 14.828 0.0242
NP_441237.1_9 Forward -241 -231 9.81313 0.265
NP_441311.1_2 Forward -41 -27 12.2903 0.236
NP_440643.1_6 Forward -284 -265 5.30933 0.214
NP_440643.1_6 Forward -290 -271 4.916 0.214
NP_439910.1_2 Forward -388 -371 -13.8258 0.163
NP_439910.1_2 Reverse -363 -380 -21.889 0.195
NP_442867.1_8 Reverse -76 -95 9.93088 0.214
NP_442867.1_8 Reverse -190 -209 8.75091 0.23
NP_440457.1_1 Reverse -367 -379 0.137309 0.25
NP_440457.1_1 Forward -75 -63 -0.256015 0.259
NP_440457.1_1 Forward -384 -372 -0.452677 0.263
NP_440457.1_1 Reverse -58 -70 -0.649339 0.271
NP_440798.1_6 Forward -379 -366 3.65753 0.15
NP_441984.1_3 Forward -103 -85 7.4923 0.246
NP_441984.1_3 Reverse -222 -240 7.19731 0.255
NP_441984.1_3 Forward -289 -271 7.09898 0.256
NP_441984.1_3 Forward -295 -277 4.83737 0.3
NP_440473.1_1 Reverse -140 -159 13.0891 0.209
NP_442509.1_9 Forward -380 -370 16.2041 0.00739
NP_442509.1_9 Reverse -62 -72 15.9091 0.00953
NP_442509.1_9 Reverse -371 -381 8.14104 0.192
NP_441489.1_3 Forward -396 -382 7.55548 0.261
NP_442784.1_3 Forward -98 -79 15.2408 0.264
NP_441253.1_8 Forward -76 -62 10.088 0.288
NP_443037.1_8 Reverse -261 -280 7.57094 0.242
NP_440524.1_2 Forward -358 -339 11.7992 0.14
NP_440554.1_4 Forward -70 -60 17.9746 0.0131
NP_440554.1_4 Forward -379 -369 13.943 0.0218
NP_441845.1_6 Reverse -50 -68 0.510803 0.274
NP_441885.1_5 Reverse -371 -381 20.9245 0.000538
NP_441885.1_5 Forward -380 -370 11.4848 0.00668
NP_441885.1_5 Reverse -62 -72 2.24165 0.0822
NP_441885.1_5 Forward -71 -61 1.55333 0.109
NP_441885.1_5 Forward -99 -89 0.471689 0.145
NP_441885.1_5 Forward -11 -1 0.471689 0.145
NP_440478.1_10 Reverse -369 -383 7.57108 0.261
NP_442341.1_7 Forward -381 -367 17.8958 0.0111
NP_442341.1_7 Reverse -370 -384 16.1259 0.0186
NP_442341.1_9 Reverse -60 -74 23.4017 0.0012
NP_442341.1_9 Reverse -369 -383 10.5204 0.133
NP_442341.1_9 Reverse -348 -362 9.53707 0.151
NP_442341.1_9 Forward -244 -230 9.24208 0.155
NP_441756.1_5 Forward -75 -56 -1.57384 0.258
NP_441173.1_9 Reverse -387 -395 13.1954 0.184
NP_441173.1_9 Reverse -386 -394 12.9004 0.206
NP_442395.2_1 Forward -174 -155 25.3688 0.00483
NP_443000.1_7 Reverse -60 -70 20.3345 0.00223
NP_443000.1_7 Forward -382 -372 10.3048 0.0345
NP_443000.1_7 Reverse -369 -379 2.04498 0.226
NP_442513.1_5 Forward -164 -145 6.39016 0.282
NP_441561.1_7 Reverse -122 -141 11.995 0.158
NP_441842.1_1 Forward -378 -365 21.6514 0.0072
NP_441842.1_10 Reverse -364 -378 9.83269 0.182
NP_441842.1_10 Reverse -55 -69 7.47274 0.257
NP_440275.1_3 Reverse -369 -379 17.9746 0.0082
NP_440275.1_3 Reverse -60 -70 16.1063 0.0155
NP_440275.1_3 Forward -382 -372 8.04317 0.0602
NP_440275.1_3 Forward -73 -63 1.25834 0.291
NP_440091.1_1 Reverse -367 -379 10.1671 0.0498
NP_440175.1_4 Reverse -243 -262 -12.8819 0.237
NP_440804.1_6 Forward -372 -354 20.8045 0.12
NP_440149.1_8 Forward -99 -80 -3.93378 0.201
NP_441105.1_3 Forward -365 -346 6.09597 0.0636
NP_441105.1_3 Forward -82 -63 6.09597 0.0636
NP_441105.1_3 Forward -290 -271 -2.75381 0.167
NP_441105.1_3 Forward -104 -85 -3.54046 0.181
NP_441105.1_3 Reverse -360 -379 -4.32711 0.198
NP_442127.1_4 Reverse -357 -376 7.86593 0.17
NP_440216.1_1 Forward -380 -366 -1.18038 0.0301
NP_440216.1_1 Forward -71 -57 -2.85201 0.0608
NP_440216.1_1 Reverse -371 -385 -10.2268 0.145
NP_440216.1_1 Reverse -62 -76 -11.8985 0.228
NP_440216.1_9 Forward -282 -273 6.68623 0.289
NP_440678.1_7 Forward -368 -349 17.0107 0.264
NP_440172.1_1 Reverse -62 -72 17.2863 0.00544
NP_440172.1_1 Reverse -371 -381 15.0247 0.00945
NP_440172.1_1 Forward -380 -370 8.73149 0.0586
NP_440172.1_1 Forward -71 -61 7.74818 0.0738
NP_440172.1_1 Reverse -207 -217 1.84832 0.294
NP_442015.1_10 Forward -384 -371 19.8821 0.00366
NP_442015.1_10 Forward -75 -62 13.6873 0.0354
NP_442015.1_10 Reverse -367 -380 3.06754 0.185
NP_441226.1_7 Forward -379 -372 14.4934 0.0123
NP_441226.1_7 Reverse -372 -379 14.4934 0.0123
NP_441226.1_7 Forward -70 -63 14.4934 0.0123
NP_441226.1_7 Reverse -63 -70 14.4934 0.0123
NP_441111.1_7 Forward -379 -371 18.7023 0.00294
NP_441111.1_7 Forward -70 -62 18.7023 0.00294
NP_441111.1_7 Reverse -372 -380 18.7023 0.00294
NP_441111.1_7 Reverse -63 -71 8.96754 0.0463
NP_441111.1_7 Reverse -3 -11 -0.668896 0.274
NP_441766.1_2 Forward -71 -62 18.2893 0.00297
NP_441766.1_2 Forward -380 -371 17.5026 0.00297
NP_441766.1_2 Reverse -371 -380 17.5026 0.00297
NP_441766.1_2 Reverse -62 -71 9.14451 0.0337
NP_441766.1_2 Forward -11 -2 4.91628 0.154
NP_442507.1_1 Forward -371 -352 19.5673 0.227
NP_442417.1_5 Reverse -62 -76 9.43936 0.132
NP_442417.1_5 Forward -71 -57 8.84938 0.145
NP_440416.1_1 Reverse -90 -109 -14.7502 0.299
NP_440416.1_9 Forward -387 -368 -7.67036 0.105
NP_440416.1_9 Reverse -268 -287 -20.8467 0.289
NP_440416.1_9 Forward -78 -59 -20.8467 0.289
NP_443052.1_8 Reverse -16 -35 -9.047 0.183
NP_443052.1_9 Reverse -161 -180 -6.88371 0.289
NP_440072.1_5 Forward -192 -174 -2.3408 0.271
NP_440591.1_9 Forward -78 -60 12.4089 0.0935
NP_440261.1_5 Forward -379 -366 14.3756 0.0214
NP_440261.1_5 Forward -70 -57 -2.63565 0.0924
NP_440261.1_5 Reverse -372 -385 -2.83231 0.0932
NP_440261.1_5 Reverse -63 -76 -10.4038 0.201
NP_440988.1_10 Reverse -369 -383 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACCTTGGGTAAAATCCTTGGCGATCGCCGCCAAAAAATTGCTGATGCCATTGAAGAAGCGGAAACTCGCCAACGTAAATCTGCTCAGATTTTAGCGGAGGAAGAGAAAAAGCTAGCCCAAGCCAAAGCCGAAGCGGCCCGCATTGTCCAAGAAGCTGGGCAACGGGCAGAGGTGGCTAAACAAGAAATTGCGACCCAGACGGAAGCGGATCTGCGGCGGATGCAGGAAGCAGCGGCCCAGGATTTGGGAGCTGAGCAGGAACGGGTGATTGCTGAACTCAAGCGTCGTATTGCCGAACAGGCTGTGGCCAAGGCTGAAGCTGACCTGCGCGATCGCCTGAATGAAGACACCCAGGATCGGTTAATCGAACGCAGTATTGCCCAATTGGGAGGTCGCTA

CDS

ATGAAAGGTTCCTTATACAGTAGTAAGATTGCTGAACCCTACGCCCAGGCGTTGATAGGATTGGCCCAACAGCAGAATTTAACTGAAGTTTTCGGGGACAACTTGCGCTCTCTGTTGACCCTGCTCCAAGATTCTCCCGATCTGTCGGCGGTGCTTTCTAGCCCCGTAGTCAAGGACGAAGATAAAAAATCCGTGCTCCGCTCCGTGCTGGGGGACGGGGGCAATGGCTATCTTCTCAACTTCTTAATGTTGTTGGTGGATAAACGCCGGATTGTTTTCCTCGAAGCCATTTGTGAGCAGTACCTCGCCCTGTTGCGGCAGTTCACCAATACGGTCTTGGCAGAGGTCACCTCCGCCCTCAAACTCACCGATGCCCAAAAGGATCAGGTGAAGGAAAGAGTTAAGCAACTCACCGGGGCCCAGGCGGTGGAACTAGAAACCAAAGTAGACGGCGACATCCTCGGTGGCATTGTCATCAAAGTGGGTTCCCAGGTGTTTGATTCCAGTTTACGGGGTCAACTCCGCCGGGTGGGTTTAAGTCTTGGGACCGCCCTCTAG

Protein

MKGSLYSSKIAEPYAQALIGLAQQQNLTEVFGDNLRSLLTLLQDSPDLSAVLSSPVVKDEDKKSVLRSVLGDGGNGYLLNFLMLLVDKRRIVFLEAICEQYLALLRQFTNTVLAEVTSALKLTDAQKDQVKERVKQLTGAQAVELETKVDGDILGGIVIKVGSQVFDSSLRGQLRRVGLSLGTAL