Your browser is old and dusty. Try Google Chrome!

Details for sll1321

ORF sll1321
Accession NP_440061.1
Symbol
Category ATP synthase
Definition hypothetical protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -172 -158 2.65453 0.173
NP_441061.1_2 Reverse -153 -167 0.687908 0.202
NP_440795.1_7 Forward -172 -165 14.6904 0.0123
NP_440795.1_7 Reverse -165 -172 14.6904 0.0123
NP_440795.1_7 Reverse -97 -104 11.1505 0.108
NP_441418.1_6 Forward -173 -154 -0.983855 0.0113
NP_441418.1_6 Reverse -152 -171 -2.36049 0.0184
NP_441418.1_6 Forward -161 -142 -4.03212 0.0255
NP_441418.1_6 Reverse -186 -205 -30.4831 0.28
NP_442291.1_5 Forward -174 -158 -1.21977 0.192
NP_440897.1_6 Reverse -164 -183 0.490334 0.18
NP_441453.1_4 Reverse -164 -172 16.539 0.00633
NP_441453.1_4 Forward -173 -165 16.539 0.00633
NP_441960.1_9 Forward -261 -242 14.2574 0.291
NP_442151.1_1 Reverse -34 -53 3.14605 0.291
NP_442151.1_6 Reverse -164 -178 19.4691 0.0045
NP_442151.1_6 Forward -173 -159 12.291 0.0771
NP_441818.1_1 Forward -172 -161 9.79292 0.232
NP_440226.1_1 Reverse -164 -183 6.98095 0.115
NP_440226.1_1 Forward -173 -154 6.39097 0.129
NP_440226.1_1 Forward -195 -176 2.75272 0.253
NP_440226.1_8 Reverse -125 -144 18.3865 0.177
NP_442169.1_1 Forward -295 -276 8.35759 0.26
NP_442623.1_3 Forward -172 -153 -8.55534 0.127
NP_442173.1_1 Forward -172 -164 15.4574 0.00633
NP_442173.1_1 Reverse -165 -173 15.4574 0.00633
NP_442752.1_4 Forward -173 -166 13.8055 0.0199
NP_442752.1_4 Reverse -164 -171 13.8055 0.0199
NP_442752.1_4 Forward -161 -154 5.44732 0.202
NP_443027.1_4 Reverse -81 -91 11.9764 0.0872
NP_443027.1_4 Reverse -162 -172 11.0914 0.107
NP_442975.1_10 Forward -177 -163 10.2254 0.056
NP_442975.1_10 Reverse -92 -106 5.70218 0.212
NP_440784.1_7 Forward -172 -165 15.9687 0.0123
NP_440784.1_7 Reverse -165 -172 15.9687 0.0123
NP_441250.1_3 Forward -400 -381 11.2092 0.188
NP_440061.1_1 Forward -97 -78 26.5488 0.00005
NP_440061.1_9 Forward -175 -161 19.6651 0.00478
NP_440061.1_9 Reverse -162 -176 10.422 0.124
NP_440061.1_9 Reverse -357 -371 5.60385 0.279
NP_441054.1_2 Forward -301 -282 12.2908 0.24
NP_441054.1_2 Forward -300 -281 11.3075 0.271
NP_441054.1_2 Forward -372 -353 10.0292 0.284
NP_440878.1_9 Forward -183 -164 4.03102 0.174
NP_442062.1_8 Forward -173 -163 17.3846 0.00193
NP_442062.1_8 Reverse -164 -174 17.3846 0.00193
NP_442062.1_8 Forward -161 -151 14.4347 0.0134
NP_441859.1_3 Reverse -151 -170 4.03023 0.228
NP_441859.1_3 Reverse -163 -182 3.83357 0.233
NP_441859.1_3 Forward -174 -155 3.24359 0.246
NP_440304.1_4 Forward -163 -153 7.35486 0.118
NP_440304.1_4 Forward -175 -165 1.84832 0.299
NP_440304.1_4 Reverse -162 -172 1.84832 0.299
NP_442242.1_4 Forward -172 -165 14.3954 0.0124
NP_442242.1_4 Reverse -165 -172 14.3954 0.0124
NP_442242.1_4 Reverse -84 -91 10.0689 0.174
NP_441781.1_7 Forward -161 -142 -2.75381 0.289
NP_441208.1_9 Forward -164 -150 6.19444 0.253
NP_441594.1_6 Forward -170 -151 8.65258 0.153
NP_442110.1_7 Forward -173 -159 10.6193 0.0644
NP_442110.1_7 Forward -364 -350 4.81781 0.192
NP_441925.1_4 Reverse -355 -374 -15.3409 0.263
NP_440856.1_4 Reverse -157 -176 9.0459 0.0576
NP_441083.1_5 Forward -173 -163 20.3345 0.00053
NP_441083.1_5 Reverse -164 -174 20.3345 0.00053
NP_441083.1_5 Reverse -152 -162 7.35486 0.0566
NP_441738.1_2 Forward -171 -164 15.28 0.0102
NP_441738.1_2 Reverse -166 -173 15.28 0.0102
NP_441738.1_2 Reverse -154 -161 10.2652 0.101
NP_441738.1_2 Reverse -357 -364 6.52862 0.261
NP_440209.1_1 Reverse -164 -172 18.1123 0.00295
NP_440209.1_1 Forward -173 -165 18.1123 0.00295
NP_441444.1_1 Reverse -117 -136 2.75272 0.295
NP_442136.1_10 Forward -111 -97 19.5675 0.271
NP_442889.1_8 Reverse -161 -175 5.40719 0.227
NP_441713.1_1 Forward -167 -148 -8.16202 0.145
NP_441770.1_10 Forward -278 -259 8.55425 0.279
NP_441716.1_1 Forward -173 -159 10.7177 0.0936
NP_441716.1_1 Reverse -164 -178 6.3911 0.198
NP_442111.1_4 Forward -174 -160 14.3559 0.0307
NP_442111.1_4 Reverse -163 -177 11.111 0.0515
NP_441163.1_1 Reverse -144 -161 6.52796 0.255
NP_440343.1_3 Reverse -356 -374 2.67334 0.291
NP_440343.1_9 Forward -311 -292 9.0459 0.251
NP_440906.1_5 Forward -172 -165 15.8704 0.0124
NP_440906.1_5 Reverse -165 -172 15.8704 0.0124
NP_440906.1_5 Forward -91 -84 9.47889 0.116
NP_440747.1_10 Reverse -161 -173 26.5883 0.000317
NP_440747.1_10 Forward -176 -164 14.887 0.00223
NP_440747.1_10 Forward -164 -152 -11.7607 0.142
NP_442973.1_5 Reverse -168 -187 12.3892 0.206
NP_441486.1_1 Reverse -161 -175 6.3911 0.0344
NP_441486.1_1 Forward -176 -162 5.89945 0.0344
NP_441486.1_1 Reverse -149 -163 0.786239 0.126
NP_441265.1_3 Reverse -158 -172 2.85119 0.181
NP_441014.1_5 Forward -178 -160 10.5406 0.263
NP_442848.1_1 Reverse -146 -160 -3.93365 0.275
NP_443018.1_3 Forward -172 -165 14.8871 0.0123
NP_443018.1_3 Reverse -165 -172 14.8871 0.0123
NP_441316.1_7 Reverse -296 -311 -2.97003 0.273
NP_441634.1_8 Reverse -162 -176 -3.147 0.295
NP_441634.1_9 Forward -311 -292 8.75009 0.294
NP_440376.1_1 Forward -173 -164 19.4693 0.000692
NP_440376.1_1 Reverse -164 -173 19.4693 0.000692
NP_440376.1_1 Forward -161 -152 13.4711 0.016
NP_440376.1_1 Reverse -152 -161 -0.0986038 0.285
NP_441588.1_4 Reverse -166 -176 15.9097 0.0369
NP_442687.1_7 Forward -174 -164 8.92815 0.0994
NP_442687.1_7 Reverse -163 -173 8.92815 0.0994
NP_442687.1_7 Reverse -151 -161 6.07655 0.179
NP_442687.1_7 Reverse -35 -45 5.28991 0.211
NP_441077.1_6 Forward -125 -109 4.24797 0.258
NP_442485.1_3 Forward -287 -268 -3.24547 0.272
NP_442485.1_3 Forward -172 -153 -3.73712 0.277
NP_441846.1_10 Forward -374 -355 -4.13045 0.156
NP_441846.1_10 Forward -379 -360 -23.1083 0.277
NP_442583.1_8 Forward -172 -153 11.0125 0.205
NP_441013.1_2 Reverse -159 -177 -4.70074 0.299
NP_440571.1_7 Forward -158 -140 18.0485 0.197
NP_441422.1_7 Reverse -94 -111 1.71047 0.118
NP_442296.1_9 Forward -172 -153 -3.14714 0.249
NP_442658.1_1 Reverse -150 -160 10.1076 0.132
NP_442658.1_1 Reverse -162 -172 7.94438 0.199
NP_442658.1_1 Forward -175 -165 6.76441 0.214
NP_442782.1_2 Forward -295 -281 2.16287 0.277
NP_442496.1_5 Forward -291 -273 6.70565 0.275
NP_440656.1_8 Reverse -141 -160 -9.44032 0.286
NP_441414.1_9 Reverse -164 -183 3.04771 0.0606
NP_439968.1_8 Forward -155 -139 12.8416 0.285
NP_441256.1_8 Forward -299 -280 2.0644 0.285
NP_442937.1_5 Forward -178 -159 12.2908 0.113
NP_441317.1_4 Reverse -123 -137 9.65494 0.29
NP_441958.1_5 Forward -174 -164 12.2714 0.00183
NP_441958.1_5 Reverse -163 -173 12.2714 0.00183
NP_441958.1_5 Forward -162 -152 0.963343 0.12
NP_440610.1_4 Forward -292 -273 18.4848 0.245
NP_440203.1_5 Reverse -155 -165 12.7626 0.138
NP_440203.1_5 Reverse -180 -190 9.02601 0.275
NP_439905.1_2 Reverse -153 -167 9.14437 0.234
NP_443001.1_7 Forward -185 -166 3.6377 0.279
NP_440984.1_7 Reverse -159 -173 9.63603 0.127
NP_440984.1_7 Reverse -231 -245 6.19444 0.224
NP_441162.1_3 Forward -311 -292 7.47261 0.293
NP_439990.1_5 Forward -178 -165 20.4721 0.00366
NP_439990.1_5 Reverse -159 -172 13.7856 0.0889
NP_442911.1_2 Forward -183 -164 12.9791 0.0118
NP_442911.1_2 Reverse -154 -173 8.06259 0.0223
NP_442911.1_2 Forward -115 -96 -4.22878 0.129
NP_440153.1_5 Forward -172 -158 2.75286 0.219
NP_441591.1_10 Forward -249 -230 9.63589 0.199
NP_443055.1_6 Reverse -229 -247 2.08335 0.22
NP_443055.1_6 Reverse -283 -301 0.706727 0.24
NP_440993.1_3 Reverse -154 -173 4.71854 0.161
NP_440993.1_3 Forward -183 -164 4.03023 0.17
NP_442210.1_9 Forward -177 -159 9.0656 0.269
NP_439975.1_2 Forward -363 -345 6.01734 0.256
NP_441099.1_5 Reverse -154 -173 -0.000545616 0.0865
NP_441099.1_5 Reverse -355 -374 -8.06369 0.187
NP_441099.1_5 Forward -171 -152 -9.24366 0.216
NP_442002.1_9 Reverse -388 -395 9.77388 0.258
NP_442002.1_9 Reverse -151 -158 9.08556 0.289
NP_441294.1_7 Reverse -148 -162 10.6905 0.177
NP_441294.1_7 Forward -177 -163 9.15464 0.256
NP_442438.1_10 Reverse -159 -173 9.04604 0.0692
NP_442438.1_10 Reverse -147 -161 0.88457 0.213
NP_441000.1_6 Forward -162 -148 -5.70361 0.29
NP_442771.1_1 Reverse -150 -168 -7.25734 0.17
NP_442771.1_1 Reverse -265 -283 -8.83064 0.208
NP_440484.1_3 Reverse -162 -176 11.2093 0.242
NP_440147.1_4 Forward -175 -162 18.9972 0.00328
NP_440147.1_4 Reverse -162 -175 8.77074 0.0465
NP_441550.1_8 Reverse -162 -172 15.1225 0.0132
NP_441550.1_8 Forward -175 -165 14.6309 0.0132
NP_441916.1_7 Forward -173 -163 10.3048 0.0261
NP_441916.1_7 Reverse -164 -174 10.3048 0.0261
NP_441916.1_10 Reverse -156 -175 5.211 0.214
NP_440206.1_4 Reverse -293 -312 -1.96793 0.293
NP_441041.1_4 Forward -173 -154 -8.65367 0.205
NP_441041.1_4 Reverse -152 -171 -9.34199 0.215
NP_441041.1_7 Reverse -161 -173 7.51478 0.162
NP_442396.1_5 Forward -177 -164 12.114 0.0913
NP_443063.1_7 Reverse -151 -167 9.20332 0.224
NP_442004.1_6 Reverse -152 -166 8.55439 0.14
NP_441725.1_4 Reverse -159 -173 4.42388 0.278
NP_441725.1_5 Forward -172 -162 2.04498 0.115
NP_441725.1_5 Reverse -165 -175 2.04498 0.115
NP_441725.1_5 Reverse -153 -163 1.65166 0.13
NP_441725.1_5 Forward -160 -150 -0.0199663 0.223
NP_439966.1_7 Reverse -162 -172 15.3192 0.0152
NP_439966.1_7 Reverse -150 -160 12.0743 0.0508
NP_439966.1_7 Reverse -353 -363 9.12434 0.119
NP_439966.1_7 Forward -175 -165 7.25606 0.15
NP_439966.1_7 Reverse -290 -300 5.38779 0.226
NP_439966.1_7 Reverse -236 -246 4.99446 0.248
NP_442941.1_3 Forward -172 -162 19.2529 0.00262
NP_442941.1_3 Reverse -165 -175 11.0914 0.0116
NP_442941.1_3 Forward -160 -150 -0.609952 0.264
NP_440289.1_2 Reverse -161 -174 3.06754 0.0811
NP_440289.1_2 Reverse -149 -162 -4.79893 0.294
NP_440289.1_2 Forward -176 -163 -4.9956 0.294
NP_440260.1_8 Reverse -264 -282 -6.07737 0.285
NP_441678.1_9 Forward -282 -263 -2.55715 0.26
NP_442281.1_1 Reverse -159 -173 16.5185 0.00772
NP_441566.1_3 Forward -293 -274 16.0274 0.198
NP_442575.1_8 Forward -384 -365 -3.93378 0.26
NP_442575.1_8 Forward -256 -237 -6.78538 0.286
NP_442256.1_2 Forward -175 -157 -0.374176 0.14
NP_442256.1_2 Reverse -162 -180 -8.73231 0.235
NP_442012.1_1 Reverse -158 -177 1.76941 0.212
NP_441457.1_7 Forward -94 -75 0.786102 0.278
NP_441556.1_10 Reverse -159 -173 13.0446 0.182
NP_442068.1_4 Reverse -131 -150 7.37347 0.23
NP_441644.1_6 Forward -173 -163 17.3841 0.00127
NP_441644.1_6 Reverse -164 -174 17.3841 0.00127
NP_441644.1_6 Reverse -83 -93 6.66608 0.152
NP_442215.1_2 Forward -175 -159 16.3815 0.0155
NP_442215.1_2 Reverse -162 -178 -1.61309 0.186
NP_442215.1_2 Forward -309 -293 -4.46469 0.233
NP_442029.1_6 Forward -178 -159 15.4374 0.0999
NP_442029.1_6 Forward -373 -354 4.22769 0.271
NP_442029.1_6 Reverse -159 -178 4.22769 0.271
NP_442029.1_8 Forward -203 -184 9.53756 0.284
NP_440253.1_2 Forward -173 -155 3.75572 0.112
NP_440253.1_2 Reverse -164 -182 0.21581 0.192
NP_440929.1_8 Forward -173 -164 19.2726 0.000701
NP_440929.1_8 Reverse -164 -173 19.2726 0.000701
NP_440780.1_1 Reverse -314 -333 10.7424 0.257
NP_442933.1_2 Forward -131 -113 10.3151 0.257
NP_442933.1_10 Forward -173 -164 17.601 0.00325
NP_442933.1_10 Reverse -164 -173 17.601 0.00325
NP_441751.2_8 Forward -172 -158 -2.16369 0.132
NP_442554.1_8 Forward -172 -162 16.2046 0.0065
NP_442554.1_8 Reverse -165 -175 15.3197 0.00882
NP_441762.1_7 Reverse -163 -175 0.432302 0.0747
NP_441762.1_7 Forward -277 -265 -6.5492 0.284
NP_441762.1_7 Forward -174 -162 -6.74586 0.284
NP_442142.1_4 Reverse -161 -174 13.49 0.0348
NP_442142.1_4 Forward -164 -151 4.44361 0.222
NP_442142.1_4 Forward -176 -163 2.96866 0.269
NP_442292.1_1 Forward -172 -163 18.486 0.00229
NP_442292.1_1 Reverse -165 -174 18.486 0.00229
NP_442476.1_6 Forward -172 -158 2.06454 0.195
NP_440895.1_6 Forward -179 -166 10.049 0.202
NP_441523.1_6 Reverse -160 -179 5.80098 0.229
NP_443009.1_2 Reverse -166 -185 0.294447 0.216
NP_443009.1_5 Forward -162 -151 14.7094 0.02
NP_443009.1_5 Reverse -163 -174 8.90795 0.0965
NP_443009.1_5 Forward -174 -163 8.90795 0.0965
NP_443009.1_5 Reverse -151 -162 6.74468 0.15
NP_441715.1_4 Forward -172 -162 17.3846 0.0106
NP_441715.1_4 Reverse -165 -175 7.94484 0.107
NP_441715.1_4 Forward -160 -150 4.60159 0.261
NP_441198.1_5 Forward -90 -77 15.9483 0.206
NP_441198.1_8 Forward -163 -153 10.2438 0.289
NP_441198.1_10 Reverse -65 -84 17.2074 0.268
NP_440464.1_10 Reverse -165 -175 13.0082 0.169
NP_441468.1_1 Forward -172 -165 15.8704 0.0124
NP_441468.1_1 Reverse -165 -172 15.8704 0.0124
NP_441015.1_10 Forward -178 -159 -3.04881 0.184
NP_441015.1_10 Reverse -159 -178 -7.86702 0.272
NP_441015.1_10 Forward -172 -153 -11.1119 0.291
NP_441673.1_1 Forward -173 -164 20.8459 0.000698
NP_441673.1_1 Reverse -164 -173 20.8459 0.000698
NP_441673.1_1 Forward -161 -152 1.27803 0.155
NP_441673.1_1 Reverse -152 -161 1.27803 0.155
NP_441876.1_9 Reverse -278 -288 14.1392 0.267
NP_441876.1_9 Reverse -288 -298 13.8442 0.267
NP_441826.1_2 Reverse -158 -172 6.98109 0.0899
NP_441826.1_2 Reverse -146 -160 -3.63866 0.286
NP_441826.1_2 Reverse -297 -311 -4.52363 0.296
NP_441330.1_1 Reverse -159 -178 -3.14714 0.0791
NP_441637.1_9 Reverse -116 -134 -4.11075 0.296
NP_442490.1_9 Forward -173 -154 3.73603 0.165
NP_442490.1_9 Reverse -152 -171 -4.91709 0.273
NP_441764.1_8 Reverse -387 -397 15.1389 0.284
NP_441764.1_8 Reverse -174 -184 11.0236 0.287
NP_442081.1_1 Reverse -111 -130 18.5709 0.217
NP_442868.1_6 Reverse -162 -172 19.2529 0.00563
NP_442868.1_6 Forward -175 -165 9.81313 0.038
NP_442719.1_2 Forward -44 -26 -11.6829 0.294
NP_441056.1_1 Forward -173 -154 -0.688862 0.166
NP_441056.1_1 Reverse -152 -171 -1.96717 0.193
NP_441612.1_2 Reverse -164 -174 8.54929 0.21
NP_441612.1_2 Forward -173 -163 8.54929 0.21
NP_441612.1_2 Forward -133 -123 6.80666 0.277
NP_442227.1_2 Reverse -360 -379 8.65258 0.171
NP_442227.1_2 Reverse -356 -375 4.42435 0.206
NP_442227.1_2 Reverse -285 -304 -2.16383 0.271
NP_442227.1_2 Reverse -282 -301 -3.83545 0.298
NP_442361.1_3 Reverse -158 -171 10.049 0.272
NP_442427.1_8 Forward -182 -163 12.3892 0.152
NP_442808.1_1 Reverse -163 -173 8.63269 0.0481
NP_442808.1_1 Forward -174 -164 8.63269 0.0481
NP_442808.1_1 Reverse -151 -161 6.37109 0.116
NP_442808.1_1 Reverse -362 -372 3.91283 0.218
NP_441101.1_10 Forward -165 -146 1.0811 0.173
NP_441176.1_1 Forward -248 -229 8.65258 0.273
NP_442820.1_4 Forward -339 -322 11.7402 0.265
NP_442542.1_2 Reverse -265 -278 6.01747 0.239
NP_442050.1_5 Reverse -162 -172 14.3359 0.0206
NP_442050.1_5 Reverse -353 -363 7.94438 0.243
NP_442050.1_5 Forward -175 -165 7.64939 0.243
NP_441114.1_3 Forward -43 -34 15.1427 0.193
NP_440558.1_2 Reverse -148 -167 -0.197208 0.198
NP_440558.1_2 Forward -170 -151 -3.44213 0.236
NP_442789.1_4 Reverse -184 -203 -7.86702 0.299
NP_441878.1_6 Forward -174 -164 10.4031 0.0176
NP_441878.1_6 Reverse -163 -173 10.4031 0.0176
NP_441878.1_6 Forward -162 -152 2.24165 0.0462
NP_441878.1_6 Reverse -35 -45 -7.29646 0.217
NP_441036.1_8 Forward -174 -164 8.33817 0.174
NP_441036.1_8 Reverse -163 -173 8.33817 0.174
NP_442650.1_2 Reverse -96 -110 2.75286 0.246
NP_441557.1_5 Forward -173 -164 19.9609 0.000699
NP_441557.1_5 Reverse -164 -173 19.9609 0.000699
NP_441557.1_5 Forward -161 -152 0.393051 0.166
NP_441557.1_5 Reverse -152 -161 0.393051 0.166
NP_441445.1_1 Forward -170 -151 3.83436 0.205
NP_441445.1_1 Forward -182 -163 3.04771 0.22
NP_441308.1_8 Forward -94 -84 9.22315 0.226
NP_441458.1_10 Reverse -155 -174 5.01433 0.224
NP_441458.1_10 Forward -182 -163 4.42435 0.23
NP_442183.1_1 Forward -161 -147 6.48943 0.171
NP_442183.1_1 Reverse -152 -166 4.32615 0.266
NP_442183.1_9 Forward -145 -135 9.41981 0.296
NP_441459.1_8 Forward -180 -167 10.934 0.286
NP_442347.1_2 Forward -172 -163 12.4878 0.056
NP_442347.1_2 Reverse -165 -174 12.4878 0.056
NP_442645.1_2 Reverse -156 -175 -22.715 0.293
NP_441037.1_4 Reverse -265 -275 9.65667 0.21
NP_441037.1_4 Forward -175 -165 7.9999 0.237
NP_442508.1_8 Forward -381 -364 9.08529 0.292
NP_441633.1_3 Reverse -162 -175 3.46087 0.0699
NP_441633.1_3 Forward -175 -162 1.19926 0.109
NP_441633.1_3 Reverse -150 -163 -4.79893 0.212
NP_440136.1_2 Forward -172 -165 15.9687 0.0123
NP_440136.1_2 Reverse -165 -172 15.9687 0.0123
NP_440136.1_2 Forward -160 -153 11.1505 0.0519
NP_442590.1_10 Forward -173 -154 3.24438 0.294
NP_442998.1_5 Forward -283 -273 12.4681 0.169
NP_442998.1_5 Forward -263 -253 11.8781 0.176
NP_442998.1_10 Forward -171 -164 15.5754 0.0102
NP_442998.1_10 Reverse -166 -173 15.5754 0.0102
NP_440731.1_2 Reverse -152 -171 3.44104 0.295
NP_440899.1_8 Reverse -275 -294 -9.047 0.258
NP_440299.1_1 Forward -177 -164 22.7331 0.000547
NP_440299.1_1 Reverse -160 -173 20.2748 0.00128
NP_440299.1_1 Forward -109 -96 5.52525 0.172
NP_441799.1_1 Forward -177 -163 6.98048 0.155
NP_441799.1_1 Reverse -160 -174 6.58715 0.167
NP_441007.1_10 Reverse -159 -172 -0.669033 0.287
NP_442201.1_10 Reverse -153 -172 -14.8485 0.291
NP_442333.2_5 Reverse -153 -172 -13.1769 0.251
NP_440256.1_1 Forward -164 -145 5.99764 0.0324
NP_440256.1_1 Reverse -161 -180 -0.295539 0.0918
NP_440256.1_1 Forward -176 -157 -1.47551 0.104
NP_442283.1_6 Forward -315 -296 16.6174 0.189
NP_441559.1_8 Reverse -147 -161 3.24451 0.143
NP_441559.1_8 Reverse -159 -173 2.94952 0.143
NP_441559.1_8 Forward -178 -164 -6.19526 0.275
NP_440915.1_6 Reverse -160 -174 10.6193 0.0301
NP_440915.1_6 Forward -177 -163 3.44117 0.101
NP_440915.1_6 Forward -164 -150 -2.06536 0.258
NP_442452.1_8 Reverse -158 -172 12.2903 0.273
NP_442866.1_1 Forward -97 -78 -8.06369 0.275
NP_441464.1_10 Reverse -114 -128 7.66941 0.295
NP_440702.1_2 Forward -157 -138 -6.78538 0.261
NP_440695.1_5 Reverse -152 -171 7.37428 0.15
NP_440695.1_5 Forward -173 -154 4.916 0.186
NP_441939.1_3 Forward -172 -153 16.9124 0.0341
NP_441494.1_6 Forward -166 -153 10.934 0.225
NP_442993.1_1 Reverse -267 -283 -9.08625 0.179
NP_442993.1_1 Reverse -247 -263 -9.67623 0.19
NP_442386.1_9 Reverse -163 -172 13.8639 0.0289
NP_442386.1_9 Forward -174 -165 13.8639 0.0289
NP_442386.1_9 Reverse -151 -160 9.24241 0.168
NP_442386.1_9 Reverse -348 -357 6.78414 0.219
NP_442386.1_9 Reverse -354 -363 5.50585 0.25
NP_440570.1_5 Reverse -67 -86 -0.197208 0.262
NP_441340.1_5 Forward -172 -165 15.6737 0.0124
NP_441340.1_5 Reverse -165 -172 15.6737 0.0124
NP_442484.1_2 Reverse -153 -172 19.469 0.0181
NP_442484.1_2 Forward -184 -165 6.58763 0.156
NP_439976.1_4 Reverse -279 -298 9.04509 0.278
NP_442240.1_1 Reverse -156 -175 4.91521 0.266
NP_442240.1_2 Forward -172 -153 -19.1751 0.295
NP_442714.1_7 Reverse -165 -184 -0.787193 0.274
NP_440586.1_8 Forward -172 -165 13.2151 0.026
NP_440586.1_8 Reverse -165 -172 13.2151 0.026
NP_440586.1_8 Reverse -84 -91 9.3802 0.156
NP_442251.1_6 Forward -172 -165 15.2804 0.0124
NP_442251.1_6 Reverse -165 -172 15.2804 0.0124
NP_442251.1_6 Reverse -187 -194 8.20058 0.23
NP_442959.1_5 Forward -348 -329 10.4225 0.224
NP_441262.1_3 Reverse -164 -171 14.7888 0.0223
NP_441262.1_3 Forward -173 -166 14.7888 0.0223
NP_440027.1_3 Reverse -297 -315 6.01657 0.23
NP_440027.1_3 Reverse -349 -367 5.62325 0.239
NP_443051.1_1 Reverse -163 -172 10.4228 0.00754
NP_443051.1_1 Forward -174 -165 10.4228 0.00754
NP_439937.1_9 Reverse -163 -180 -6.84499 0.157
NP_439937.1_9 Forward -49 -32 -8.41828 0.176
NP_439937.1_9 Forward -162 -145 -10.3849 0.227
NP_439937.1_9 Reverse -281 -298 -14.7114 0.287
NP_441595.1_2 Reverse -384 -397 9.229 0.277
NP_440408.1_7 Forward -173 -154 19.3707 0.107
NP_440408.1_7 Forward -364 -345 7.17762 0.291
NP_440439.1_1 Reverse -161 -174 1.9859 0.138
NP_440439.1_1 Reverse -149 -162 0.215946 0.199
NP_440439.1_1 Forward -164 -151 -1.45568 0.269
NP_442239.1_8 Forward -167 -148 6.58763 0.263
NP_439943.1_7 Forward -178 -159 8.55425 0.181
NP_440372.1_2 Forward -172 -165 16.3621 0.0124
NP_440372.1_2 Reverse -165 -172 16.3621 0.0124
NP_440819.1_5 Forward -264 -256 7.59091 0.272
NP_442488.1_7 Reverse -325 -344 11.7992 0.231
NP_441803.1_2 Reverse -159 -178 5.01433 0.171
NP_439977.1_5 Reverse -158 -177 2.65439 0.17
NP_439977.1_5 Forward -179 -160 0.196116 0.212
NP_440139.1_1 Forward -282 -263 6.78348 0.139
NP_440210.1_8 Forward -92 -76 7.43336 0.293
NP_442384.1_10 Forward -173 -160 20.8655 0.00194
NP_442384.1_10 Reverse -164 -177 17.7189 0.00567
NP_442384.1_10 Reverse -152 -165 6.31247 0.105
NP_442384.1_10 Forward -44 -31 0.805932 0.278
NP_442114.1_8 Forward -132 -118 22.025 0.0708
NP_442114.1_8 Forward -125 -111 4.52221 0.259
NP_441018.1_7 Forward -177 -158 12.3892 0.161
NP_441018.1_7 Forward -190 -171 9.63589 0.22
NP_441018.1_7 Reverse -263 -282 6.88262 0.281
NP_442790.1_4 Forward -182 -163 -10.1286 0.201
NP_442262.1_10 Forward -172 -165 14.1988 0.0123
NP_442262.1_10 Reverse -165 -172 14.1988 0.0123
NP_441689.1_5 Forward -175 -165 5.78111 0.197
NP_441689.1_5 Reverse -162 -172 5.78111 0.197
NP_440163.1_10 Forward -273 -263 8.33817 0.278
NP_440344.1_10 Forward -180 -163 10.5603 0.00697
NP_440344.1_10 Forward -168 -151 4.46374 0.0247
NP_440344.1_10 Reverse -157 -174 -6.746 0.114
NP_440282.1_10 Forward -171 -152 -10.0303 0.29
NP_440531.1_6 Reverse -156 -175 -2.55715 0.253
NP_440531.1_6 Reverse -361 -380 -5.31042 0.296
NP_441060.1_1 Forward -161 -142 13.0577 0.294
NP_441060.1_3 Forward -381 -362 7.17762 0.297
NP_442910.1_1 Forward -180 -161 -6.88371 0.254
NP_440487.1_1 Reverse -183 -202 -6.09707 0.239
NP_441335.1_8 Reverse -182 -201 6.19431 0.291
NP_440562.1_3 Forward -91 -74 3.0871 0.247
NP_441965.1_10 Forward -176 -160 4.18844 0.247
NP_440297.1_9 Reverse -153 -163 0.766681 0.282
NP_440297.1_9 Forward -172 -162 -0.118297 0.282
NP_440297.1_9 Reverse -165 -175 -0.118297 0.282
NP_440350.1_5 Reverse -115 -134 3.14605 0.158
NP_440350.1_5 Reverse -108 -127 -6.1954 0.296
NP_442187.1_3 Forward -143 -133 14.9263 0.129
NP_441592.1_4 Reverse -267 -286 -3.04881 0.274
NP_441103.1_9 Reverse -288 -298 12.2942 0.299
NP_440990.1_10 Forward -304 -285 15.3391 0.261
NP_440894.1_10 Reverse -279 -298 2.3594 0.29
NP_440999.1_9 Reverse -160 -174 10.1277 0.055
NP_440888.1_2 Forward -173 -159 17.7968 0.00308
NP_440888.1_2 Reverse -164 -178 11.7003 0.0611
NP_440888.1_2 Forward -161 -147 11.2087 0.0729
NP_440600.1_4 Reverse -156 -174 -3.42244 0.23
NP_439969.1_3 Forward -178 -159 0.786102 0.265
NP_442277.1_4 Reverse -155 -174 3.24359 0.228
NP_442277.1_7 Forward -135 -119 -1.99853 0.289
NP_442033.1_10 Reverse -94 -113 -2.75381 0.156
NP_441543.1_2 Forward -172 -163 16.9127 0.00359
NP_441543.1_2 Reverse -165 -174 16.9127 0.00359
NP_442845.1_2 Forward -179 -165 11.7993 0.122
NP_442845.1_2 Forward -173 -159 7.37441 0.195
NP_442845.1_2 Forward -253 -239 6.29277 0.212
NP_442845.1_2 Reverse -29 -43 4.12949 0.267
NP_441304.1_10 Forward -241 -232 13.1761 0.255
NP_441918.1_7 Forward -162 -143 -2.45882 0.297
NP_441469.1_8 Reverse -151 -160 13.3727 0.073
NP_441469.1_8 Forward -174 -165 6.48957 0.227
NP_441469.1_8 Reverse -163 -172 6.48957 0.227
NP_443064.1_6 Forward -173 -163 12.5669 0.0796
NP_443064.1_6 Reverse -164 -174 12.5669 0.0796
NP_443064.1_6 Reverse -152 -162 11.7912 0.119
NP_443064.1_6 Forward -211 -201 8.59164 0.278
NP_442578.1_7 Forward -172 -165 14.5921 0.026
NP_442578.1_7 Reverse -165 -172 14.5921 0.026
NP_440710.1_1 Forward -53 -35 -1.45582 0.18
NP_440998.1_3 Reverse -328 -347 5.01433 0.16
NP_441462.1_2 Forward -173 -163 11.5831 0.00406
NP_441462.1_2 Reverse -164 -174 11.5831 0.00406
NP_441462.1_2 Reverse -152 -162 0.57002 0.144
NP_441621.1_7 Forward -107 -93 -5.9986 0.27
NP_443062.1_1 Forward -173 -155 4.45062 0.26
NP_443062.1_6 Reverse -144 -163 9.53756 0.125
NP_443062.1_6 Forward -169 -150 1.37609 0.276
NP_443062.1_6 Forward -181 -162 0.982764 0.283
NP_440889.1_5 Reverse -325 -344 13.6675 0.188
NP_440911.1_4 Forward -171 -152 -7.17871 0.266
NP_442204.1_1 Reverse -160 -171 11.5634 0.0565
NP_442204.1_1 Forward -199 -188 6.54852 0.162
NP_442204.1_2 Reverse -154 -173 18.4857 0.144
NP_442204.1_2 Forward -171 -152 6.98095 0.287
NP_440504.1_5 Reverse -168 -186 9.26226 0.162
NP_440516.1_4 Reverse -282 -301 15.3391 0.261
NP_440516.1_8 Forward -173 -164 16.9127 0.00442
NP_440516.1_8 Reverse -164 -173 16.9127 0.00442
NP_442428.1_4 Reverse -151 -170 3.6377 0.24
NP_442428.1_5 Forward -172 -165 15.8704 0.0124
NP_442428.1_5 Reverse -165 -172 15.8704 0.0124
NP_441443.1_5 Reverse -138 -157 9.63589 0.269
NP_440618.1_1 Forward -267 -248 -6.58872 0.247
NP_441867.1_2 Forward -247 -228 -3.14714 0.176
NP_440673.1_3 Forward -171 -164 12.4288 0.0426
NP_440673.1_3 Reverse -166 -173 12.4288 0.0426
NP_440673.1_3 Forward -90 -83 11.7405 0.0653
NP_440673.1_3 Forward -109 -102 6.92228 0.277
NP_440673.1_3 Forward -43 -36 6.23397 0.283
NP_441052.1_2 Forward -173 -163 19.9412 0.00106
NP_441052.1_2 Reverse -164 -174 19.9412 0.00106
NP_442219.1_9 Forward -172 -163 17.7976 0.00718
NP_442219.1_9 Reverse -165 -174 17.7976 0.00718
NP_440436.1_4 Forward -172 -163 17.2072 0.00233
NP_440436.1_4 Reverse -165 -174 17.2072 0.00233
NP_440436.1_4 Forward -160 -151 5.21086 0.214
NP_441884.1_9 Forward -176 -157 -22.6167 0.281
NP_442864.1_2 Forward -60 -41 14.6508 0.224
NP_440314.1_9 Reverse -165 -184 -3.14714 0.176
NP_442907.1_2 Reverse -184 -202 11.4255 0.181
NP_441719.1_4 Forward -172 -165 16.3621 0.0124
NP_441719.1_4 Reverse -165 -172 16.3621 0.0124
NP_441719.1_6 Reverse -280 -299 5.50519 0.29
NP_441719.1_6 Forward -41 -22 5.40686 0.29
NP_441719.1_6 Reverse -288 -307 4.42355 0.297
NP_441004.1_1 Forward -299 -280 -8.94866 0.206
NP_441004.1_1 Reverse -30 -49 -12.0953 0.244
NP_441004.1_1 Forward -179 -160 -15.4385 0.275
NP_441004.1_2 Reverse -25 -44 -3.93378 0.286
NP_441004.1_4 Reverse -33 -43 14.828 0.175
NP_441004.1_4 Reverse -99 -109 7.84651 0.286
NP_442813.1_4 Forward -188 -169 -6.29373 0.299
NP_442813.1_4 Forward -157 -138 -8.85033 0.299
NP_442366.1_3 Reverse -246 -264 2.28076 0.132
NP_442366.1_3 Reverse -163 -181 -1.75081 0.217
NP_442366.1_3 Forward -174 -156 -4.60241 0.274
NP_442366.1_5 Forward -176 -166 15.4175 0.0374
NP_440129.1_10 Reverse -157 -171 5.21113 0.185
NP_440129.1_10 Forward -168 -154 3.8345 0.189
NP_441115.1_4 Reverse -82 -100 11.6214 0.133
NP_441115.1_4 Forward -174 -156 9.06482 0.227
NP_442694.1_4 Forward -324 -315 11.9961 0.275
NP_442206.1_10 Forward -173 -158 4.01147 0.179
NP_442854.1_4 Reverse -292 -311 19.9598 0.0619
NP_442854.1_4 Reverse -159 -178 10.815 0.278
NP_442854.1_6 Forward -167 -148 0.884433 0.287
NP_443054.1_2 Reverse -227 -241 4.22782 0.24
NP_443054.1_2 Forward -163 -149 1.27789 0.25
NP_443054.1_2 Reverse -162 -176 -0.393733 0.294
NP_443054.1_2 Reverse -150 -164 -0.492064 0.295
NP_441851.1_7 Forward -157 -138 4.62101 0.297
NP_441851.1_10 Forward -174 -164 15.8113 0.00552
NP_441851.1_10 Reverse -163 -173 15.8113 0.00552
NP_441851.1_10 Forward -162 -152 14.533 0.0146
NP_441851.1_10 Reverse -151 -161 4.40493 0.271
NP_442856.1_2 Reverse -371 -390 13.6675 0.0858
NP_442856.1_7 Reverse -155 -174 -4.03212 0.254
NP_442856.1_7 Reverse -199 -218 -5.9004 0.289
NP_441668.1_4 Forward -183 -164 2.94938 0.189
NP_442515.1_1 Reverse -163 -177 4.42448 0.107
NP_442515.1_1 Forward -174 -160 2.16287 0.141
NP_441396.1_5 Forward -147 -138 9.4395 0.205
NP_441683.1_7 Forward -293 -274 5.01433 0.241
NP_440593.1_3 Reverse -159 -178 -0.000545616 0.198
NP_440593.1_3 Forward -178 -159 -2.85214 0.228
NP_440593.1_3 Reverse -153 -172 -6.58872 0.278
NP_441982.1_6 Forward -135 -126 13.2493 0.274
NP_440165.1_5 Forward -174 -155 -7.08038 0.256
NP_441349.1_10 Forward -183 -164 -7.17871 0.245
NP_441409.1_6 Forward -179 -160 0.0977854 0.0655
NP_441394.1_10 Reverse -356 -374 14.0797 0.238
NP_441394.1_10 Reverse -209 -227 8.86816 0.263
NP_442314.1_6 Reverse -352 -371 9.43923 0.269
NP_442843.1_1 Forward -300 -281 6.39097 0.144
NP_442843.1_1 Forward -268 -249 -3.93378 0.23
NP_442843.1_1 Forward -299 -280 -8.06369 0.253
NP_442843.1_1 Forward -255 -236 -9.53865 0.266
NP_439960.1_10 Reverse -157 -175 3.06741 0.165
NP_440474.1_8 Reverse -84 -98 8.45543 0.186
NP_440431.1_3 Reverse -163 -182 7.47261 0.0886
NP_440431.1_3 Forward -174 -155 -4.6221 0.179
NP_440431.1_3 Reverse -326 -345 -6.88371 0.199
NP_440431.1_4 Forward -129 -110 8.06865 0.07
NP_442450.1_5 Forward -175 -165 7.55152 0.13
NP_440588.1_2 Forward -182 -163 -5.50708 0.252
NP_441031.1_8 Reverse -184 -203 -4.91709 0.268
NP_442006.1_3 Forward -299 -281 -7.749 0.298
NP_440483.1_1 Forward -306 -287 -5.21209 0.223
NP_442243.1_1 Reverse -158 -176 15.2596 0.106
NP_442243.1_1 Reverse -291 -309 -2.83317 0.297
NP_441570.1_1 Forward -173 -155 -10.5023 0.171
NP_441570.1_1 Forward -161 -143 -15.0255 0.227
NP_441570.1_1 Reverse -36 -54 -16.4021 0.245
NP_441078.1_4 Forward -173 -164 19.6659 0.0007
NP_441078.1_4 Reverse -164 -173 19.6659 0.0007
NP_441078.1_4 Reverse -152 -161 7.86621 0.0432
NP_441078.1_4 Forward -161 -152 0.589713 0.174
NP_442729.1_8 Forward -177 -164 9.36073 0.125
NP_441663.1_8 Reverse -370 -389 -2.0655 0.258
NP_442443.1_4 Reverse -310 -320 13.1559 0.261
NP_440793.1_1 Reverse -119 -133 9.14375 0.295
NP_440526.1_3 Forward -172 -161 8.02298 0.126
NP_440526.1_3 Reverse -153 -164 6.35136 0.205
NP_440526.1_3 Reverse -165 -176 1.04151 0.267
NP_441432.1_8 Reverse -163 -172 16.8143 0.00595
NP_441432.1_8 Forward -174 -165 16.8143 0.00595
NP_441333.1_1 Reverse -118 -128 14.7357 0.208
NP_442320.1_8 Forward -179 -165 6.48943 0.0272
NP_442320.1_8 Reverse -158 -172 -4.32697 0.159
NP_441732.1_2 Reverse -160 -176 -6.52964 0.0495
NP_441732.1_2 Forward -177 -161 -6.82463 0.0533
NP_441732.1_2 Forward -165 -149 -15.2811 0.145
NP_442343.1_8 Forward -269 -253 19.5273 0.293
NP_440760.1_1 Reverse -164 -183 -5.60541 0.0503
NP_440760.1_1 Forward -45 -26 -21.1417 0.231
NP_442797.1_7 Reverse -157 -175 -1.16082 0.293
NP_442353.1_4 Forward -179 -160 3.53858 0.215
NP_442353.1_4 Reverse -158 -177 1.6703 0.242
NP_442727.1_1 Forward -152 -138 13.4709 0.245
NP_442400.1_10 Reverse -178 -191 9.32449 0.271
NP_442400.1_10 Reverse -329 -342 8.56056 0.278
NP_440713.1_4 Forward -171 -152 2.94938 0.254
NP_440713.1_4 Reverse -154 -173 1.96607 0.273
NP_442489.1_2 Forward -178 -159 8.35759 0.168
NP_442489.1_7 Forward -173 -164 20.1576 0.000695
NP_442489.1_7 Reverse -164 -173 20.1576 0.000695
NP_442489.1_7 Forward -161 -152 7.86621 0.0448
NP_442489.1_7 Reverse -152 -161 0.589713 0.17
NP_440386.1_1 Forward -164 -145 -9.44032 0.28
NP_440559.1_1 Forward -172 -163 17.4043 0.00658
NP_440559.1_1 Reverse -165 -174 17.4043 0.00658
NP_440559.1_1 Reverse -153 -162 4.22796 0.292
NP_441659.2_8 Forward -173 -163 18.1713 0.00133
NP_441659.2_8 Reverse -164 -174 18.1713 0.00133
NP_441659.2_8 Reverse -83 -93 2.24165 0.207
NP_441659.2_8 Reverse -152 -162 0.0783647 0.277
NP_440860.1_6 Forward -160 -141 12.1925 0.293
NP_442913.1_10 Reverse -155 -174 -0.295539 0.158
NP_441040.1_5 Forward -383 -364 3.24438 0.275
NP_442008.1_2 Forward -176 -157 8.16093 0.2
NP_440708.1_6 Reverse -154 -173 -6.39206 0.234
NP_440708.1_6 Reverse -355 -374 -7.37537 0.248
NP_440779.1_5 Forward -276 -259 -6.05768 0.159
NP_442346.1_5 Forward -174 -164 16.6963 0.00248
NP_442346.1_5 Reverse -163 -173 16.6963 0.00248
NP_442346.1_5 Reverse -35 -45 9.22315 0.118
NP_442346.1_5 Reverse -82 -92 8.1415 0.146
NP_440545.1_3 Forward -177 -160 3.97208 0.0764
NP_440545.1_3 Forward -165 -148 -6.15601 0.27
NP_440545.1_3 Reverse -299 -316 -6.64766 0.285
NP_440459.1_2 Forward -236 -219 7.90532 0.276
NP_441653.1_2 Reverse -153 -172 17.2516 0.0464
NP_441653.1_2 Forward -172 -153 11.6469 0.111
NP_441653.1_2 Forward -126 -107 5.94546 0.235
NP_440847.1_3 Reverse -356 -370 16.8135 0.119
NP_442603.1_7 Forward -173 -159 19.7634 0.00895
NP_442603.1_7 Reverse -164 -178 12.2903 0.1
NP_441888.1_7 Reverse -159 -173 3.73617 0.225
NP_441358.1_2 Forward -299 -280 5.211 0.277
NP_441502.1_3 Reverse -162 -181 9.3409 0.212
NP_441502.1_3 Forward -175 -156 5.60432 0.287
NP_441833.1_4 Forward -172 -165 15.9687 0.0124
NP_441833.1_4 Reverse -165 -172 15.9687 0.0124
NP_441833.1_4 Forward -91 -84 4.46401 0.256
NP_441329.1_6 Forward -132 -113 -2.24448 0.294
NP_441112.1_6 Reverse -167 -186 2.55606 0.241
NP_442162.1_9 Forward -172 -165 16.2637 0.0124
NP_442162.1_9 Reverse -165 -172 16.2637 0.0124
NP_440224.1_1 Reverse -153 -172 2.26107 0.132
NP_440204.1_1 Forward -327 -308 1.96607 0.278
NP_442199.1_5 Reverse -156 -175 -0.4922 0.177
NP_442140.1_3 Reverse -165 -175 12.2714 0.0632
NP_442140.1_3 Forward -172 -162 10.3048 0.0902
NP_440875.1_9 Forward -90 -80 9.15072 0.233
NP_440875.1_9 Forward -171 -161 8.37203 0.233
NP_441813.1_3 Forward -294 -275 13.4617 0.284
NP_441813.1_5 Reverse -162 -172 18.1713 0.00743
NP_441813.1_5 Forward -175 -165 8.63316 0.0367
NP_442028.1_1 Reverse -116 -129 9.99293 0.251
NP_442028.1_1 Reverse -117 -130 7.03268 0.292
NP_440590.1_4 Reverse -165 -178 19.5871 0.00651
NP_440590.1_4 Forward -172 -159 12.8023 0.013
NP_440590.1_4 Forward -275 -262 -0.669033 0.196
NP_440567.1_1 Forward -172 -158 6.78443 0.0803
NP_440567.1_1 Reverse -165 -179 5.40779 0.103
NP_442497.1_10 Forward -172 -163 10.4228 0.0087
NP_442497.1_10 Reverse -165 -174 10.4228 0.0087
NP_442497.1_10 Reverse -153 -162 0.29472 0.199
NP_440821.1_4 Reverse -162 -172 9.41981 0.0286
NP_440821.1_4 Forward -175 -165 9.41981 0.0286
NP_440821.1_4 Forward -163 -153 6.8632 0.0814
NP_440821.1_4 Reverse -150 -160 -0.511621 0.269
NP_441239.1_9 Reverse -162 -174 5.25052 0.223
NP_441239.1_9 Reverse -150 -162 5.15219 0.227
NP_441239.1_9 Forward -175 -163 3.38223 0.285
NP_441951.1_4 Forward -282 -263 4.22769 0.273
NP_442691.1_6 Reverse -219 -238 21.4356 0.0813
NP_441727.1_3 Forward -180 -161 6.78429 0.24
NP_442643.1_1 Forward -179 -160 -11.3086 0.231
NP_442629.1_3 Forward -156 -137 8.55425 0.198
NP_440833.1_6 Reverse -325 -339 12.0937 0.205
NP_440949.1_7 Reverse -144 -163 13.6666 0.206
NP_441617.1_8 Reverse -314 -333 15.2399 0.124
NP_442138.1_1 Reverse -265 -284 0.293673 0.292
NP_442052.1_8 Reverse -34 -44 11.8781 0.297
NP_440546.1_4 Forward -173 -163 10.046 0.109
NP_440546.1_4 Reverse -164 -174 10.046 0.109
NP_440546.1_4 Reverse -267 -277 8.6886 0.176
NP_440462.1_4 Forward -365 -351 9.14437 0.243
NP_440462.1_6 Reverse -162 -172 9.61647 0.0429
NP_440462.1_6 Forward -175 -165 1.35667 0.294
NP_442465.1_9 Reverse -307 -321 8.35772 0.298
NP_442340.1_3 Forward -62 -43 -10.3253 0.286
NP_440868.1_4 Reverse -160 -172 8.00379 0.0602
NP_440868.1_4 Forward -177 -165 -0.944332 0.284
NP_442479.1_9 Reverse -175 -194 -11.1119 0.273
NP_441269.1_6 Forward -161 -143 15.9488 0.136
NP_441474.1_1 Reverse -237 -256 0.883656 0.253
NP_442402.1_1 Reverse -278 -297 8.94757 0.278
NP_442402.1_4 Reverse -156 -175 -4.52452 0.226
NP_442402.1_4 Reverse -278 -297 -6.98278 0.268
NP_442402.1_10 Reverse -287 -297 14.0409 0.182
NP_440653.1_10 Forward -172 -153 15.2408 0.103
NP_440696.1_3 Forward -316 -298 -1.06249 0.251
NP_440696.1_3 Forward -368 -350 -3.81576 0.29
NP_442039.1_4 Forward -172 -165 15.1821 0.0124
NP_442039.1_4 Reverse -165 -172 15.1821 0.0124
NP_442039.1_7 Forward -267 -257 11.9764 0.257
NP_441811.1_1 Reverse -283 -302 3.83436 0.299
NP_440825.1_7 Reverse -165 -175 12.9096 0.152
NP_442786.1_5 Reverse -132 -151 11.5042 0.141
NP_442837.1_3 Forward -172 -165 15.7721 0.0124
NP_442837.1_3 Reverse -165 -172 15.7721 0.0124
NP_442053.1_1 Forward -173 -164 18.3876 0.0007
NP_442053.1_1 Reverse -164 -173 18.3876 0.0007
NP_442053.1_1 Forward -161 -152 5.21127 0.203
NP_440505.1_3 Reverse -162 -172 18.3679 0.00213
NP_440505.1_3 Forward -175 -165 9.22315 0.122
NP_440505.1_3 Reverse -150 -160 8.82982 0.133
NP_441701.1_3 Forward -367 -350 5.9387 0.295
NP_441102.1_1 Forward -172 -153 3.04771 0.299
NP_441252.1_6 Reverse -33 -40 14.3954 0.168
NP_441203.1_1 Forward -172 -153 -10.3253 0.137
NP_440914.1_1 Forward -173 -163 17.5935 0.000537
NP_440914.1_1 Reverse -164 -174 17.5935 0.000537
NP_440914.1_1 Reverse -307 -317 7.63919 0.228
NP_441011.1_8 Forward -172 -163 8.25953 0.144
NP_441011.1_8 Reverse -165 -174 8.25953 0.144
NP_441011.1_8 Forward -91 -82 5.40793 0.263
NP_442533.1_6 Forward -173 -164 17.2076 0.00137
NP_442533.1_6 Reverse -164 -173 17.2076 0.00137
NP_442533.1_6 Reverse -152 -161 7.96454 0.0838
NP_442232.1_3 Forward -380 -361 -15.4385 0.291
NP_442322.1_4 Reverse -351 -368 0.82479 0.21
NP_442322.1_4 Reverse -361 -378 -6.55 0.277
NP_441482.1_7 Forward -167 -153 -0.0987402 0.0612
NP_441482.1_7 Reverse -158 -172 -0.688726 0.0612
NP_441482.1_7 Forward -179 -165 -10.4235 0.209
NP_439944.1_9 Forward -172 -162 10.5014 0.0887
NP_439944.1_9 Reverse -165 -175 10.5014 0.0887
NP_439944.1_9 Reverse -268 -278 8.53483 0.107
NP_439944.1_9 Reverse -97 -107 4.89658 0.292
NP_441028.1_6 Reverse -277 -287 6.37109 0.23
NP_441028.1_6 Reverse -255 -265 4.7978 0.277
NP_441028.1_6 Reverse -287 -297 3.8145 0.281
NP_440116.1_8 Forward -172 -153 4.62101 0.0698
NP_440116.1_8 Reverse -165 -184 -3.54046 0.154
NP_441527.1_4 Forward -130 -111 -0.716613 0.146
NP_440115.1_6 Reverse -161 -171 16.008 0.0325
NP_440007.1_9 Reverse -160 -174 8.25939 0.18
NP_440007.1_9 Forward -273 -259 0.786239 0.29
NP_441680.1_4 Forward -278 -259 -1.47551 0.262
NP_441972.1_5 Forward -172 -153 7.96426 0.0748
NP_441972.1_5 Reverse -153 -172 4.03102 0.11
NP_441972.1_5 Reverse -165 -184 -7.27704 0.247
NP_441106.1_1 Forward -174 -165 9.63616 0.0311
NP_441106.1_1 Reverse -163 -172 9.63616 0.0311
NP_439903.1_6 Forward -48 -29 0.981987 0.255
NP_001035870.1_3 Forward -184 -165 -2.95047 0.26
NP_441286.1_1 Forward -174 -162 12.9203 0.00815
NP_441286.1_1 Reverse -163 -175 12.9203 0.00815
NP_441286.1_1 Reverse -151 -163 -5.17256 0.192
NP_440670.1_8 Forward -173 -164 18.3876 0.000699
NP_440670.1_8 Reverse -164 -173 18.3876 0.000699
NP_440670.1_8 Forward -161 -152 5.40793 0.158
NP_442908.1_1 Forward -191 -172 7.57094 0.277
NP_440886.1_7 Reverse -151 -161 12.5659 0.0805
NP_440886.1_7 Reverse -237 -247 11.9759 0.0805
NP_440886.1_7 Forward -174 -164 7.94438 0.0805
NP_440886.1_7 Reverse -163 -173 7.94438 0.0805
NP_442614.1_2 Forward -173 -159 9.04604 0.242
NP_442614.1_2 Reverse -35 -49 7.27608 0.275
NP_442382.1_7 Reverse -151 -170 11.5042 0.183
NP_442072.1_9 Forward -93 -75 -13.9439 0.126
NP_442072.1_9 Forward -174 -156 -21.417 0.208
NP_442072.1_9 Forward -337 -319 -22.4986 0.241
NP_442773.2_1 Reverse -30 -49 15.7324 0.219
NP_440907.2_8 Reverse -165 -175 7.64939 0.117
NP_440907.2_8 Reverse -356 -366 4.30615 0.269
NP_440907.2_8 Reverse -239 -249 4.01116 0.283
NP_441021.1_1 Forward -172 -153 4.916 0.0751
NP_441021.1_8 Forward -53 -35 0.805796 0.295
NP_440841.1_4 Reverse -162 -181 0.687771 0.119
NP_441463.1_3 Forward -171 -152 -2.75381 0.16
NP_441463.1_3 Reverse -154 -173 -8.65367 0.272
NP_442842.1_10 Reverse -113 -132 0.465433 0.266
NP_441626.1_2 Forward -172 -165 15.7721 0.0124
NP_441626.1_2 Reverse -165 -172 15.7721 0.0124
NP_441626.1_2 Forward -104 -97 11.1505 0.0716
NP_442794.1_1 Reverse -160 -172 20.0002 0.00523
NP_442794.1_1 Forward -177 -165 19.1152 0.00716
NP_442794.1_1 Reverse -351 -363 6.33216 0.185
NP_442615.1_1 Forward -182 -164 6.50899 0.0344
NP_442615.1_1 Reverse -155 -173 0.314141 0.105
NP_442615.1_1 Forward -170 -152 -7.15901 0.278
NP_441962.1_4 Reverse -159 -178 -12.3902 0.256
NP_441962.1_4 Forward -178 -159 -14.6519 0.291
NP_440387.1_1 Reverse -164 -180 -1.90808 0.145
NP_440387.1_1 Forward -173 -157 -3.28472 0.157
NP_440387.1_1 Forward -161 -145 -4.75968 0.198
NP_440855.1_5 Reverse -156 -175 12.9783 0.161
NP_441431.1_2 Reverse -161 -175 10.422 0.159
NP_441488.1_8 Reverse -159 -173 10.717 0.146
NP_441488.1_8 Forward -178 -164 9.93039 0.146
NP_441836.1_1 Forward -320 -301 12.6681 0.248
NP_441836.1_2 Forward -179 -160 3.93269 0.147
NP_441836.1_2 Forward -384 -365 -4.42544 0.255
NP_441193.1_1 Reverse -352 -371 12.1917 0.229
NP_441993.1_1 Forward -179 -160 8.96362 0.136
NP_441993.1_1 Forward -312 -293 4.18821 0.223
NP_442805.1_5 Reverse -356 -375 1.6703 0.246
NP_440467.1_3 Forward -172 -153 17.6042 0.0604
NP_440467.1_3 Reverse -153 -172 16.5299 0.101
NP_440114.1_10 Forward -161 -147 6.88276 0.253
NP_442437.1_8 Reverse -153 -172 5.80098 0.242
NP_442437.1_8 Forward -172 -153 4.52268 0.259
NP_442323.1_7 Reverse -159 -178 6.78348 0.19
NP_440287.1_6 Forward -94 -75 3.83436 0.208
NP_440293.1_3 Forward -380 -361 7.66927 0.184
NP_441237.1_9 Reverse -165 -175 14.828 0.0242
NP_441979.1_9 Forward -167 -148 4.42435 0.297
NP_442743.1_4 Forward -172 -153 -8.35868 0.291
NP_442930.1_1 Reverse -341 -351 10.501 0.276
NP_442930.1_1 Forward -349 -339 10.1076 0.278
NP_442867.1_8 Forward -308 -289 4.62101 0.278
NP_440457.1_1 Reverse -160 -172 7.61046 0.101
NP_440457.1_1 Forward -165 -153 5.93884 0.134
NP_440457.1_1 Forward -362 -350 5.74217 0.138
NP_441981.1_8 Reverse -142 -156 12.1926 0.28
NP_441332.1_6 Reverse -370 -380 14.0671 0.163
NP_441436.1_2 Forward -298 -279 10.0292 0.163
NP_441436.1_2 Forward -253 -234 -5.11376 0.294
NP_440473.1_9 Forward -375 -356 -5.9004 0.22
NP_442509.1_9 Reverse -152 -162 13.6475 0.0475
NP_442509.1_9 Forward -173 -163 8.14104 0.192
NP_442509.1_9 Reverse -164 -174 8.14104 0.192
NP_442514.1_5 Reverse -156 -175 7.76679 0.107
NP_442514.1_5 Reverse -63 -82 -5.90115 0.263
NP_440554.1_4 Forward -172 -162 8.92815 0.0646
NP_442737.1_5 Forward -174 -155 12.1033 0.265
NP_441885.1_5 Forward -173 -163 20.9245 0.000538
NP_441885.1_5 Reverse -164 -174 20.9245 0.000538
NP_441885.1_5 Reverse -152 -162 -0.0199663 0.186
NP_440478.1_4 Forward -177 -158 21.9273 0.00936
NP_440478.1_10 Forward -175 -161 7.9644 0.257
NP_441428.1_8 Forward -44 -25 14.6508 0.0903
NP_442341.1_7 Reverse -163 -177 17.4042 0.012
NP_442341.1_7 Forward -174 -160 9.2427 0.0751
NP_442341.1_7 Reverse -151 -165 4.42448 0.191
NP_441173.1_9 Reverse -288 -296 12.0154 0.214
NP_441173.1_9 Reverse -257 -265 10.9338 0.242
NP_441173.1_9 Reverse -278 -286 10.1471 0.261
NP_440423.1_6 Forward -246 -227 -13.1769 0.211
NP_440423.1_6 Forward -380 -361 -19.6667 0.243
NP_443000.1_7 Reverse -162 -172 19.9412 0.00223
NP_443000.1_7 Forward -175 -165 10.3048 0.0345
NP_440507.2_3 Forward -170 -151 13.5683 0.145
NP_441842.1_10 Reverse -260 -274 9.93102 0.178
NP_440275.1_3 Reverse -162 -172 15.123 0.0182
NP_440275.1_3 Forward -175 -165 8.04317 0.0602
NP_440275.1_3 Forward -107 -97 7.05986 0.0901
NP_440275.1_3 Forward -94 -84 6.07655 0.126
NP_441307.1_6 Forward -173 -154 9.63589 0.217
NP_440679.1_10 Forward -254 -235 -14.1602 0.226
NP_442451.1_2 Reverse -144 -163 -7.67036 0.237
NP_440149.1_8 Forward -173 -154 2.75272 0.105
NP_440149.1_8 Forward -161 -142 -2.45882 0.171
NP_441105.1_3 Forward -184 -165 12.8808 0.0315
NP_441105.1_3 Reverse -153 -172 -5.60541 0.222
NP_440216.1_1 Forward -173 -159 9.2427 0.00589
NP_440216.1_1 Reverse -164 -178 -10.5218 0.145
NP_440216.1_1 Forward -161 -147 -11.7018 0.212
NP_440216.1_9 Reverse -172 -181 6.39124 0.289
NP_440216.1_9 Forward -53 -44 6.09625 0.289
NP_440172.1_1 Forward -173 -163 15.0247 0.00945
NP_440172.1_1 Reverse -164 -174 15.0247 0.00945
NP_440172.1_1 Reverse -152 -162 3.81494 0.216
NP_442371.1_1 Forward -297 -287 12.4676 0.249
NP_442015.1_10 Reverse -160 -173 21.1604 0.00329
NP_442015.1_10 Forward -177 -164 11.229 0.0372
NP_442015.1_10 Forward -165 -152 7.88576 0.0755
NP_441226.1_7 Forward -172 -165 14.4934 0.0123
NP_441226.1_7 Reverse -165 -172 14.4934 0.0123
NP_441226.1_7 Reverse -350 -357 8.29857 0.205
NP_441111.1_7 Forward -172 -164 18.7023 0.00294
NP_441111.1_7 Reverse -165 -173 18.7023 0.00294
NP_442379.1_10 Reverse -76 -93 -3.69774 0.265
NP_441766.1_2 Forward -173 -164 17.5026 0.00297
NP_441766.1_2 Reverse -164 -173 17.5026 0.00297
NP_442417.1_5 Forward -173 -159 7.37441 0.19
NP_440416.1_9 Reverse -157 -176 2.65439 0.0394
NP_440416.1_9 Forward -168 -149 -5.11376 0.0791
NP_440416.1_9 Forward -180 -161 -7.67036 0.105
NP_440416.1_9 Reverse -348 -367 -18.2901 0.256
NP_443052.1_9 Reverse -361 -380 -4.13045 0.254
NP_442116.1_6 Reverse -317 -334 6.54559 0.276
NP_442154.1_1 Forward -400 -382 -4.20908 0.125
NP_442154.1_1 Forward -150 -132 -17.5821 0.26
NP_440261.1_5 Forward -172 -159 6.80412 0.0316
NP_440261.1_5 Reverse -165 -178 -12.1738 0.272
NP_440988.1_10 Forward -175 -161 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCAAGTTTGCTCTGATTGTTCGGACGGGGCTAGGGAGGGATTGGGATGGGTAATAATTTCCTGGTCAATTTCGTCTGGATTTTTGGCTTCGTTGACCTCGGGCTGGGGAGAATTGGGGGGAAGAACCATAGCCGCTGGGAAAAAACGCTGGACGGGATAGGGGCAACTGGTAGGCCTTGGATAATGATCAGAATCAGCCACCTAGGTGATCTTGGCAATTTTCTTTGGCGATCGCCAGGGGGATTGCCGTCCTTGTTGGGGGTCTAGGCAAAAAACAAAAAACTAAGAATCCGTTGCGACAGCGTGATATGATCGCTTCTGGCTTAGGGTAGGTGGTCCTTGATTACCAAGGAAGACCGTTGCCCAAACTCCATTTCTCACCTTGCTAGTAGTCAGAGT

CDS

GTGACACCGCCAACTCCATCGTCCGAGGGTCAAAATTTTCCTAGTGCTCCTGCCCCGAAGCTTATGGAAGCGGAAACGGTAGTGGATAACGGAATGGCTGACTTTTACCGGTTGCAACGGCAGTTGTTGACCTGGACCCTGGTAGCTACGGCGATAATTTTTGTCTGTGTTGTCTGGGTCTATTCCCTCAATATAGCTTTAAATTATTTGCTCGGAGCACTGGTGGGGCTGGTATATCTCAAGCTATTGGCAAAAGATGTGGAAAGGATCGGAGCCCAGTCTGGGCGGGCTGGGGTGAAAGGCTTAGCAGTTTTTGTTGGGCTCATCATCATTGCCACCCAAAGGGAAAACCTCGAGGTTTTGCCTATTTTTCTGGGATTCCTAACCTATAAAGCTGCGATCATTTTCTATATGCTGCAAAGCGTGTTTACGCCCGCAGCGGATTAG

Protein

MTPPTPSSEGQNFPSAPAPKLMEAETVVDNGMADFYRLQRQLLTWTLVATAIIFVCVVWVYSLNIALNYLLGALVGLVYLKLLAKDVERIGAQSGRAGVKGLAVFVGLIIIATQRENLEVLPIFLGFLTYKAAIIFYMLQSVFTPAAD