Your browser is old and dusty. Try Google Chrome!

Details for sll1319

ORF sll1319
Accession NP_440067.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -137 -151 1.47456 0.188
NP_441061.1_2 Forward -78 -64 1.08123 0.195
NP_441061.1_2 Forward -273 -259 0.589577 0.205
NP_441061.1_2 Reverse -77 -91 -0.983719 0.246
NP_440557.1_1 Forward -84 -65 -0.983855 0.27
NP_440557.1_3 Forward -172 -153 8.35759 0.183
NP_440795.1_7 Forward -273 -266 14.6904 0.0123
NP_440795.1_7 Reverse -266 -273 14.6904 0.0123
NP_441418.1_6 Reverse -76 -95 -12.1936 0.0614
NP_441418.1_6 Reverse -70 -89 -19.8634 0.0979
NP_441418.1_6 Reverse -64 -83 -28.2215 0.203
NP_441418.1_6 Reverse -136 -155 -29.3032 0.221
NP_441418.1_6 Reverse -265 -284 -29.5982 0.23
NP_442291.1_5 Forward -393 -377 -1.41643 0.199
NP_441453.1_1 Forward -281 -263 11.6214 0.112
NP_441453.1_4 Reverse -265 -273 16.539 0.00633
NP_441453.1_4 Forward -274 -266 7.8859 0.0536
NP_441453.1_4 Forward -145 -137 6.80426 0.121
NP_441453.1_4 Reverse -76 -84 6.70593 0.121
NP_441453.1_4 Forward -392 -384 6.70593 0.121
NP_441453.1_4 Reverse -136 -144 6.11594 0.121
NP_441453.1_4 Reverse -199 -207 3.85433 0.284
NP_441960.1_3 Reverse -134 -153 15.9926 0.181
NP_442151.1_6 Forward -274 -260 17.3058 0.0111
NP_442151.1_6 Forward -145 -131 14.4542 0.0349
NP_442151.1_6 Reverse -265 -279 9.5377 0.145
NP_442151.1_6 Forward -85 -71 5.99778 0.253
NP_440561.1_4 Reverse -134 -153 14.864 0.221
NP_441818.1_1 Reverse -266 -277 8.71129 0.28
NP_440226.1_1 Reverse -76 -95 2.75272 0.253
NP_441630.1_3 Reverse -128 -147 1.67108 0.239
NP_442173.1_1 Forward -273 -265 15.4574 0.00633
NP_442173.1_1 Reverse -266 -274 14.1791 0.0165
NP_442173.1_1 Reverse -137 -145 12.0158 0.0316
NP_442173.1_1 Reverse -384 -392 5.82095 0.2
NP_442173.1_1 Forward -84 -76 5.82095 0.2
NP_442173.1_1 Forward -144 -136 4.83764 0.241
NP_442752.1_4 Forward -392 -385 13.8055 0.0199
NP_442752.1_4 Reverse -265 -272 13.8055 0.0199
NP_442752.1_4 Forward -145 -138 13.8055 0.0199
NP_442752.1_4 Reverse -76 -83 13.8055 0.0199
NP_442752.1_4 Reverse -199 -206 5.25066 0.256
NP_443027.1_4 Forward -394 -384 10.1081 0.144
NP_443027.1_4 Forward -276 -266 8.33817 0.207
NP_443027.1_4 Forward -147 -137 6.66654 0.274
NP_443027.1_4 Forward -87 -77 6.07655 0.294
NP_441812.1_3 Reverse -264 -278 7.47274 0.272
NP_442975.1_10 Forward -40 -26 8.94708 0.0821
NP_442975.1_10 Reverse -379 -393 3.14559 0.263
NP_442975.1_10 Reverse -132 -146 3.14559 0.263
NP_442975.1_10 Forward -89 -75 2.75226 0.269
NP_441675.1_4 Reverse -228 -247 3.24438 0.277
NP_440784.1_7 Forward -273 -266 15.9687 0.0123
NP_440784.1_7 Reverse -266 -273 15.9687 0.0123
NP_440784.1_7 Reverse -384 -391 6.23397 0.241
NP_440784.1_7 Forward -144 -137 6.23397 0.241
NP_440784.1_7 Forward -84 -77 6.23397 0.241
NP_440784.1_7 Forward -391 -384 6.13563 0.241
NP_440784.1_7 Reverse -137 -144 6.13563 0.241
NP_440784.1_7 Reverse -77 -84 6.13563 0.241
NP_441250.1_3 Reverse -214 -233 5.11266 0.241
NP_440110.1_7 Reverse -132 -151 11.0125 0.289
NP_441476.1_5 Reverse -174 -193 9.43923 0.0933
NP_442062.1_8 Reverse -265 -275 16.9913 0.00317
NP_442062.1_8 Reverse -199 -209 10.4031 0.0493
NP_442062.1_8 Reverse -76 -86 9.22315 0.0658
NP_442062.1_8 Forward -274 -264 7.84651 0.0871
NP_440304.1_4 Forward -147 -137 10.2065 0.051
NP_440304.1_4 Forward -276 -266 9.12481 0.0626
NP_440304.1_4 Reverse -107 -117 5.48657 0.206
NP_440304.1_4 Reverse -171 -181 4.99491 0.239
NP_440304.1_4 Reverse -263 -273 1.84832 0.299
NP_442242.1_4 Forward -273 -266 14.3954 0.0124
NP_442242.1_4 Reverse -266 -273 14.3954 0.0124
NP_442242.1_4 Reverse -77 -84 12.4288 0.0393
NP_442242.1_4 Forward -391 -384 12.4288 0.0393
NP_440044.1_8 Forward -84 -65 -1.47551 0.246
NP_440011.1_1 Forward -183 -164 11.1109 0.286
NP_441208.1_9 Reverse -133 -147 5.99778 0.254
NP_441594.1_6 Reverse -170 -189 16.1257 0.0903
NP_441594.1_6 Reverse -67 -86 0.982764 0.276
NP_440132.1_1 Reverse -263 -281 10.1472 0.223
NP_442110.1_7 Forward -145 -131 5.60446 0.168
NP_442110.1_7 Reverse -136 -150 3.63784 0.21
NP_441083.1_5 Forward -274 -264 10.9931 0.017
NP_441083.1_5 Reverse -265 -275 9.61647 0.0243
NP_441083.1_5 Reverse -136 -146 8.73149 0.0307
NP_441083.1_5 Forward -145 -135 7.05986 0.067
NP_441083.1_5 Reverse -383 -393 0.865012 0.218
NP_442827.1_8 Reverse -128 -147 4.81688 0.129
NP_442827.1_8 Reverse -171 -190 2.85027 0.155
NP_442827.1_8 Forward -153 -134 -0.689632 0.234
NP_441434.1_7 Reverse -385 -399 3.14618 0.259
NP_441738.1_2 Reverse -385 -392 15.28 0.0102
NP_441738.1_2 Forward -272 -265 15.28 0.0102
NP_441738.1_2 Reverse -138 -145 15.28 0.0102
NP_441738.1_2 Forward -83 -76 15.28 0.0102
NP_441738.1_2 Reverse -267 -274 11.5435 0.084
NP_441558.1_5 Forward -276 -257 7.86593 0.167
NP_441558.1_5 Forward -147 -128 5.99764 0.232
NP_440209.1_1 Reverse -265 -273 18.1123 0.00295
NP_440209.1_1 Forward -392 -384 14.8674 0.012
NP_440209.1_1 Reverse -76 -84 14.8674 0.012
NP_440209.1_1 Forward -145 -137 8.57422 0.0425
NP_440209.1_1 Forward -274 -266 8.47588 0.0457
NP_440209.1_1 Reverse -383 -391 5.62429 0.0821
NP_440209.1_1 Reverse -136 -144 5.52596 0.0821
NP_442889.1_8 Forward -277 -263 10.3237 0.0864
NP_441713.1_1 Forward -280 -261 -12.2919 0.244
NP_441770.1_4 Forward -391 -372 -5.01543 0.204
NP_442706.1_5 Reverse -207 -226 14.2087 0.245
NP_441792.1_2 Forward -117 -104 16.8339 0.288
NP_442111.1_4 Reverse -135 -149 17.8958 0.00908
NP_442111.1_4 Reverse -264 -278 8.84938 0.0677
NP_441624.1_7 Reverse -136 -150 6.98109 0.272
NP_440906.1_5 Forward -273 -266 15.8704 0.0124
NP_440906.1_5 Reverse -266 -273 15.8704 0.0124
NP_440906.1_5 Forward -391 -384 12.0355 0.0724
NP_440906.1_5 Forward -84 -77 12.0355 0.0724
NP_440906.1_5 Reverse -384 -391 12.0355 0.0724
NP_440906.1_5 Reverse -77 -84 12.0355 0.0724
NP_440906.1_5 Forward -144 -137 6.23397 0.234
NP_440906.1_5 Reverse -137 -144 6.13563 0.241
NP_440747.1_10 Reverse -262 -274 14.9853 0.00221
NP_440747.1_10 Forward -277 -265 -2.02597 0.0196
NP_440747.1_10 Forward -148 -136 -11.6624 0.131
NP_440747.1_10 Reverse -380 -392 -12.2524 0.254
NP_440747.1_10 Forward -199 -187 -12.5474 0.297
NP_441130.1_7 Forward -187 -173 16.9119 0.287
NP_441130.1_10 Forward -394 -380 10.521 0.112
NP_441130.1_10 Reverse -381 -395 9.73436 0.12
NP_441130.1_10 Forward -190 -176 5.60446 0.223
NP_442973.1_5 Reverse -55 -74 9.93088 0.287
NP_441486.1_1 Reverse -262 -276 4.91614 0.0399
NP_441486.1_1 Forward -277 -263 3.53951 0.0575
NP_441486.1_1 Forward -88 -74 2.06454 0.0918
NP_441486.1_1 Forward -211 -197 0.786239 0.126
NP_441486.1_1 Forward -185 -171 -2.65535 0.175
NP_441486.1_1 Reverse -196 -210 -5.50694 0.242
NP_442634.1_4 Reverse -134 -148 3.8345 0.0946
NP_442634.1_4 Reverse -263 -277 -2.06536 0.149
NP_441265.1_3 Forward -280 -266 7.57108 0.181
NP_442848.1_5 Forward -313 -295 2.87075 0.276
NP_441012.1_4 Reverse -32 -45 18.2105 0.104
NP_441012.1_4 Reverse -382 -395 9.45906 0.272
NP_443018.1_3 Forward -273 -266 14.8871 0.0123
NP_443018.1_3 Reverse -266 -273 14.8871 0.0123
NP_443018.1_3 Reverse -137 -144 11.7405 0.0655
NP_443018.1_3 Forward -144 -137 5.44732 0.193
NP_443018.1_3 Forward -391 -384 5.34899 0.212
NP_443018.1_3 Forward -84 -77 5.34899 0.212
NP_443018.1_3 Reverse -384 -391 5.34899 0.212
NP_443018.1_3 Reverse -77 -84 5.34899 0.212
NP_441316.1_7 Forward -276 -261 6.07642 0.107
NP_441316.1_7 Reverse -134 -149 -3.46169 0.277
NP_441634.1_8 Reverse -381 -395 -4.03198 0.295
NP_440376.1_1 Reverse -265 -274 9.73449 0.0365
NP_440376.1_1 Forward -274 -265 9.63616 0.0385
NP_440376.1_1 Forward -145 -136 5.99792 0.111
NP_440376.1_1 Reverse -109 -118 4.32629 0.163
NP_440376.1_1 Forward -392 -383 -0.000272808 0.285
NP_440376.1_1 Reverse -76 -85 -0.000272808 0.285
NP_440376.1_1 Reverse -383 -392 -0.0986038 0.285
NP_440376.1_1 Forward -85 -76 -0.0986038 0.285
NP_440376.1_1 Reverse -136 -145 -0.196935 0.285
NP_441857.1_5 Forward -399 -381 3.26407 0.246
NP_441588.1_4 Forward -272 -262 9.02648 0.14
NP_441588.1_4 Forward -83 -73 6.96153 0.178
NP_441588.1_4 Reverse -385 -395 6.96153 0.178
NP_442687.1_7 Forward -275 -265 8.92815 0.0994
NP_442687.1_7 Reverse -198 -208 6.96153 0.147
NP_442687.1_7 Reverse -135 -145 5.97822 0.179
NP_442687.1_7 Reverse -29 -39 5.68323 0.189
NP_442687.1_7 Forward -393 -383 5.19158 0.217
NP_442191.1_4 Reverse -137 -151 13.0292 0.17
NP_442946.1_7 Reverse -12 -27 14.3468 0.284
NP_440042.1_2 Reverse -373 -392 -3.14714 0.276
NP_441422.1_7 Forward -190 -173 1.8088 0.118
NP_441029.1_5 Reverse -216 -235 11.3286 0.273
NP_440667.1_2 Forward -352 -333 -5.50708 0.261
NP_442296.1_9 Reverse -130 -149 -4.6221 0.28
NP_441763.1_10 Reverse -168 -187 10.9134 0.143
NP_442658.1_1 Forward -276 -266 12.9592 0.0423
NP_442658.1_1 Reverse -381 -391 11.5826 0.0787
NP_442658.1_1 Forward -87 -77 10.6976 0.11
NP_442658.1_1 Forward -394 -384 8.92768 0.172
NP_442658.1_1 Reverse -263 -273 6.76441 0.214
NP_442658.1_1 Reverse -134 -144 5.87944 0.246
NP_442198.1_3 Forward -194 -175 5.11266 0.26
NP_442205.1_9 Reverse -303 -319 -3.77637 0.295
NP_440656.1_2 Reverse -152 -171 9.0459 0.149
NP_441414.1_9 Forward -274 -255 -1.67217 0.103
NP_441414.1_9 Forward -145 -126 -5.60541 0.178
NP_440800.1_7 Reverse -58 -72 10.9143 0.294
NP_441487.1_6 Reverse -150 -169 -1.47551 0.285
NP_442937.1_5 Reverse -174 -193 6.19431 0.286
NP_441958.1_1 Forward -169 -150 12.0775 0.295
NP_441958.1_5 Forward -275 -265 10.6981 0.0112
NP_441958.1_5 Forward -146 -136 9.81313 0.0174
NP_441958.1_5 Reverse -264 -274 3.12662 0.0364
NP_441958.1_5 Reverse -75 -85 2.53664 0.0409
NP_441958.1_5 Reverse -135 -145 0.865012 0.12
NP_441958.1_5 Reverse -198 -208 -0.314959 0.198
NP_441958.1_5 Forward -393 -383 -6.41148 0.28
NP_441127.1_1 Reverse -303 -317 10.9143 0.239
NP_441127.1_1 Reverse -148 -162 9.5377 0.272
NP_440203.1_5 Reverse -139 -149 14.9258 0.0886
NP_440203.1_5 Forward -82 -72 12.5659 0.146
NP_440203.1_5 Forward -271 -261 11.8776 0.171
NP_440203.1_5 Forward -244 -234 8.43603 0.299
NP_443001.1_7 Reverse -52 -71 1.76941 0.279
NP_440984.1_7 Forward -397 -383 6.48943 0.214
NP_441162.1_3 Forward -149 -130 8.75091 0.254
NP_441097.1_2 Reverse -60 -77 14.0018 0.135
NP_439990.1_5 Reverse -260 -273 17.4239 0.0249
NP_439990.1_5 Forward -279 -266 6.21414 0.249
NP_442376.1_2 Reverse -131 -150 -11.6036 0.286
NP_442911.1_2 Forward -95 -76 4.12936 0.0397
NP_442911.1_2 Forward -284 -265 -3.3438 0.111
NP_442911.1_2 Reverse -255 -274 -4.6221 0.138
NP_442911.1_2 Reverse -126 -145 -5.60541 0.163
NP_440153.1_8 Forward -312 -299 -2.34066 0.235
NP_442064.1_1 Reverse -260 -279 -1.86883 0.146
NP_443055.1_6 Reverse -375 -393 -0.178247 0.254
NP_443055.1_6 Forward -39 -21 -1.84987 0.284
NP_440993.1_2 Forward -150 -134 1.23851 0.286
NP_440993.1_3 Reverse -126 -145 1.76863 0.225
NP_440827.1_3 Reverse -131 -150 12.6841 0.246
NP_440138.1_6 Forward -207 -188 2.85027 0.259
NP_441099.1_5 Reverse -126 -145 2.16274 0.0581
NP_442002.1_9 Forward -393 -386 10.7572 0.185
NP_442002.1_9 Reverse -98 -105 9.77388 0.258
NP_442002.1_9 Reverse -178 -185 9.08556 0.289
NP_441294.1_7 Reverse -132 -146 9.63458 0.236
NP_442438.1_10 Forward -44 -30 9.73436 0.0602
NP_442438.1_10 Forward -397 -383 1.57289 0.191
NP_441000.1_6 Reverse -382 -396 5.40779 0.0933
NP_441000.1_6 Forward -393 -379 5.1128 0.0933
NP_441000.1_6 Forward -345 -331 -5.31028 0.273
NP_442771.1_1 Reverse -134 -152 -5.09406 0.166
NP_442771.1_1 Reverse -28 -46 -8.43732 0.193
NP_441110.1_1 Reverse -304 -323 3.04771 0.297
NP_440147.1_4 Reverse -263 -276 2.2809 0.209
NP_440147.1_4 Forward -147 -134 2.2809 0.209
NP_441550.1_8 Reverse -134 -144 15.2208 0.0132
NP_441550.1_8 Reverse -263 -273 14.6309 0.0132
NP_441550.1_8 Forward -276 -266 12.1726 0.0361
NP_441550.1_8 Forward -147 -137 11.7793 0.0435
NP_441550.1_8 Reverse -74 -84 5.97777 0.22
NP_441916.1_7 Reverse -265 -275 7.55152 0.0639
NP_441916.1_7 Forward -208 -198 4.99491 0.15
NP_441916.1_7 Reverse -109 -119 4.40493 0.178
NP_441916.1_7 Forward -274 -264 2.04498 0.265
NP_441916.1_7 Forward -85 -75 1.16001 0.293
NP_441916.1_7 Reverse -136 -146 1.06167 0.294
NP_440206.1_4 Reverse -131 -150 -1.57461 0.292
NP_441041.1_4 Reverse -136 -155 4.32602 0.0588
NP_441041.1_4 Reverse -64 -83 -2.85214 0.117
NP_441041.1_4 Reverse -297 -316 -11.4069 0.246
NP_441041.1_4 Reverse -265 -284 -13.0786 0.28
NP_441041.1_7 Reverse -380 -392 11.4019 0.0813
NP_441041.1_7 Reverse -133 -145 9.55551 0.109
NP_441041.1_7 Forward -395 -383 8.87526 0.128
NP_441041.1_7 Forward -277 -265 8.09784 0.147
NP_440569.1_6 Reverse -55 -74 4.71934 0.24
NP_442004.1_6 Reverse -136 -150 8.25939 0.145
NP_441725.1_4 Forward -150 -136 4.32555 0.278
NP_441725.1_5 Reverse -266 -276 19.7446 0.0112
NP_441725.1_5 Forward -144 -134 7.05986 0.106
NP_441725.1_5 Forward -273 -263 2.04498 0.115
NP_441725.1_5 Forward -207 -197 1.94665 0.115
NP_441725.1_5 Reverse -137 -147 1.35667 0.137
NP_441725.1_5 Reverse -77 -87 0.176696 0.206
NP_441725.1_5 Forward -181 -171 -0.511621 0.26
NP_441725.1_5 Reverse -384 -394 -0.708283 0.267
NP_439966.1_7 Reverse -381 -391 9.71433 0.104
NP_439966.1_7 Reverse -134 -144 7.84605 0.149
NP_439966.1_7 Forward -394 -384 7.64939 0.15
NP_439966.1_7 Reverse -263 -273 7.25606 0.15
NP_439966.1_7 Forward -87 -77 6.96107 0.16
NP_439966.1_7 Forward -276 -266 6.56775 0.177
NP_439966.1_7 Forward -147 -137 5.09279 0.243
NP_439966.1_9 Forward -394 -385 10.7178 0.0863
NP_442941.1_3 Forward -273 -263 11.0914 0.0116
NP_442941.1_3 Reverse -137 -147 10.1081 0.024
NP_442941.1_3 Reverse -266 -276 1.94665 0.147
NP_442941.1_3 Forward -84 -74 1.35667 0.15
NP_440289.1_2 Forward -277 -264 4.05085 0.0718
NP_440289.1_2 Reverse -133 -146 3.95252 0.0733
NP_440289.1_2 Reverse -380 -393 3.85419 0.0735
NP_440289.1_2 Forward -395 -382 1.88757 0.112
NP_440289.1_2 Forward -148 -135 -4.30728 0.286
NP_441514.1_4 Reverse -226 -245 13.765 0.26
NP_441514.1_6 Reverse -236 -243 12.8221 0.252
NP_442281.1_1 Forward -213 -199 12.8803 0.033
NP_442281.1_1 Reverse -131 -145 8.25877 0.0832
NP_442281.1_1 Reverse -260 -274 7.07881 0.108
NP_442281.1_1 Reverse -194 -208 4.52221 0.192
NP_442281.1_1 Forward -279 -265 3.34225 0.235
NP_442281.1_1 Reverse -378 -392 2.65393 0.26
NP_441334.1_7 Reverse -134 -153 -9.34199 0.12
NP_441079.1_7 Reverse -245 -264 -5.31116 0.264
NP_441079.1_7 Forward -247 -228 -6.09781 0.271
NP_442256.1_2 Forward -276 -258 -6.27403 0.214
NP_442256.1_2 Reverse -134 -152 -7.35568 0.214
NP_440437.1_1 Forward -127 -108 -1.7705 0.205
NP_440437.1_1 Reverse -21 -40 -2.0655 0.21
NP_440437.1_1 Reverse -334 -353 -2.85214 0.227
NP_440437.1_1 Reverse -377 -396 -5.50708 0.286
NP_442500.1_8 Reverse -217 -231 8.63588 0.291
NP_440498.1_1 Forward -94 -76 -2.43913 0.241
NP_441644.1_6 Reverse -136 -146 16.1058 0.0048
NP_441644.1_6 Reverse -265 -275 13.2542 0.0212
NP_441644.1_6 Forward -118 -108 11.3859 0.0502
NP_441644.1_6 Forward -274 -264 8.04271 0.11
NP_441644.1_6 Reverse -76 -86 3.32285 0.288
NP_443049.1_6 Forward -146 -136 12.3241 0.24
NP_443049.1_6 Reverse -264 -274 11.2506 0.269
NP_440867.1_3 Forward -186 -167 8.45592 0.262
NP_442215.1_2 Reverse -263 -279 3.10679 0.102
NP_442177.1_5 Reverse -67 -81 7.76774 0.293
NP_442029.1_1 Forward -394 -375 -20.3551 0.297
NP_442029.1_6 Reverse -182 -201 5.40766 0.25
NP_440253.1_2 Reverse -309 -327 -2.93078 0.28
NP_440929.1_8 Forward -274 -265 17.4043 0.00289
NP_440929.1_8 Reverse -265 -274 17.4043 0.00289
NP_440929.1_8 Forward -85 -76 7.86621 0.0522
NP_440929.1_8 Reverse -76 -85 7.57121 0.0706
NP_440929.1_8 Reverse -136 -145 7.07956 0.0713
NP_440566.1_2 Forward -155 -136 8.25926 0.205
NP_442933.1_10 Reverse -265 -274 9.04618 0.063
NP_442933.1_10 Forward -274 -265 8.94785 0.0643
NP_442933.1_10 Reverse -76 -85 5.40793 0.19
NP_442933.1_10 Forward -392 -383 5.40793 0.19
NP_442933.1_10 Forward -208 -199 4.42462 0.246
NP_441751.2_8 Forward -273 -259 4.81781 0.0464
NP_441751.2_8 Reverse -266 -280 3.04785 0.0737
NP_441751.2_8 Reverse -137 -151 -2.95034 0.134
NP_442554.1_8 Forward -273 -263 15.3197 0.00882
NP_442554.1_8 Reverse -266 -276 11.4848 0.0355
NP_442554.1_8 Reverse -336 -346 7.55152 0.0893
NP_442554.1_8 Reverse -137 -147 7.15819 0.0975
NP_442554.1_8 Forward -84 -74 6.66654 0.111
NP_442554.1_8 Reverse -384 -394 6.27322 0.123
NP_442554.1_8 Forward -144 -134 5.09324 0.161
NP_442554.1_8 Forward -207 -197 3.91327 0.203
NP_441762.1_7 Forward -393 -381 4.36554 0.0504
NP_441762.1_7 Reverse -382 -394 4.36554 0.0504
NP_441762.1_7 Forward -275 -263 1.51394 0.0747
NP_441762.1_7 Forward -146 -134 -4.9759 0.185
NP_441762.1_7 Reverse -178 -190 -5.56589 0.217
NP_442142.1_4 Reverse -380 -393 19.3898 0.0251
NP_442142.1_4 Forward -277 -264 8.18017 0.12
NP_442142.1_4 Reverse -133 -146 6.60689 0.16
NP_442142.1_4 Reverse -196 -209 3.65697 0.248
NP_442142.1_4 Forward -395 -382 3.46031 0.255
NP_442142.1_4 Forward -154 -141 2.772 0.278
NP_442292.1_1 Forward -273 -264 18.486 0.00229
NP_442292.1_1 Reverse -266 -275 8.94785 0.0261
NP_442292.1_1 Forward -84 -75 7.76787 0.0615
NP_442292.1_1 Reverse -137 -146 7.66954 0.0634
NP_442292.1_1 Reverse -384 -393 -0.0986038 0.239
NP_442292.1_1 Reverse -77 -86 -0.786921 0.287
NP_442476.1_6 Reverse -266 -280 2.06454 0.195
NP_440895.1_6 Reverse -259 -272 12.999 0.202
NP_440895.1_10 Reverse -382 -399 12.0352 0.0554
NP_442381.1_8 Forward -395 -376 5.99764 0.0616
NP_443009.1_5 Reverse -264 -275 14.7094 0.02
NP_443009.1_5 Reverse -75 -86 8.71129 0.102
NP_443009.1_5 Reverse -198 -209 6.25303 0.169
NP_443009.1_5 Reverse -29 -40 5.85971 0.185
NP_441715.1_4 Forward -273 -263 7.94484 0.107
NP_441715.1_4 Reverse -137 -147 4.40493 0.281
NP_441198.1_8 Reverse -197 -207 12.783 0.116
NP_441198.1_8 Forward -276 -266 11.6111 0.193
NP_440464.1_10 Forward -273 -263 13.0082 0.169
NP_440464.1_10 Forward -103 -93 12.4352 0.225
NP_441468.1_1 Forward -273 -266 15.8704 0.0124
NP_441468.1_1 Reverse -266 -273 15.8704 0.0124
NP_441468.1_1 Reverse -384 -391 6.13563 0.209
NP_441468.1_1 Forward -144 -137 6.13563 0.209
NP_441468.1_1 Forward -84 -77 6.13563 0.209
NP_441468.1_1 Reverse -137 -144 6.0373 0.223
NP_441468.1_1 Reverse -77 -84 6.0373 0.223
NP_441468.1_1 Forward -391 -384 6.0373 0.223
NP_441468.1_1 Forward -207 -200 3.97235 0.277
NP_441020.2_6 Reverse -134 -151 10.0686 0.154
NP_441015.1_10 Forward -150 -131 -4.72043 0.211
NP_441015.1_10 Reverse -298 -317 -8.45701 0.273
NP_441673.1_1 Reverse -265 -274 11.1111 0.0121
NP_441673.1_1 Forward -274 -265 11.0128 0.018
NP_441673.1_1 Forward -145 -136 1.37636 0.114
NP_441673.1_1 Forward -392 -383 1.27803 0.155
NP_441673.1_1 Reverse -383 -392 1.27803 0.155
NP_441673.1_1 Forward -85 -76 1.27803 0.155
NP_441673.1_1 Reverse -76 -85 1.27803 0.155
NP_441673.1_1 Reverse -136 -145 1.1797 0.163
NP_441731.1_3 Forward -153 -134 -5.11376 0.284
NP_441826.1_2 Reverse -130 -144 12.9793 0.0241
NP_441826.1_2 Reverse -30 -44 -0.787057 0.224
NP_441826.1_2 Reverse -193 -207 -4.13031 0.292
NP_442490.1_9 Reverse -64 -83 2.75272 0.165
NP_442868.1_6 Reverse -263 -273 9.81313 0.038
NP_442868.1_6 Reverse -134 -144 6.66654 0.103
NP_442868.1_6 Forward -351 -341 4.79825 0.165
NP_442868.1_6 Reverse -381 -391 0.275027 0.243
NP_442868.1_6 Forward -276 -266 0.275027 0.243
NP_442227.1_2 Forward -348 -329 -3.54046 0.293
NP_442227.1_2 Forward -186 -167 -3.54046 0.293
NP_442227.1_2 Forward -316 -297 -3.83545 0.298
NP_442361.1_3 Forward -151 -138 18.1122 0.0481
NP_442808.1_1 Reverse -382 -392 17.5808 0.00507
NP_442808.1_1 Reverse -135 -145 9.71433 0.0481
NP_442808.1_1 Forward -86 -76 8.53436 0.0493
NP_441101.1_10 Forward -189 -170 2.94938 0.173
NP_441101.1_10 Reverse -261 -280 -5.70374 0.285
NP_440145.1_3 Reverse -255 -274 -2.36049 0.168
NP_442542.1_2 Reverse -134 -147 7.19745 0.19
NP_442542.1_9 Reverse -328 -342 12.8803 0.108
NP_442050.1_5 Forward -276 -266 15.2208 0.0133
NP_442050.1_5 Reverse -134 -144 11.7793 0.0832
NP_442050.1_5 Forward -147 -137 8.3377 0.234
NP_442050.1_5 Reverse -263 -273 7.64939 0.243
NP_442342.1_9 Reverse -134 -150 23.8546 0.0161
NP_440558.1_2 Forward -88 -69 -4.22878 0.243
NP_440558.1_2 Forward -283 -264 -4.72043 0.248
NP_440558.1_2 Reverse -27 -46 -7.67036 0.298
NP_442789.1_4 Reverse -134 -153 -7.57203 0.298
NP_441878.1_6 Forward -275 -265 10.4031 0.0176
NP_441878.1_6 Reverse -264 -274 0.668351 0.139
NP_441878.1_6 Reverse -135 -145 0.57002 0.14
NP_441878.1_6 Reverse -198 -208 -0.314959 0.174
NP_441878.1_6 Reverse -29 -39 -0.314959 0.174
NP_441878.1_6 Reverse -172 -182 -6.90313 0.198
NP_441878.1_6 Reverse -108 -118 -7.88644 0.278
NP_441036.1_8 Forward -86 -76 15.2213 0.0116
NP_441036.1_8 Reverse -382 -392 13.8447 0.0353
NP_441036.1_8 Reverse -168 -178 10.8948 0.148
NP_441036.1_8 Forward -275 -265 7.45319 0.197
NP_442503.1_9 Reverse -141 -160 5.70265 0.272
NP_441557.1_5 Forward -274 -265 17.4043 0.0023
NP_441557.1_5 Reverse -265 -274 10.8161 0.00464
NP_441557.1_5 Forward -85 -76 7.66954 0.0443
NP_441557.1_5 Forward -145 -136 1.08137 0.0794
NP_441557.1_5 Forward -392 -383 0.983037 0.0911
NP_441557.1_5 Reverse -76 -85 0.983037 0.0911
NP_441557.1_5 Reverse -383 -392 0.688044 0.128
NP_441557.1_5 Reverse -136 -145 0.589713 0.134
NP_441557.1_5 Reverse -199 -208 -0.885252 0.26
NP_441557.1_8 Forward -343 -333 14.0409 0.201
NP_441445.1_1 Forward -361 -342 2.85105 0.226
NP_441445.1_1 Forward -283 -264 2.45773 0.233
NP_442419.1_2 Reverse -174 -193 -0.0988766 0.243
NP_441308.1_8 Forward -147 -137 11.6814 0.22
NP_440101.1_5 Forward -281 -262 5.89931 0.196
NP_442183.1_1 Reverse -76 -90 11.5043 0.0702
NP_442183.1_1 Reverse -265 -279 10.816 0.0784
NP_442183.1_1 Forward -145 -131 6.19444 0.184
NP_442166.1_7 Reverse -137 -151 9.73436 0.19
NP_440979.1_3 Reverse -77 -95 21.5536 0.0967
NP_441574.1_1 Reverse -64 -83 4.71934 0.13
NP_441574.1_1 Forward -200 -181 -4.42544 0.252
NP_441549.1_9 Forward -186 -168 -3.22577 0.198
NP_441549.1_9 Forward -353 -335 -9.91228 0.265
NP_441549.1_9 Reverse -132 -150 -10.1089 0.269
NP_441467.1_5 Reverse -96 -106 17.0896 0.213
NP_440540.1_8 Forward -357 -338 8.06259 0.254
NP_442347.1_2 Forward -273 -264 12.4878 0.056
NP_441037.1_4 Forward -394 -384 15.2117 0.028
NP_441037.1_4 Reverse -74 -84 13.9448 0.0515
NP_441037.1_4 Forward -276 -266 8.58464 0.237
NP_441037.1_4 Reverse -263 -273 7.9999 0.237
NP_441633.1_3 Reverse -381 -394 5.62415 0.0481
NP_441633.1_3 Reverse -263 -276 0.805932 0.115
NP_440136.1_2 Forward -273 -266 15.9687 0.0123
NP_440136.1_2 Reverse -266 -273 15.9687 0.0123
NP_440136.1_2 Forward -144 -137 6.23397 0.171
NP_440136.1_2 Forward -84 -77 6.23397 0.171
NP_440136.1_2 Reverse -384 -391 6.23397 0.171
NP_440136.1_2 Forward -391 -384 6.13563 0.193
NP_440136.1_2 Reverse -137 -144 6.13563 0.193
NP_440136.1_2 Reverse -77 -84 6.13563 0.193
NP_440136.1_2 Reverse -341 -348 4.16902 0.234
NP_442590.1_10 Reverse -109 -128 8.16093 0.213
NP_442998.1_10 Reverse -385 -392 15.5754 0.0102
NP_442998.1_10 Forward -272 -265 15.5754 0.0102
NP_442998.1_10 Reverse -138 -145 15.5754 0.0102
NP_442998.1_10 Forward -83 -76 15.5754 0.0102
NP_442998.1_10 Reverse -267 -274 5.84064 0.235
NP_440899.1_1 Reverse -176 -195 6.16283 0.287
NP_440899.1_5 Reverse -333 -352 3.73603 0.257
NP_440899.1_8 Forward -232 -213 -7.96535 0.246
NP_440299.1_1 Forward -278 -265 7.88518 0.103
NP_440299.1_1 Reverse -261 -274 4.05029 0.221
NP_440299.1_1 Forward -89 -76 3.7553 0.232
NP_441799.1_1 Reverse -261 -275 9.04542 0.1
NP_441799.1_1 Forward -278 -264 6.0955 0.183
NP_441007.1_10 Forward -354 -341 6.31247 0.167
NP_441007.1_10 Reverse -260 -273 1.59258 0.203
NP_441007.1_10 Forward -279 -266 1.10092 0.209
NP_441007.1_10 Forward -397 -384 1.00259 0.209
NP_441007.1_10 Reverse -71 -84 0.707601 0.219
NP_441007.1_10 Reverse -131 -144 -0.669033 0.287
NP_442201.1_10 Reverse -65 -84 -8.55534 0.221
NP_441118.1_10 Forward -21 -3 13.9821 0.246
NP_441559.1_8 Forward -201 -187 -6.78525 0.279
NP_440915.1_6 Forward -149 -135 10.0294 0.0357
NP_440915.1_6 Reverse -132 -146 5.70279 0.0879
NP_440915.1_6 Forward -200 -186 3.63784 0.101
NP_440915.1_6 Forward -212 -198 -2.65535 0.278
NP_441179.1_1 Forward -42 -23 16.6174 0.0238
NP_441866.1_6 Forward -75 -56 8.55343 0.258
NP_441939.1_3 Forward -144 -125 7.47261 0.201
NP_441939.1_3 Forward -343 -324 6.88262 0.22
NP_442957.1_4 Reverse -134 -153 16.2241 0.139
NP_442993.1_1 Forward -392 -376 -5.448 0.146
NP_442993.1_1 Reverse -265 -281 -7.61128 0.146
NP_440677.1_3 Reverse -167 -185 9.85225 0.262
NP_442386.1_9 Reverse -264 -273 13.8639 0.0289
NP_442386.1_9 Forward -152 -143 12.094 0.075
NP_442386.1_9 Forward -209 -200 10.029 0.142
NP_442386.1_9 Reverse -382 -391 8.06244 0.209
NP_442386.1_9 Forward -393 -384 5.89917 0.233
NP_442386.1_9 Forward -275 -266 5.11253 0.266
NP_442386.1_9 Forward -86 -77 4.81753 0.282
NP_442386.1_9 Reverse -135 -144 4.52254 0.297
NP_440570.1_5 Reverse -60 -79 12.3892 0.132
NP_440570.1_5 Reverse -132 -151 -2.75381 0.28
NP_441340.1_5 Forward -273 -266 15.6737 0.0124
NP_441340.1_5 Reverse -266 -273 15.6737 0.0124
NP_441340.1_5 Forward -144 -137 13.5105 0.0314
NP_441340.1_5 Forward -391 -384 6.13563 0.175
NP_441340.1_5 Reverse -77 -84 6.13563 0.175
NP_441340.1_5 Reverse -384 -391 5.93897 0.198
NP_441340.1_5 Forward -84 -77 5.93897 0.198
NP_441340.1_5 Reverse -137 -144 5.84064 0.208
NP_441271.1_1 Forward -280 -262 11.6214 0.239
NP_441271.1_8 Reverse -144 -154 14.6313 0.266
NP_441947.1_4 Reverse -162 -181 14.7491 0.167
NP_440168.1_9 Reverse -134 -153 -2.36049 0.28
NP_440327.1_8 Reverse -58 -77 14.6508 0.264
NP_440161.1_10 Reverse -329 -348 15.013 0.288
NP_442714.1_4 Reverse -98 -117 18.9773 0.0889
NP_440586.1_8 Forward -273 -266 13.2151 0.026
NP_440586.1_8 Reverse -266 -273 13.2151 0.026
NP_440586.1_8 Forward -391 -384 11.4451 0.0645
NP_440586.1_8 Reverse -77 -84 11.4451 0.0645
NP_440586.1_8 Reverse -137 -144 9.47853 0.146
NP_440586.1_8 Forward -144 -137 5.74197 0.283
NP_441861.1_2 Reverse -62 -81 20.054 0.159
NP_442251.1_6 Forward -273 -266 15.2804 0.0124
NP_442251.1_6 Reverse -266 -273 15.2804 0.0124
NP_442251.1_6 Reverse -384 -391 12.0355 0.0627
NP_442251.1_6 Forward -84 -77 12.0355 0.0627
NP_440684.1_9 Reverse -70 -84 7.37441 0.266
NP_441262.1_3 Forward -274 -267 14.8871 0.0223
NP_441262.1_3 Reverse -265 -272 14.7888 0.0223
NP_441262.1_3 Reverse -76 -83 14.7888 0.0223
NP_441262.1_3 Forward -392 -385 14.7888 0.0223
NP_441262.1_3 Forward -145 -138 14.7888 0.0223
NP_441262.1_3 Forward -85 -78 5.15232 0.265
NP_440027.1_3 Forward -128 -110 1.78836 0.295
NP_443051.1_1 Forward -146 -137 16.6177 0.00754
NP_443051.1_1 Forward -275 -266 16.0277 0.00754
NP_443051.1_1 Reverse -264 -273 10.4228 0.00754
NP_443051.1_1 Reverse -75 -84 9.93116 0.0146
NP_443051.1_1 Forward -393 -384 0.786375 0.125
NP_443051.1_1 Reverse -135 -144 -1.18024 0.297
NP_439937.1_8 Reverse -298 -317 -4.22878 0.28
NP_439937.1_9 Reverse -382 -399 -1.7318 0.129
NP_439937.1_9 Reverse -29 -46 -10.1882 0.224
NP_439937.1_9 Forward -189 -172 -14.2198 0.287
NP_440408.1_3 Reverse -130 -149 -4.52377 0.268
NP_440408.1_5 Reverse -70 -89 16.1257 0.27
NP_440408.1_7 Reverse -64 -83 11.4058 0.224
NP_440439.1_1 Forward -148 -135 7.78743 0.0599
NP_440439.1_1 Forward -88 -75 -1.75067 0.281
NP_442239.1_8 Reverse -166 -185 4.42435 0.297
NP_440372.1_2 Forward -273 -266 16.3621 0.0124
NP_440372.1_2 Reverse -266 -273 16.3621 0.0124
NP_440372.1_2 Forward -144 -137 13.8055 0.0214
NP_440372.1_2 Forward -391 -384 6.72562 0.0929
NP_440372.1_2 Reverse -77 -84 6.72562 0.0929
NP_440372.1_2 Forward -84 -77 6.62729 0.151
NP_440372.1_2 Reverse -384 -391 6.62729 0.151
NP_440372.1_2 Reverse -137 -144 6.52896 0.188
NP_441138.1_5 Forward -233 -220 9.51548 0.238
NP_441181.1_6 Reverse -137 -155 3.95239 0.254
NP_440316.1_10 Forward -146 -136 12.4681 0.214
NP_440316.1_10 Reverse -63 -73 6.46988 0.257
NP_441803.1_2 Forward -150 -131 16.3224 0.0353
NP_441803.1_2 Reverse -304 -323 1.96607 0.222
NP_439977.1_5 Reverse -259 -278 -2.65548 0.287
NP_440139.1_1 Reverse -377 -396 3.24359 0.211
NP_441572.1_7 Reverse -130 -149 3.14605 0.119
NP_441572.1_7 Reverse -329 -348 0.0977854 0.174
NP_441572.1_7 Forward -280 -261 -5.99873 0.278
NP_442384.1_10 Forward -274 -261 6.60746 0.0987
NP_442384.1_10 Reverse -265 -278 6.4108 0.102
NP_442384.1_10 Reverse -109 -122 6.01747 0.113
NP_442384.1_10 Forward -208 -195 5.82081 0.118
NP_442384.1_10 Forward -85 -72 4.64084 0.151
NP_442384.1_10 Reverse -136 -149 3.36254 0.193
NP_442339.1_1 Forward -226 -207 18.7798 0.11
NP_440693.1_4 Reverse -372 -391 15.2408 0.258
NP_442114.1_4 Reverse -383 -394 17.7582 0.107
NP_441604.1_4 Forward -126 -107 -3.73712 0.218
NP_440530.1_6 Forward -236 -222 14.9069 0.264
NP_442262.1_10 Forward -273 -266 14.1988 0.0123
NP_442262.1_10 Reverse -266 -273 14.1988 0.0123
NP_442262.1_10 Reverse -137 -144 13.2155 0.0213
NP_441689.1_5 Forward -147 -137 15.3192 0.0403
NP_441689.1_5 Reverse -263 -273 5.78111 0.197
NP_440344.1_10 Forward -281 -264 -7.92597 0.12
NP_440344.1_10 Forward -399 -382 -9.49926 0.147
NP_440282.1_10 Reverse -189 -208 -2.65548 0.232
NP_440282.1_10 Forward -83 -64 -9.44032 0.28
NP_440531.1_6 Reverse -121 -140 -4.81876 0.287
NP_441965.1_10 Forward -277 -261 4.87675 0.228
NP_441965.1_10 Reverse -184 -200 4.48343 0.238
NP_441640.1_8 Forward -273 -254 -5.80207 0.289
NP_440297.1_9 Reverse -266 -276 19.3512 0.0359
NP_440297.1_9 Forward -207 -197 8.92815 0.0967
NP_440297.1_9 Forward -181 -171 0.471689 0.282
NP_440297.1_9 Forward -273 -263 -0.118297 0.282
NP_440297.1_9 Reverse -77 -87 -0.216628 0.282
NP_440297.1_9 Reverse -137 -147 -0.609952 0.292
NP_442187.1_3 Forward -146 -136 13.4514 0.245
NP_441592.1_4 Forward -392 -373 5.211 0.137
NP_440894.1_7 Reverse -283 -302 9.34008 0.244
NP_440894.1_10 Reverse -131 -150 18.9773 0.0432
NP_440999.1_9 Reverse -132 -146 1.57289 0.162
NP_440999.1_9 Forward -278 -264 -0.885388 0.22
NP_440888.1_2 Reverse -136 -150 10.9137 0.0815
NP_440888.1_2 Forward -188 -174 10.3237 0.0974
NP_440888.1_2 Reverse -383 -397 6.88214 0.217
NP_440491.1_1 Forward -277 -258 7.79413 0.258
NP_442033.1_10 Forward -181 -162 -12.6852 0.274
NP_442871.1_4 Reverse -32 -51 -9.9327 0.292
NP_440575.1_1 Forward -165 -146 1.6703 0.267
NP_441543.1_2 Forward -273 -264 16.9127 0.00359
NP_441543.1_2 Reverse -384 -393 8.75118 0.0968
NP_441543.1_2 Forward -84 -75 6.19458 0.153
NP_441543.1_2 Reverse -137 -146 6.09625 0.153
NP_442845.1_2 Forward -151 -137 7.86607 0.195
NP_442845.1_2 Reverse -70 -84 7.37441 0.195
NP_442845.1_2 Reverse -259 -273 5.40779 0.233
NP_442845.1_6 Forward -307 -288 13.7649 0.217
NP_441834.1_7 Reverse -139 -158 16.0274 0.211
NP_441178.1_6 Forward -316 -297 6.98015 0.268
NP_441319.1_6 Reverse -134 -153 13.5691 0.255
NP_441829.1_2 Reverse -49 -63 17.5018 0.292
NP_441469.1_8 Forward -275 -266 13.7661 0.0719
NP_441469.1_8 Forward -119 -110 9.83282 0.227
NP_441469.1_8 Forward -86 -77 6.78456 0.227
NP_441469.1_8 Reverse -264 -273 6.48957 0.227
NP_441469.1_8 Forward -393 -384 6.29291 0.227
NP_441469.1_8 Reverse -382 -391 5.70292 0.257
NP_442637.1_3 Reverse -68 -87 2.85105 0.208
NP_443064.1_6 Reverse -320 -330 8.6886 0.276
NP_442578.1_7 Forward -273 -266 14.5921 0.026
NP_442578.1_7 Reverse -266 -273 14.5921 0.026
NP_442578.1_7 Reverse -310 -317 6.72562 0.18
NP_442578.1_7 Forward -144 -137 6.0373 0.18
NP_442578.1_7 Forward -391 -384 5.93897 0.183
NP_442578.1_7 Reverse -77 -84 5.93897 0.183
NP_440071.1_5 Forward -200 -181 9.53756 0.276
NP_440998.1_3 Reverse -52 -71 11.7992 0.0586
NP_441462.1_2 Forward -145 -135 16.1063 0.00406
NP_441462.1_2 Reverse -265 -275 11.2881 0.00441
NP_441462.1_2 Forward -274 -264 1.74999 0.0811
NP_441462.1_2 Forward -85 -75 0.668351 0.135
NP_441462.1_2 Reverse -136 -146 0.57002 0.144
NP_441462.1_2 Forward -392 -382 -0.118297 0.184
NP_441621.1_7 Reverse -134 -148 2.5562 0.123
NP_441621.1_7 Forward -394 -380 -2.16369 0.188
NP_441621.1_7 Reverse -381 -395 -3.73699 0.193
NP_441621.1_7 Forward -276 -262 -4.03198 0.203
NP_443062.1_1 Forward -208 -190 6.79079 0.192
NP_443062.1_1 Reverse -136 -154 6.10824 0.209
NP_443062.1_1 Forward -274 -256 3.96308 0.279
NP_443062.1_6 Forward -47 -28 7.96426 0.157
NP_443062.1_6 Reverse -257 -276 6.4893 0.181
NP_440349.1_2 Forward -192 -173 18.1907 0.191
NP_442204.1_1 Forward -149 -138 19.2332 0.0136
NP_442204.1_1 Reverse -72 -83 16.4799 0.0397
NP_442204.1_1 Reverse -60 -71 7.53183 0.127
NP_442204.1_1 Reverse -105 -116 -0.432984 0.299
NP_442204.1_5 Forward -49 -30 -0.197208 0.28
NP_440516.1_2 Forward -91 -73 11.0322 0.0788
NP_440516.1_2 Forward -280 -262 -2.43913 0.299
NP_440516.1_8 Forward -145 -136 18.9776 0.00442
NP_440516.1_8 Forward -392 -383 17.6993 0.00442
NP_440516.1_8 Reverse -265 -274 9.53783 0.0136
NP_440516.1_8 Reverse -76 -85 8.25953 0.0391
NP_440516.1_8 Forward -274 -265 7.07956 0.0867
NP_440516.1_8 Reverse -136 -145 5.01461 0.118
NP_440516.1_8 Reverse -179 -188 -0.491928 0.262
NP_441033.1_2 Reverse -373 -392 -7.76869 0.293
NP_442428.1_5 Forward -273 -266 15.8704 0.0124
NP_442428.1_5 Reverse -266 -273 15.8704 0.0124
NP_442428.1_5 Forward -207 -200 10.6589 0.0727
NP_442428.1_5 Reverse -384 -391 6.13563 0.209
NP_442428.1_5 Forward -144 -137 6.13563 0.209
NP_442428.1_5 Forward -84 -77 6.13563 0.209
NP_442428.1_5 Forward -391 -384 6.0373 0.212
NP_442428.1_5 Reverse -137 -144 6.0373 0.212
NP_442428.1_5 Reverse -77 -84 6.0373 0.212
NP_440783.1_5 Forward -150 -131 -6.29373 0.29
NP_441790.1_3 Forward -144 -125 -5.21209 0.291
NP_440673.1_3 Forward -272 -265 12.4288 0.0426
NP_440673.1_3 Forward -83 -76 12.4288 0.0426
NP_440673.1_3 Reverse -385 -392 12.4288 0.0426
NP_440673.1_3 Reverse -138 -145 12.4288 0.0426
NP_440673.1_3 Forward -353 -346 8.10225 0.24
NP_440673.1_3 Forward -186 -179 7.51227 0.252
NP_440673.1_3 Reverse -267 -274 5.34899 0.298
NP_440865.1_9 Forward -151 -132 -6.39206 0.226
NP_441052.1_2 Forward -274 -264 11.3864 0.0285
NP_441052.1_2 Reverse -187 -197 2.24165 0.213
NP_441052.1_2 Reverse -383 -393 1.35667 0.248
NP_441052.1_2 Reverse -136 -146 1.16001 0.25
NP_441052.1_2 Reverse -265 -275 0.668351 0.256
NP_442219.1_8 Forward -89 -70 8.55364 0.245
NP_442219.1_9 Forward -273 -264 17.7976 0.00718
NP_440436.1_4 Forward -273 -264 17.2072 0.00233
NP_440436.1_4 Reverse -384 -393 14.9456 0.0103
NP_440436.1_4 Reverse -31 -40 8.75075 0.0995
NP_440436.1_4 Reverse -266 -275 6.78414 0.147
NP_440436.1_4 Forward -84 -75 5.9975 0.174
NP_440436.1_4 Forward -391 -382 5.80084 0.182
NP_440436.1_4 Reverse -77 -86 5.80084 0.182
NP_441884.1_9 Reverse -133 -152 -23.7966 0.284
NP_441884.1_9 Reverse -337 -356 -24.19 0.284
NP_441884.1_10 Reverse -35 -45 18.9579 0.233
NP_440314.1_9 Reverse -266 -285 -7.67036 0.241
NP_441719.1_4 Forward -273 -266 16.3621 0.0124
NP_441719.1_4 Reverse -266 -273 16.3621 0.0124
NP_441719.1_4 Forward -144 -137 6.82395 0.0855
NP_441719.1_4 Forward -391 -384 6.72562 0.093
NP_441719.1_4 Reverse -77 -84 6.72562 0.093
NP_441719.1_4 Forward -84 -77 6.62729 0.151
NP_441719.1_4 Reverse -384 -391 6.62729 0.151
NP_441719.1_4 Reverse -137 -144 6.52896 0.188
NP_441733.1_10 Forward -395 -382 12.999 0.104
NP_441733.1_10 Forward -148 -135 4.8375 0.24
NP_441004.1_1 Reverse -285 -304 -8.55534 0.2
NP_441004.1_1 Reverse -130 -149 -10.4236 0.219
NP_441004.1_1 Reverse -103 -122 -16.7168 0.287
NP_442813.1_4 Forward -400 -381 -5.99873 0.299
NP_442813.1_4 Forward -242 -223 -6.68705 0.299
NP_442813.1_4 Forward -243 -224 -8.06369 0.299
NP_442366.1_3 Forward -275 -257 8.57394 0.0648
NP_442366.1_3 Forward -393 -375 7.4923 0.0747
NP_442366.1_3 Reverse -198 -216 2.0841 0.135
NP_442366.1_3 Forward -86 -68 -4.50408 0.272
NP_442366.1_5 Reverse -73 -83 17.2858 0.0141
NP_442366.1_5 Reverse -262 -272 14.0409 0.0497
NP_440129.1_4 Forward -82 -64 14.2763 0.225
NP_441115.1_4 Forward -146 -128 7.29487 0.291
NP_442206.1_10 Reverse -265 -280 7.25639 0.178
NP_442206.1_10 Reverse -136 -151 2.8315 0.198
NP_443054.1_2 Reverse -381 -395 1.08123 0.251
NP_443054.1_2 Forward -147 -133 -0.000409212 0.283
NP_441851.1_10 Forward -275 -265 15.9097 0.00552
NP_441851.1_10 Reverse -264 -274 15.6147 0.00791
NP_441851.1_10 Reverse -198 -208 7.55152 0.137
NP_441851.1_10 Forward -86 -76 4.69992 0.254
NP_442515.1_1 Reverse -264 -278 12.0943 0.0355
NP_442515.1_1 Reverse -172 -186 -2.36035 0.273
NP_441683.1_1 Reverse -34 -53 13.0845 0.3
NP_441683.1_5 Reverse -114 -133 7.47261 0.262
NP_441683.1_7 Reverse -300 -319 -12.0953 0.284
NP_440593.1_3 Reverse -131 -150 -0.590531 0.205
NP_440593.1_9 Reverse -167 -181 10.521 0.24
NP_441982.1_6 Reverse -223 -232 12.1034 0.288
NP_440940.1_7 Forward -155 -137 4.04996 0.265
NP_441409.1_6 Forward -280 -261 6.29264 0.0292
NP_441409.1_6 Reverse -259 -278 -7.57203 0.153
NP_440432.1_9 Reverse -384 -399 4.50312 0.0691
NP_440432.1_9 Forward -38 -23 -5.32998 0.245
NP_439960.1_10 Forward -192 -174 -4.70074 0.296
NP_440474.1_8 Forward -348 -334 8.3571 0.189
NP_440474.1_8 Reverse -77 -91 7.3738 0.207
NP_440474.1_8 Reverse -384 -398 6.88214 0.215
NP_440431.1_3 Reverse -216 -235 -11.3086 0.286
NP_442450.1_5 Forward -276 -266 10.5014 0.115
NP_442450.1_5 Reverse -263 -273 7.55152 0.13
NP_442450.1_5 Reverse -197 -207 6.8632 0.151
NP_442168.1_5 Forward -207 -188 -2.55715 0.264
NP_442168.1_5 Reverse -376 -395 -3.3438 0.281
NP_440588.1_2 Reverse -374 -393 0.0977854 0.149
NP_440588.1_2 Reverse -256 -275 -1.57384 0.155
NP_440588.1_2 Forward -154 -135 -1.57384 0.155
NP_440588.1_2 Reverse -67 -86 -1.96717 0.158
NP_440588.1_2 Forward -283 -264 -3.24547 0.182
NP_442006.1_2 Reverse -142 -159 -16.8741 0.265
NP_442006.1_2 Reverse -326 -343 -17.6607 0.279
NP_442006.1_3 Forward -151 -133 -6.07737 0.298
NP_441003.1_9 Reverse -55 -74 10.4225 0.213
NP_440483.1_1 Forward -397 -378 -6.78538 0.252
NP_441570.1_1 Reverse -136 -154 -1.45582 0.0568
NP_441570.1_1 Reverse -70 -88 -17.2871 0.269
NP_441078.1_4 Reverse -265 -274 9.93116 0.0203
NP_441078.1_4 Forward -274 -265 9.83282 0.0226
NP_441078.1_4 Forward -208 -199 5.11294 0.118
NP_441078.1_4 Forward -145 -136 0.196389 0.205
NP_441078.1_4 Reverse -383 -392 0.0980582 0.205
NP_441078.1_4 Reverse -76 -85 0.0980582 0.205
NP_441078.1_4 Forward -392 -383 0.0980582 0.205
NP_441078.1_4 Forward -85 -76 0.0980582 0.205
NP_441078.1_4 Reverse -136 -145 -0.000272808 0.205
NP_441078.1_4 Reverse -109 -118 -1.96689 0.282
NP_440526.1_3 Reverse -384 -395 8.90795 0.11
NP_440526.1_3 Forward -273 -262 8.02298 0.126
NP_440526.1_3 Reverse -266 -277 7.03967 0.168
NP_440526.1_3 Forward -144 -133 2.22148 0.267
NP_440526.1_3 Forward -348 -337 0.254868 0.292
NP_441432.1_8 Reverse -264 -273 16.8143 0.00595
NP_441432.1_8 Forward -146 -137 14.0611 0.0258
NP_441432.1_8 Reverse -75 -84 7.17789 0.102
NP_441432.1_8 Reverse -178 -187 3.44131 0.245
NP_441432.1_8 Reverse -63 -72 3.04799 0.268
NP_442320.1_8 Forward -398 -384 14.1593 0.0138
NP_441732.1_2 Forward -149 -133 -7.80794 0.0935
NP_441732.1_2 Reverse -72 -88 -7.80794 0.0935
NP_441732.1_2 Forward -278 -262 -17.5427 0.27
NP_442540.1_9 Forward -266 -247 14.2574 0.194
NP_440760.1_1 Forward -145 -126 -5.70374 0.0511
NP_440760.1_1 Forward -274 -255 -7.76869 0.0726
NP_440760.1_1 Forward -85 -66 -23.4033 0.297
NP_442797.1_6 Reverse -253 -272 8.22503 0.265
NP_442797.1_6 Forward -83 -64 6.86764 0.299
NP_442797.1_7 Forward -189 -171 16.4404 0.0969
NP_442797.1_7 Forward -152 -134 2.77242 0.238
NP_442797.1_7 Reverse -166 -184 -0.472507 0.283
NP_442510.1_5 Reverse -133 -152 19.174 0.145
NP_442510.1_8 Forward -276 -257 20.649 0.0947
NP_442727.1_1 Forward -238 -224 11.8976 0.288
NP_442751.1_2 Forward -152 -133 5.2102 0.261
NP_440713.1_4 Forward -155 -136 15.7324 0.0778
NP_442489.1_2 Forward -162 -143 16.7157 0.126
NP_442489.1_7 Reverse -265 -274 10.4228 0.0151
NP_442489.1_7 Forward -274 -265 10.3245 0.0193
NP_442489.1_7 Forward -85 -76 0.786375 0.152
NP_442489.1_7 Reverse -383 -392 0.786375 0.152
NP_442489.1_7 Forward -145 -136 0.688044 0.152
NP_442489.1_7 Reverse -136 -145 0.688044 0.152
NP_442489.1_7 Forward -392 -383 0.589713 0.17
NP_442489.1_7 Reverse -76 -85 0.589713 0.17
NP_442489.1_7 Reverse -109 -118 -1.47524 0.203
NP_442489.1_7 Forward -39 -30 -1.47524 0.203
NP_442489.1_7 Forward -208 -199 -1.6719 0.235
NP_442079.1_6 Reverse -165 -184 15.6341 0.273
NP_442079.1_7 Forward -207 -188 2.26107 0.232
NP_440559.1_1 Forward -273 -264 17.4043 0.00658
NP_440559.1_1 Reverse -266 -275 16.421 0.01
NP_440559.1_1 Forward -144 -135 6.39124 0.134
NP_440559.1_1 Reverse -384 -393 5.50626 0.14
NP_440559.1_1 Forward -84 -75 5.40793 0.14
NP_441659.2_8 Reverse -265 -275 16.008 0.0042
NP_441659.2_8 Forward -274 -264 8.63316 0.0405
NP_441659.2_8 Reverse -136 -146 8.23984 0.0462
NP_441659.2_8 Reverse -76 -86 5.28991 0.112
NP_441659.2_8 Forward -85 -75 1.84832 0.224
NP_441659.2_8 Forward -145 -135 0.275027 0.27
NP_441659.2_8 Forward -118 -108 -0.314959 0.298
NP_440860.1_8 Forward -190 -171 18.1907 0.149
NP_442913.1_10 Reverse -127 -146 -1.08219 0.166
NP_440708.1_6 Forward -116 -97 -5.11376 0.232
NP_441800.1_10 Reverse -76 -95 0.491109 0.29
NP_442776.1_1 Forward -178 -159 3.24438 0.29
NP_440779.1_5 Reverse -383 -400 -6.15601 0.164
NP_442346.1_5 Reverse -264 -274 15.418 0.00627
NP_442346.1_5 Reverse -75 -85 13.648 0.0222
NP_442346.1_5 Forward -275 -265 8.53483 0.133
NP_442346.1_5 Reverse -108 -118 7.25653 0.176
NP_442346.1_5 Reverse -198 -208 6.66654 0.195
NP_442346.1_5 Reverse -29 -39 5.68323 0.234
NP_442346.1_5 Reverse -135 -145 4.3066 0.291
NP_440545.1_3 Reverse -261 -278 10.8552 0.0296
NP_440545.1_3 Reverse -72 -89 9.87194 0.0368
NP_440545.1_3 Forward -77 -60 -2.41943 0.184
NP_440545.1_3 Reverse -132 -149 -2.71443 0.191
NP_441856.1_3 Forward -277 -258 -1.57384 0.239
NP_440025.1_1 Reverse -379 -398 10.9142 0.157
NP_440831.1_3 Forward -154 -135 14.5416 0.113
NP_441629.1_3 Forward -189 -170 -3.14789 0.277
NP_441923.1_6 Reverse -143 -157 20.3541 0.0984
NP_440004.1_5 Forward -397 -378 19.174 0.119
NP_440459.1_2 Forward -147 -130 13.1169 0.131
NP_440459.1_2 Reverse -61 -78 8.00365 0.272
NP_441653.1_2 Forward -207 -188 9.03774 0.164
NP_442603.1_7 Forward -145 -131 12.2903 0.1
NP_442603.1_7 Reverse -265 -279 7.27547 0.211
NP_441233.1_2 Forward -196 -177 15.7324 0.162
NP_440449.1_6 Reverse -128 -146 23.0398 0.00985
NP_440449.1_6 Forward -380 -362 7.67226 0.214
NP_440449.1_6 Forward -126 -108 5.62973 0.273
NP_441948.1_4 Forward -399 -381 -5.09406 0.253
NP_441833.1_4 Forward -273 -266 15.9687 0.0124
NP_441833.1_4 Reverse -266 -273 15.9687 0.0124
NP_441833.1_4 Reverse -384 -391 14.1004 0.0258
NP_441833.1_4 Forward -84 -77 14.1004 0.0258
NP_441833.1_4 Reverse -137 -144 6.52896 0.0924
NP_441833.1_4 Forward -144 -137 6.23397 0.163
NP_441833.1_4 Forward -391 -384 6.13563 0.198
NP_441833.1_4 Reverse -77 -84 6.13563 0.198
NP_442162.1_9 Forward -273 -266 16.2637 0.0124
NP_442162.1_9 Reverse -266 -273 16.2637 0.0124
NP_442162.1_9 Forward -144 -137 12.9205 0.0282
NP_442162.1_9 Reverse -137 -144 12.9205 0.0282
NP_442162.1_9 Reverse -384 -391 6.62729 0.142
NP_442162.1_9 Forward -84 -77 6.62729 0.142
NP_442162.1_9 Forward -391 -384 6.52896 0.178
NP_442162.1_9 Reverse -77 -84 6.52896 0.178
NP_440671.1_4 Forward -151 -137 11.6026 0.129
NP_440671.1_4 Forward -280 -266 6.09611 0.261
NP_440671.1_4 Reverse -58 -72 5.50613 0.281
NP_442404.1_9 Forward -185 -171 11.012 0.263
NP_440204.1_4 Reverse -286 -305 1.0811 0.238
NP_442199.1_5 Reverse -191 -210 -5.21209 0.24
NP_442140.1_3 Forward -391 -381 14.533 0.0486
NP_442140.1_3 Forward -273 -263 12.2714 0.0632
NP_442140.1_3 Reverse -384 -394 8.04317 0.124
NP_442140.1_3 Reverse -77 -87 7.84651 0.126
NP_442140.1_3 Forward -144 -134 7.35486 0.142
NP_442140.1_3 Reverse -266 -276 6.66654 0.159
NP_442140.1_3 Reverse -143 -153 3.61828 0.288
NP_440875.1_9 Reverse -385 -395 17.619 0.0104
NP_440875.1_9 Reverse -138 -148 8.27469 0.233
NP_441813.1_5 Forward -276 -266 15.3197 0.0113
NP_441813.1_5 Reverse -381 -391 9.91146 0.021
NP_441813.1_5 Reverse -263 -273 8.63316 0.0367
NP_441813.1_5 Forward -87 -77 6.8632 0.0784
NP_441813.1_5 Forward -147 -137 6.17489 0.1
NP_441813.1_5 Reverse -134 -144 5.78156 0.109
NP_441813.1_5 Forward -394 -384 0.176696 0.215
NP_441813.1_7 Forward -301 -287 8.3571 0.285
NP_440590.1_4 Reverse -384 -397 9.06573 0.0395
NP_440590.1_4 Forward -84 -71 8.27909 0.0466
NP_440590.1_4 Forward -273 -260 3.16588 0.0756
NP_440590.1_4 Forward -144 -131 2.57589 0.0845
NP_440567.1_1 Forward -144 -130 6.88276 0.08
NP_440567.1_1 Forward -84 -70 4.91614 0.109
NP_440567.1_1 Forward -273 -259 4.81781 0.111
NP_440567.1_1 Reverse -137 -151 4.42448 0.121
NP_440567.1_1 Reverse -384 -398 2.85119 0.16
NP_442497.1_10 Reverse -266 -275 17.9943 0.00813
NP_442497.1_10 Forward -273 -264 10.4228 0.0087
NP_442497.1_10 Forward -84 -75 7.86621 0.0695
NP_442497.1_10 Reverse -137 -146 7.76787 0.0731
NP_442497.1_10 Forward -144 -135 1.08137 0.115
NP_442497.1_10 Reverse -384 -393 0.688044 0.141
NP_442497.1_10 Forward -207 -198 0.29472 0.199
NP_440821.1_4 Forward -276 -266 19.2529 0.00399
NP_440821.1_4 Reverse -263 -273 9.41981 0.0286
NP_440821.1_4 Forward -394 -384 8.92815 0.0382
NP_440821.1_4 Forward -87 -77 8.73149 0.0426
NP_440821.1_4 Reverse -134 -144 7.35486 0.072
NP_440821.1_4 Reverse -197 -207 6.8632 0.0814
NP_440821.1_4 Forward -147 -137 1.35667 0.137
NP_441239.1_9 Reverse -134 -146 12.9203 0.0402
NP_441239.1_9 Forward -276 -264 11.7404 0.0551
NP_441239.1_9 Reverse -381 -393 7.21714 0.169
NP_441239.1_9 Forward -346 -334 6.52882 0.185
NP_441239.1_9 Reverse -197 -209 4.36554 0.253
NP_441239.1_9 Forward -87 -75 4.07055 0.264
NP_441239.1_9 Forward -140 -128 3.48056 0.285
NP_441951.1_4 Reverse -130 -149 1.57275 0.283
NP_441892.1_1 Forward -154 -137 0.137172 0.173
NP_441892.1_1 Reverse -67 -84 -4.09106 0.255
NP_441892.1_1 Reverse -190 -207 -5.36936 0.279
NP_441892.1_2 Reverse -178 -197 -0.787193 0.16
NP_440665.1_1 Reverse -323 -342 -15.3402 0.267
NP_440665.1_1 Reverse -161 -180 -16.4218 0.288
NP_440604.1_6 Reverse -136 -155 -4.13045 0.24
NP_442044.1_1 Reverse -335 -354 11.2092 0.116
NP_441508.1_4 Reverse -225 -239 14.9084 0.258
NP_440833.1_6 Forward -301 -287 15.2402 0.143
NP_442216.1_4 Forward -245 -237 17.6202 0.23
NP_440212.1_5 Forward -156 -137 16.1257 0.218
NP_441617.1_6 Forward -235 -216 -6.49039 0.283
NP_442052.1_7 Reverse -299 -313 16.2242 0.161
NP_440546.1_4 Forward -145 -135 14.9908 0.0459
NP_440546.1_4 Forward -392 -382 11.0156 0.0991
NP_440546.1_4 Reverse -136 -146 8.20381 0.199
NP_440546.1_4 Reverse -199 -209 6.74945 0.282
NP_440546.1_6 Forward -49 -30 15.6341 0.137
NP_441230.1_5 Reverse -131 -150 21.2389 0.0189
NP_441230.1_5 Forward -193 -174 2.45773 0.214
NP_440462.1_6 Forward -394 -384 8.33817 0.0646
NP_440462.1_6 Forward -147 -137 7.35486 0.0803
NP_440462.1_6 Reverse -381 -391 6.76487 0.102
NP_440462.1_6 Reverse -134 -144 6.46988 0.115
NP_440462.1_6 Reverse -263 -273 1.35667 0.294
NP_442465.1_9 Reverse -220 -234 10.3243 0.297
NP_442611.1_1 Reverse -136 -155 5.70265 0.179
NP_442611.1_1 Reverse -335 -354 2.55606 0.216
NP_440868.1_4 Reverse -261 -273 15.1819 0.0164
NP_440868.1_4 Forward -149 -137 3.57889 0.134
NP_440868.1_4 Forward -89 -77 2.98891 0.142
NP_440868.1_4 Reverse -379 -391 2.39892 0.156
NP_440868.1_4 Forward -353 -341 1.02229 0.193
NP_440868.1_4 Forward -278 -266 0.432302 0.212
NP_440868.1_4 Forward -396 -384 0.137309 0.228
NP_440868.1_4 Reverse -72 -84 -0.944332 0.284
NP_441497.1_3 Reverse -206 -225 -11.5053 0.294
NP_442402.1_9 Reverse -119 -138 9.63589 0.277
NP_442402.1_10 Forward -382 -372 10.8943 0.275
NP_440653.1_10 Reverse -188 -207 2.94938 0.287
NP_440696.1_3 Reverse -132 -150 5.23069 0.198
NP_440696.1_3 Reverse -109 -127 -2.14413 0.274
NP_442039.1_4 Forward -273 -266 15.1821 0.0124
NP_442039.1_4 Reverse -266 -273 15.1821 0.0124
NP_442039.1_4 Forward -144 -137 11.6422 0.0747
NP_442829.1_2 Reverse -217 -233 7.75456 0.295
NP_441926.1_3 Forward -392 -376 5.56507 0.17
NP_440825.1_7 Forward -273 -263 12.9096 0.152
NP_442837.1_3 Forward -273 -266 15.7721 0.0124
NP_442837.1_3 Reverse -266 -273 15.7721 0.0124
NP_442837.1_3 Reverse -384 -391 6.13563 0.25
NP_442837.1_3 Forward -84 -77 6.13563 0.25
NP_442837.1_3 Forward -144 -137 6.0373 0.25
NP_442837.1_3 Reverse -137 -144 6.0373 0.25
NP_442837.1_3 Forward -391 -384 5.93897 0.265
NP_442837.1_3 Reverse -77 -84 5.93897 0.265
NP_439994.1_3 Forward -275 -256 8.24345 0.291
NP_442053.1_1 Reverse -136 -145 14.4544 0.0114
NP_442053.1_1 Reverse -265 -274 9.34117 0.0666
NP_442053.1_1 Forward -274 -265 8.84951 0.072
NP_442053.1_1 Forward -145 -136 7.86621 0.0863
NP_442053.1_1 Forward -392 -383 7.76787 0.0895
NP_442053.1_1 Reverse -383 -392 7.17789 0.104
NP_440505.1_3 Forward -147 -137 13.5497 0.0297
NP_440505.1_3 Forward -394 -384 12.8614 0.0427
NP_440505.1_3 Reverse -263 -273 9.22315 0.122
NP_440505.1_3 Reverse -74 -84 6.76487 0.169
NP_441203.1_1 Reverse -266 -285 -11.8003 0.139
NP_441203.1_1 Forward -207 -188 -20.2567 0.297
NP_442532.1_7 Reverse -76 -90 3.63784 0.192
NP_442532.1_7 Forward -85 -71 1.37622 0.289
NP_440914.1_1 Reverse -136 -146 11.8356 0.0767
NP_440914.1_1 Forward -274 -264 8.51751 0.186
NP_440914.1_1 Reverse -265 -275 6.27291 0.288
NP_441011.1_8 Forward -144 -135 9.24284 0.131
NP_441011.1_8 Forward -273 -264 8.25953 0.144
NP_441011.1_8 Forward -207 -198 7.27622 0.179
NP_441011.1_8 Reverse -384 -393 7.17789 0.179
NP_441011.1_8 Forward -84 -75 6.8829 0.18
NP_441011.1_8 Reverse -137 -146 6.78456 0.184
NP_441011.1_8 Reverse -266 -275 6.68623 0.184
NP_441011.1_8 Forward -391 -382 5.60459 0.247
NP_442533.1_1 Reverse -294 -313 -9.63698 0.228
NP_442533.1_6 Forward -118 -109 12.2911 0.0304
NP_442533.1_6 Reverse -265 -274 7.86621 0.0862
NP_442533.1_6 Forward -274 -265 7.37455 0.0898
NP_442533.1_6 Forward -208 -199 5.80125 0.128
NP_442533.1_6 Reverse -199 -208 5.70292 0.132
NP_442533.1_6 Reverse -136 -145 4.42462 0.179
NP_442533.1_6 Reverse -129 -138 3.44131 0.212
NP_443016.1_1 Reverse -259 -278 -0.688862 0.219
NP_441482.1_7 Forward -151 -137 7.86607 0.0233
NP_441482.1_7 Reverse -103 -117 -5.70361 0.189
NP_441482.1_7 Forward -280 -266 -9.63684 0.208
NP_441482.1_7 Reverse -70 -84 -10.6202 0.211
NP_439944.1_9 Reverse -266 -276 15.123 0.0244
NP_439944.1_9 Forward -273 -263 10.5014 0.0887
NP_439944.1_9 Reverse -137 -147 7.84651 0.127
NP_439944.1_9 Reverse -77 -87 6.07655 0.199
NP_439944.1_9 Forward -207 -197 5.19158 0.27
NP_440816.1_2 Reverse -146 -165 5.66045 0.296
NP_442202.1_10 Forward -345 -331 2.85119 0.282
NP_440116.1_5 Reverse -262 -279 5.15205 0.176
NP_441527.1_4 Reverse -226 -245 -7.87851 0.239
NP_441527.1_4 Reverse -216 -235 -8.16498 0.241
NP_440115.1_6 Reverse -262 -272 9.32148 0.115
NP_440115.1_6 Forward -148 -138 7.45319 0.147
NP_440115.1_6 Reverse -73 -83 6.37155 0.186
NP_440115.1_6 Reverse -176 -186 4.69992 0.288
NP_440007.1_9 Forward -149 -135 9.14437 0.171
NP_440007.1_9 Reverse -60 -74 2.2612 0.281
NP_441680.1_4 Reverse -381 -400 7.66927 0.167
NP_442492.1_2 Forward -392 -373 2.0644 0.224
NP_442492.1_2 Reverse -199 -218 0.491109 0.241
NP_441972.1_5 Forward -207 -188 -7.96535 0.256
NP_441106.1_1 Reverse -264 -273 9.63616 0.0311
NP_441106.1_1 Forward -146 -137 8.75118 0.0469
NP_441106.1_1 Reverse -75 -84 8.65285 0.0522
NP_441106.1_1 Forward -393 -384 8.35786 0.0585
NP_441106.1_1 Reverse -382 -391 5.70292 0.131
NP_441106.1_1 Forward -86 -77 5.70292 0.131
NP_441106.1_1 Reverse -108 -117 2.75299 0.261
NP_441420.1_1 Forward -146 -127 -5.60541 0.292
NP_440429.1_9 Reverse -133 -152 -0.4922 0.297
NP_439903.1_6 Reverse -133 -152 9.34008 0.124
NP_439903.1_6 Forward -76 -57 -0.0996487 0.276
NP_441286.1_1 Reverse -264 -276 14.7886 0.00418
NP_441286.1_1 Forward -146 -134 4.36554 0.0342
NP_441286.1_1 Forward -275 -263 2.20226 0.0693
NP_441286.1_1 Forward -209 -197 -4.77924 0.175
NP_441286.1_1 Forward -183 -171 -6.15587 0.251
NP_441286.1_1 Reverse -75 -87 -6.64753 0.271
NP_441286.1_1 Forward -393 -381 -7.04085 0.3
NP_442674.1_3 Reverse -362 -381 5.60352 0.264
NP_440670.1_8 Reverse -265 -274 16.3227 0.00291
NP_440670.1_8 Forward -274 -265 15.1427 0.00768
NP_440670.1_8 Forward -85 -76 13.2744 0.0157
NP_440670.1_8 Forward -145 -136 8.75118 0.0606
NP_440670.1_8 Reverse -76 -85 7.37455 0.0774
NP_440670.1_8 Reverse -383 -392 6.8829 0.0907
NP_440670.1_8 Reverse -136 -145 6.19458 0.124
NP_441705.1_3 Reverse -284 -303 -3.93378 0.291
NP_440886.1_7 Forward -393 -383 12.5659 0.0805
NP_440886.1_7 Reverse -382 -392 8.53436 0.0805
NP_440886.1_7 Forward -119 -109 7.45273 0.093
NP_440886.1_7 Reverse -135 -145 6.76441 0.114
NP_440886.1_7 Reverse -178 -188 3.71617 0.267
NP_440828.1_4 Forward -192 -173 0.588665 0.181
NP_440828.1_4 Forward -161 -142 -5.40949 0.255
NP_442614.1_2 Reverse -265 -279 21.7307 0.00177
NP_442614.1_2 Reverse -173 -187 13.4709 0.124
NP_442614.1_2 Forward -274 -260 7.57108 0.271
NP_442614.1_2 Forward -145 -131 7.27608 0.275
NP_442614.1_2 Reverse -335 -349 6.29277 0.291
NP_441784.1_4 Forward -247 -228 5.11266 0.221
NP_442072.1_9 Forward -146 -128 -3.81576 0.0388
NP_440028.1_6 Reverse -292 -310 10.2456 0.282
NP_440907.2_8 Reverse -384 -394 8.14104 0.117
NP_440907.2_8 Reverse -266 -276 7.94438 0.117
NP_440907.2_8 Reverse -137 -147 7.74772 0.117
NP_440907.2_8 Forward -273 -263 7.64939 0.117
NP_440907.2_8 Forward -348 -338 6.86274 0.144
NP_440907.2_8 Forward -84 -74 6.56775 0.161
NP_442264.1_2 Reverse -169 -186 7.70866 0.231
NP_441021.1_8 Reverse -378 -396 13.6872 0.0938
NP_440326.1_5 Reverse -263 -276 13.3923 0.243
NP_442842.1_2 Forward -199 -180 13.0775 0.182
NP_441626.1_2 Forward -273 -266 15.7721 0.0124
NP_441626.1_2 Reverse -266 -273 15.7721 0.0124
NP_441626.1_2 Forward -144 -137 12.2322 0.0511
NP_441626.1_2 Forward -391 -384 6.0373 0.212
NP_441626.1_2 Reverse -384 -391 6.0373 0.212
NP_441626.1_2 Forward -84 -77 6.0373 0.212
NP_441626.1_2 Reverse -77 -84 6.0373 0.212
NP_441626.1_2 Reverse -137 -144 5.93897 0.231
NP_442794.1_1 Reverse -261 -273 12.1337 0.0721
NP_442794.1_1 Reverse -60 -72 3.87389 0.283
NP_441401.1_10 Forward -163 -144 16.4207 0.289
NP_442615.1_1 Reverse -256 -274 4.83737 0.0426
NP_442615.1_1 Forward -283 -265 3.46073 0.0542
NP_442467.1_6 Reverse -33 -52 11.6017 0.298
NP_441962.1_4 Reverse -71 -90 -13.2752 0.271
NP_440387.1_1 Reverse -76 -92 3.89344 0.0503
NP_440387.1_1 Forward -118 -102 2.12349 0.0871
NP_440387.1_1 Forward -274 -258 0.943514 0.116
NP_440387.1_1 Forward -85 -69 -3.28472 0.157
NP_440387.1_1 Reverse -136 -152 -5.34967 0.227
NP_441431.1_3 Reverse -291 -310 8.25926 0.236
NP_442020.1_1 Reverse -219 -238 0.785326 0.255
NP_441488.1_8 Reverse -260 -274 11.602 0.146
NP_441488.1_8 Forward -150 -136 11.1104 0.146
NP_441488.1_8 Reverse -71 -85 10.2254 0.146
NP_441836.1_2 Forward -347 -328 -6.39206 0.297
NP_440467.1_3 Reverse -65 -84 12.9165 0.214
NP_440114.1_10 Reverse -383 -397 11.406 0.115
NP_440114.1_10 Forward -145 -131 6.29277 0.276
NP_440766.1_4 Forward -149 -135 18.0925 0.0255
NP_440766.1_4 Forward -396 -382 2.75286 0.172
NP_440766.1_4 Reverse -175 -189 2.35953 0.187
NP_440766.1_4 Forward -278 -264 0.392915 0.286
NP_441237.1_9 Forward -273 -263 14.828 0.0242
NP_441237.1_9 Forward -144 -134 14.1397 0.0488
NP_442743.1_5 Reverse -137 -156 9.63589 0.148
NP_442103.1_2 Forward -206 -188 9.6548 0.246
NP_442930.1_1 Forward -248 -238 9.321 0.287
NP_439910.1_2 Forward -93 -76 -21.4956 0.183
NP_439910.1_2 Forward -282 -265 -22.2823 0.22
NP_440457.1_1 Forward -149 -137 10.6587 0.092
NP_440457.1_1 Forward -278 -266 8.20045 0.101
NP_440457.1_1 Reverse -195 -207 -1.23932 0.3
NP_440798.1_6 Reverse -384 -397 3.16588 0.152
NP_440473.1_1 Reverse -262 -281 11.161 0.283
NP_440473.1_9 Reverse -372 -391 -7.86702 0.24
NP_442509.1_9 Reverse -265 -275 13.6475 0.0475
NP_442509.1_9 Forward -145 -135 13.1559 0.061
NP_442509.1_9 Reverse -383 -393 12.3692 0.0947
NP_441253.1_8 Forward -213 -199 16.4658 0.119
NP_442514.1_5 Forward -314 -295 -3.24622 0.226
NP_442514.1_5 Forward -182 -163 -8.45774 0.285
NP_440554.1_4 Reverse -137 -147 13.1564 0.0271
NP_440554.1_4 Reverse -266 -276 8.23984 0.0804
NP_440554.1_4 Reverse -77 -87 6.07655 0.128
NP_440554.1_4 Reverse -384 -394 4.40493 0.19
NP_441845.1_6 Reverse -175 -193 -1.45582 0.285
NP_441885.1_5 Forward -274 -264 11.0914 0.00874
NP_441885.1_5 Reverse -265 -275 2.24165 0.0822
NP_441885.1_5 Reverse -199 -209 0.668351 0.133
NP_441885.1_5 Forward -145 -135 -0.0199663 0.186
NP_440628.1_1 Reverse -315 -325 13.1977 0.29
NP_441614.1_5 Forward -196 -177 18.289 0.0603
NP_442341.1_7 Reverse -264 -278 1.37622 0.292
NP_442341.1_9 Forward -147 -133 9.24208 0.155
NP_442341.1_9 Forward -276 -262 7.57046 0.196
NP_442341.1_9 Reverse -170 -184 5.30886 0.274
NP_441756.1_5 Reverse -132 -151 3.83436 0.199
NP_441173.1_9 Forward -219 -211 11.0321 0.228
NP_440423.1_6 Forward -400 -381 -19.2734 0.237
NP_443000.1_7 Reverse -263 -273 10.3048 0.0345
NP_443000.1_7 Forward -147 -137 7.74818 0.0666
NP_443000.1_7 Reverse -74 -84 0.865012 0.285
NP_440727.1_3 Forward -71 -52 12.9791 0.283
NP_441842.1_1 Forward -83 -70 11.6217 0.248
NP_441842.1_10 Forward -399 -385 15.7325 0.0381
NP_441842.1_10 Reverse -69 -83 12.1926 0.107
NP_441842.1_10 Forward -152 -138 9.04604 0.2
NP_440275.1_3 Forward -276 -266 10.1081 0.0449
NP_440275.1_3 Forward -394 -384 8.33817 0.0602
NP_440275.1_3 Reverse -338 -348 8.04317 0.0602
NP_440275.1_3 Reverse -263 -273 8.04317 0.0602
NP_440275.1_3 Forward -147 -137 6.56821 0.101
NP_440275.1_3 Forward -87 -77 5.68323 0.136
NP_440275.1_3 Reverse -381 -391 3.91327 0.207
NP_440275.1_3 Reverse -134 -144 1.25834 0.291
NP_440091.1_1 Forward -396 -384 10.3637 0.0498
NP_440091.1_1 Forward -89 -77 6.1355 0.1
NP_440091.1_1 Reverse -379 -391 2.0056 0.197
NP_441902.1_3 Reverse -93 -103 15.7027 0.201
NP_440679.1_5 Reverse -139 -158 8.06259 0.292
NP_443010.1_10 Forward -395 -378 3.73713 0.252
NP_441359.1_5 Reverse -360 -379 1.47442 0.29
NP_439962.1_4 Reverse -171 -190 -3.3438 0.251
NP_439962.1_4 Forward -196 -177 -5.50708 0.28
NP_439962.1_4 Forward -153 -134 -7.76869 0.29
NP_440149.1_8 Reverse -136 -155 -2.75381 0.175
NP_441105.1_3 Reverse -65 -84 7.07928 0.0565
NP_441105.1_3 Reverse -53 -72 -7.57203 0.255
NP_442373.1_2 Reverse -170 -189 -11.1119 0.293
NP_440216.1_1 Reverse -383 -397 -3.147 0.0729
NP_440216.1_1 Forward -392 -378 -3.44199 0.082
NP_440216.1_1 Forward -145 -131 -11.2101 0.169
NP_440216.1_1 Reverse -265 -279 -11.8985 0.228
NP_440172.1_1 Reverse -265 -275 9.7148 0.0586
NP_440172.1_1 Forward -145 -135 7.55152 0.0761
NP_440172.1_1 Forward -274 -264 5.19158 0.149
NP_440172.1_1 Reverse -136 -146 4.79825 0.166
NP_442015.1_10 Forward -278 -265 12.2123 0.0372
NP_442015.1_10 Forward -89 -76 2.47756 0.191
NP_442015.1_10 Reverse -261 -274 0.314277 0.231
NP_442015.1_10 Reverse -72 -85 0.0192843 0.245
NP_442015.1_10 Forward -201 -188 -0.472371 0.268
NP_441226.1_7 Forward -273 -266 14.4934 0.0123
NP_441226.1_7 Reverse -266 -273 14.4934 0.0123
NP_441226.1_7 Forward -144 -137 12.7234 0.0312
NP_441226.1_7 Reverse -137 -144 11.5435 0.0757
NP_441226.1_7 Forward -348 -341 8.88855 0.165
NP_441226.1_7 Reverse -116 -123 6.82361 0.246
NP_442446.1_3 Reverse -64 -83 9.43923 0.282
NP_441757.1_3 Reverse -264 -283 8.94757 0.104
NP_441111.1_7 Forward -273 -265 18.7023 0.00294
NP_441111.1_7 Forward -84 -76 8.96754 0.0463
NP_441111.1_7 Reverse -384 -392 8.96754 0.0463
NP_441111.1_7 Reverse -266 -274 8.96754 0.0463
NP_441111.1_7 Reverse -137 -145 8.86921 0.0589
NP_441766.1_2 Forward -274 -265 16.2243 0.0047
NP_441766.1_2 Reverse -136 -145 14.7494 0.00772
NP_441766.1_2 Reverse -265 -274 9.14451 0.0337
NP_441766.1_2 Reverse -383 -392 8.65285 0.0495
NP_441766.1_2 Forward -85 -76 6.5879 0.0918
NP_442417.1_5 Reverse -136 -150 8.75105 0.147
NP_442252.1_3 Forward -399 -381 9.75391 0.235
NP_440416.1_1 Forward -392 -373 5.50599 0.0584
NP_440416.1_9 Forward -152 -133 -13.8652 0.171
NP_440416.1_9 Reverse -368 -387 -14.8485 0.18
NP_440416.1_9 Reverse -258 -277 -16.7168 0.22
NP_443052.1_8 Forward -284 -265 -3.93378 0.109
NP_440591.1_9 Reverse -376 -394 7.00065 0.214
NP_442154.1_1 Reverse -289 -307 -18.9587 0.288
NP_440261.1_5 Forward -273 -260 6.60746 0.0318
NP_440261.1_5 Reverse -266 -279 6.50913 0.0332
NP_440261.1_5 Forward -207 -194 -2.83231 0.0932
NP_440261.1_5 Forward -144 -131 -10.7971 0.21
NP_440261.1_5 Reverse -384 -397 -10.8955 0.221
NP_440261.1_5 Forward -181 -168 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCAAGCGGCGATCGTGGGTTTCCAGAGCCGAGAGTCGGGTATTAATGGTCGCGGTCCCATCTCCGGTAGGGTGTTTCACTATTTACCGCCTCGTCCACCCCAAATTCACCAAGCTGTGTTTCAGTGCGATCGCCAAGAAGTAATGGAATTTACTAATTCCCCTGATTTTTTGCGGATTCTTTTGCAAATTAGCGATGCCCCTGTGGATGCCCTGATTGCCGCCGCCCTCAGGGAAATTTATCTTCTCCGCCAAGGCGATCGGGCCTGGCTAGTAACCGTCGGCCGTCACCTTAGTTTGCTCCTCAAAGATGACTACGATCGCCTACGCCATATCCTTGGTCAAGTTCATTTTTAGGGACGACGATGGTCCCATTTCGGAGTAGCGGCACCAAAGAATT

CDS

ATGCGAATTTTATCTAATGTTAATCTGATGGGACTATTGATAGTCCTCCTGGCCGCTATCTTCTTTTGTTTTCATAACGTCATTGTCCGGATTTTATATTCCCAGCAAAATATTTTGGGCATTTGGCAAGTTGGCGGTTTCGTGACCCCTACCCTGAGCCACTCCTTTCTTCTTCTACTATTGAGAATGCTTTGGGTTGTGCCTCTCATGGCCTTAATTTCCCAACGCCTTTATGGCAATACTTGGCGGGAAATTAATCAACTAAAACAACCAGTTAATCGTCCGGTAATTTGGGAGGCCATGGGTTGTGGATTTTTAATGTTTCTCTACCTAGTCTTACTCTACATTTCCATTAGCTTTATTCCCACTGGTATCGCCATCACTCTATTTTTTACTTACCCAATCTTTACTGCATTATTAGCATGGCGGTTATTTAACGATGTTCCCAGTTTATTGCGTTGGTTAGTGATTGGTTTAACTTTAATCGGCACATTTTTAACCATTCCCTATGCCTACGGTGGCGAGCAACAAACTTTAGTTTTGGGCGTTAGCACAGGCATTGCTTCGGGCATTGTCTATGCGGGCTATACGGTATTTGCCCAAAGGAGCTTTCAAAGACTCCATCCCGTTCCCTTCACCTGGATCAGTTTTGCCACCACGTTAATTCTGTCCATTCTTTGTTTAATCATTTGGCAACCCCATGAAGGTAATTTACCCTGGCTTGCCATCACCATTGGTTCCCTGTTGTCCGCTTTATTTACTTTGGCGGGCCATGTGCTCAATAACTGGGGTATCCATTTAATCGGTGCTAGTCGAGCGGCTATTATTGGGGCAACCAATCCCGCTTTGACGGTGGTGCTAGCAGGATTAGCTATTCAAGAAAGCCTCACCAATATCCAAATTTTCGGGGTATGCCTAGTTACGTTTAGCATTGCCTTGCTCAACTACGAAAAAGTTAGTCCCAGTACGGGAAAAAATTCCCTAAAATAG

Protein

MRILSNVNLMGLLIVLLAAIFFCFHNVIVRILYSQQNILGIWQVGGFVTPTLSHSFLLLLLRMLWVVPLMALISQRLYGNTWREINQLKQPVNRPVIWEAMGCGFLMFLYLVLLYISISFIPTGIAITLFFTYPIFTALLAWRLFNDVPSLLRWLVIGLTLIGTFLTIPYAYGGEQQTLVLGVSTGIASGIVYAGYTVFAQRSFQRLHPVPFTWISFATTLILSILCLIIWQPHEGNLPWLAITIGSLLSALFTLAGHVLNNWGIHLIGASRAAIIGATNPALTVVLAGLAIQESLTNIQIFGVCLVTFSIALLNYEKVSPSTGKNSLK