Your browser is old and dusty. Try Google Chrome!

Details for sll1298

ORF sll1298
Accession NP_440509.1
Symbol
Category Other
Definition putative carboxymethylenebutenolidase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -67 -81 11.111 0.253
NP_441061.1_2 Forward -75 -61 9.93102 0.0668
NP_441061.1_2 Reverse -68 -82 2.16287 0.178
NP_441061.1_2 Forward -346 -332 -2.45868 0.293
NP_441061.1_2 Forward -352 -338 -2.65535 0.3
NP_440557.1_1 Reverse -228 -247 -0.000545616 0.265
NP_440795.1_7 Forward -75 -68 14.6904 0.0123
NP_440795.1_7 Reverse -68 -75 14.6904 0.0123
NP_441418.1_6 Reverse -67 -86 -19.0768 0.0844
NP_441418.1_6 Reverse -329 -348 -28.8115 0.211
NP_441480.1_8 Reverse -331 -350 13.6675 0.271
NP_442291.1_5 Forward -77 -61 4.68009 0.0869
NP_442291.1_5 Reverse -66 -82 -2.49807 0.217
NP_441453.1_4 Forward -76 -68 16.6374 0.00633
NP_441453.1_4 Reverse -67 -75 16.539 0.00633
NP_442151.1_6 Reverse -338 -352 6.58777 0.228
NP_442151.1_6 Forward -236 -222 5.80112 0.262
NP_441818.1_1 Forward -75 -64 9.69459 0.232
NP_441818.1_9 Reverse -326 -345 -3.83545 0.232
NP_440226.1_1 Reverse -67 -86 5.99764 0.139
NP_441465.1_8 Reverse -56 -74 6.01734 0.279
NP_442173.1_1 Reverse -68 -76 17.3257 0.00633
NP_442173.1_1 Forward -75 -67 15.4574 0.00633
NP_442752.1_4 Reverse -67 -74 13.8055 0.0199
NP_443027.1_4 Forward -78 -68 16.7946 0.0437
NP_443027.1_4 Reverse -65 -75 14.828 0.0437
NP_442975.1_10 Forward -80 -66 11.307 0.0508
NP_442975.1_10 Reverse -63 -77 4.22722 0.245
NP_440784.1_7 Forward -75 -68 15.9687 0.0123
NP_440784.1_7 Reverse -68 -75 15.9687 0.0123
NP_442909.1_7 Forward -352 -338 5.30886 0.289
NP_440061.1_9 Forward -355 -341 5.30886 0.29
NP_442062.1_8 Forward -76 -66 16.9913 0.00317
NP_442062.1_8 Reverse -67 -77 10.0098 0.0527
NP_442062.1_8 Forward -182 -172 6.17489 0.136
NP_441859.1_3 Reverse -66 -85 7.96345 0.147
NP_440304.1_4 Reverse -65 -75 10.8948 0.051
NP_440304.1_4 Forward -78 -68 9.22315 0.06
NP_442242.1_4 Forward -75 -68 14.3954 0.0124
NP_442242.1_4 Reverse -68 -75 14.3954 0.0124
NP_440044.1_8 Forward -343 -324 2.3594 0.153
NP_440044.1_8 Forward -75 -56 -2.26216 0.261
NP_440044.1_8 Reverse -68 -87 -2.65548 0.265
NP_442602.1_3 Reverse -249 -268 -2.45882 0.258
NP_439918.1_3 Reverse -304 -323 4.22769 0.264
NP_441161.1_3 Reverse -61 -79 8.7706 0.251
NP_441619.1_8 Reverse -61 -75 6.98048 0.295
NP_441594.1_6 Reverse -335 -354 6.29264 0.193
NP_441594.1_6 Forward -85 -66 2.94938 0.239
NP_442110.1_7 Reverse -67 -81 2.06454 0.222
NP_441082.1_10 Reverse -137 -150 10.8357 0.236
NP_441925.1_4 Forward -320 -301 -16.4225 0.282
NP_441083.1_5 Forward -76 -66 2.14332 0.195
NP_441083.1_5 Reverse -67 -77 1.455 0.205
NP_441149.1_9 Forward -368 -349 0.686995 0.231
NP_441738.1_2 Forward -74 -67 15.28 0.0102
NP_441738.1_2 Reverse -69 -76 11.5435 0.084
NP_441955.1_8 Forward -188 -171 6.13536 0.281
NP_440209.1_1 Reverse -67 -75 18.1123 0.00295
NP_440209.1_1 Forward -76 -68 8.57422 0.0425
NP_440447.1_1 Forward -312 -294 5.62401 0.194
NP_442675.1_4 Forward -355 -337 14.9655 0.039
NP_441770.1_5 Forward -84 -65 -0.4922 0.247
NP_441327.1_1 Forward -132 -113 5.36669 0.255
NP_442111.1_3 Reverse -159 -172 13.0487 0.267
NP_442111.1_4 Forward -77 -63 4.91614 0.185
NP_441533.1_4 Forward -280 -263 16.1903 0.244
NP_440906.1_5 Forward -75 -68 15.8704 0.0124
NP_440906.1_5 Reverse -68 -75 15.8704 0.0124
NP_440747.1_10 Forward -79 -67 -11.6624 0.131
NP_440747.1_10 Reverse -64 -76 -11.8591 0.161
NP_440747.1_10 Forward -185 -173 -11.9574 0.178
NP_441130.1_7 Forward -352 -338 17.9935 0.287
NP_441130.1_10 Reverse -65 -79 10.816 0.11
NP_441130.1_10 Forward -184 -170 5.50613 0.227
NP_442973.1_5 Reverse -58 -77 20.8456 0.0357
NP_441486.1_1 Reverse -64 -78 5.80112 0.0344
NP_441486.1_1 Forward -79 -65 1.17956 0.117
NP_441486.1_1 Reverse -170 -184 -1.8687 0.175
NP_442634.1_4 Reverse -65 -79 -2.55701 0.153
NP_442634.1_4 Forward -78 -64 -4.22864 0.19
NP_440403.1_4 Forward -85 -66 -4.03212 0.203
NP_440403.1_10 Forward -347 -328 4.03102 0.268
NP_441014.1_10 Forward -268 -249 7.96345 0.139
NP_442848.1_1 Reverse -61 -75 4.71948 0.0968
NP_442848.1_1 Forward -82 -68 4.32615 0.106
NP_443018.1_3 Forward -75 -68 14.8871 0.0123
NP_443018.1_3 Reverse -68 -75 14.8871 0.0123
NP_443018.1_3 Forward -181 -174 4.26735 0.267
NP_443018.1_3 Reverse -174 -181 4.16902 0.278
NP_441316.1_7 Reverse -65 -80 -1.88839 0.24
NP_441634.1_8 Forward -184 -170 -3.04867 0.295
NP_440376.1_1 Forward -76 -67 9.73449 0.0365
NP_440376.1_1 Reverse -67 -76 9.63616 0.0385
NP_440376.1_1 Forward -182 -173 4.62128 0.154
NP_441857.1_5 Forward -83 -65 4.14905 0.222
NP_441588.1_4 Reverse -69 -79 7.35486 0.178
NP_441588.1_4 Forward -74 -64 6.96153 0.178
NP_442687.1_7 Reverse -66 -76 14.828 0.0247
NP_442687.1_7 Forward -332 -322 10.1081 0.0994
NP_442687.1_7 Forward -339 -329 7.64985 0.127
NP_441077.1_6 Reverse -185 -201 9.64675 0.167
NP_441077.1_6 Forward -219 -203 2.70546 0.276
NP_442485.1_3 Reverse -56 -75 -0.590531 0.253
NP_441422.1_7 Forward -355 -338 3.0871 0.112
NP_442658.1_1 Reverse -65 -75 15.9091 0.00966
NP_442658.1_1 Forward -78 -68 15.0242 0.0188
NP_442658.1_1 Forward -184 -174 6.86274 0.214
NP_440141.1_8 Reverse -329 -348 6.09597 0.271
NP_442205.1_9 Reverse -61 -77 -2.10475 0.268
NP_440656.1_8 Reverse -56 -75 -4.22878 0.198
NP_441414.1_9 Forward -76 -57 -8.94866 0.249
NP_441958.1_5 Forward -77 -67 11.4848 0.00522
NP_441958.1_5 Reverse -66 -76 10.9931 0.00875
NP_441127.1_1 Reverse -335 -349 11.2093 0.232
NP_442836.1_5 Forward -82 -63 13.9625 0.0588
NP_439905.1_1 Forward -352 -339 13.6873 0.155
NP_439905.1_1 Reverse -174 -187 9.55739 0.216
NP_439990.1_1 Reverse -346 -365 11.0125 0.26
NP_439990.1_5 Forward -81 -68 6.80412 0.221
NP_442690.1_1 Forward -222 -203 -15.8318 0.28
NP_442911.1_2 Reverse -57 -76 -10.0303 0.268
NP_441580.1_6 Forward -87 -68 -4.32711 0.235
NP_440153.1_5 Forward -75 -61 6.98109 0.174
NP_440153.1_5 Reverse -68 -82 0.88457 0.288
NP_440153.1_8 Forward -344 -331 -3.12731 0.285
NP_443055.1_3 Forward -85 -66 15.8971 0.0848
NP_440993.1_2 Forward -81 -65 14.6115 0.0631
NP_440062.1_9 Forward -385 -366 10.7175 0.288
NP_440602.1_8 Forward -76 -62 17.8958 0.0898
NP_441099.1_5 Forward -86 -67 -12.2919 0.299
NP_442002.1_9 Reverse -66 -73 10.7572 0.185
NP_441654.1_7 Reverse -185 -204 14.179 0.208
NP_442438.1_10 Reverse -330 -344 2.45787 0.176
NP_442438.1_10 Reverse -62 -76 1.47456 0.194
NP_442438.1_10 Forward -81 -67 -0.590395 0.269
NP_442431.1_10 Reverse -332 -350 1.88744 0.246
NP_441000.1_6 Forward -77 -63 -1.77037 0.215
NP_441000.1_6 Reverse -66 -80 -5.31028 0.273
NP_440147.1_4 Reverse -65 -78 10.1474 0.0355
NP_440147.1_4 Forward -323 -310 2.18257 0.209
NP_440147.1_4 Forward -78 -65 0.314277 0.257
NP_441550.1_8 Forward -78 -68 12.6642 0.0325
NP_441550.1_8 Reverse -65 -75 6.0761 0.214
NP_441916.1_7 Forward -76 -66 19.1546 0.00144
NP_441916.1_7 Reverse -67 -77 16.893 0.00407
NP_441916.1_10 Reverse -177 -196 2.0644 0.253
NP_441041.1_4 Reverse -329 -348 -9.24366 0.214
NP_441041.1_4 Reverse -323 -342 -12.7836 0.274
NP_441041.1_7 Forward -79 -67 17.4269 0.00864
NP_441041.1_7 Reverse -64 -76 7.61196 0.162
NP_442396.1_5 Reverse -63 -76 6.90245 0.215
NP_441547.1_2 Reverse -56 -74 6.41066 0.215
NP_440703.1_9 Forward -151 -138 6.50855 0.285
NP_441725.1_4 Forward -81 -67 3.24392 0.279
NP_441725.1_5 Forward -75 -65 11.2881 0.0247
NP_441725.1_5 Reverse -68 -78 -0.118297 0.232
NP_439966.1_7 Reverse -65 -75 18.4657 0.00473
NP_439966.1_7 Forward -78 -68 5.58445 0.216
NP_439966.1_9 Forward -78 -69 0.983037 0.253
NP_439966.1_9 Reverse -65 -74 0.983037 0.253
NP_440736.1_3 Forward -78 -59 -1.27885 0.282
NP_442941.1_3 Forward -75 -65 11.4848 0.0116
NP_442941.1_3 Reverse -68 -78 8.4365 0.0356
NP_440289.1_2 Reverse -64 -77 5.23083 0.0636
NP_440289.1_2 Forward -79 -66 -3.91395 0.273
NP_440983.1_5 Forward -350 -331 7.96426 0.151
NP_442281.1_1 Forward -81 -67 16.1252 0.00915
NP_442281.1_1 Reverse -62 -76 8.55376 0.0798
NP_440177.1_1 Reverse -330 -348 2.57575 0.297
NP_440437.1_1 Forward -359 -340 -2.65548 0.22
NP_441644.1_6 Reverse -67 -77 9.616 0.0728
NP_441644.1_6 Forward -76 -66 7.74772 0.117
NP_440867.1_10 Reverse -233 -252 0.786102 0.299
NP_442215.1_2 Reverse -58 -74 0.156866 0.156
NP_441810.1_9 Forward -83 -64 -0.197208 0.3
NP_440929.1_8 Forward -76 -67 9.93116 0.0249
NP_440929.1_8 Reverse -67 -76 9.83282 0.0254
NP_440929.1_8 Reverse -173 -182 4.81794 0.176
NP_442933.1_2 Forward -309 -291 5.7315 0.291
NP_442933.1_10 Forward -76 -67 17.601 0.00325
NP_442933.1_10 Reverse -67 -76 17.601 0.00325
NP_441751.2_8 Forward -75 -61 16.7159 0.00876
NP_441751.2_8 Reverse -68 -82 4.22782 0.0521
NP_442926.1_1 Reverse -326 -345 -5.31042 0.278
NP_439922.1_3 Forward -281 -262 11.2199 0.202
NP_442554.1_8 Forward -75 -65 13.8447 0.0145
NP_442554.1_8 Reverse -68 -78 9.51814 0.0581
NP_442554.1_8 Reverse -174 -184 3.61828 0.218
NP_442554.1_8 Forward -35 -25 2.24165 0.276
NP_441762.1_7 Forward -77 -65 4.75886 0.0453
NP_441762.1_7 Reverse -66 -78 4.26721 0.0518
NP_441762.1_7 Forward -183 -171 -7.33585 0.287
NP_442142.1_4 Reverse -64 -77 14.8666 0.0302
NP_442142.1_4 Forward -79 -66 7.2952 0.143
NP_442292.1_1 Forward -75 -66 9.63616 0.0183
NP_442292.1_1 Reverse -68 -77 8.55452 0.035
NP_440511.1_1 Reverse -325 -343 25.3885 0.00453
NP_440895.1_6 Forward -398 -385 10.5407 0.202
NP_443009.1_5 Forward -77 -66 15.5944 0.0132
NP_443009.1_5 Reverse -66 -77 6.74468 0.15
NP_441715.1_4 Forward -75 -65 16.303 0.0117
NP_441715.1_4 Reverse -68 -78 5.97822 0.165
NP_441198.1_5 Reverse -69 -82 18.8982 0.206
NP_441198.1_8 Forward -78 -68 14.9316 0.0594
NP_441758.1_10 Reverse -213 -232 2.85027 0.189
NP_441468.1_1 Forward -75 -68 15.8704 0.0124
NP_441468.1_1 Reverse -68 -75 15.8704 0.0124
NP_441468.1_1 Forward -181 -174 4.36568 0.237
NP_441020.2_6 Forward -78 -61 9.47861 0.17
NP_441015.1_10 Reverse -339 -358 -8.85033 0.277
NP_441673.1_1 Forward -76 -67 11.1111 0.0121
NP_441673.1_1 Reverse -67 -76 11.0128 0.018
NP_441731.1_7 Forward -190 -171 1.17943 0.298
NP_441826.1_2 Reverse -61 -75 18.4858 0.0121
NP_441826.1_2 Forward -82 -68 4.22782 0.104
NP_442811.1_7 Reverse -301 -320 16.8141 0.262
NP_442868.1_6 Reverse -65 -75 0.963343 0.205
NP_442868.1_6 Forward -78 -68 -0.216628 0.273
NP_442719.1_2 Forward -201 -183 -7.65136 0.238
NP_440785.1_1 Reverse -154 -173 15.7324 0.0251
NP_442677.1_3 Forward -368 -349 -6.09707 0.287
NP_443058.1_7 Forward -393 -374 3.93269 0.26
NP_442427.1_3 Forward -81 -63 4.6407 0.171
NP_442808.1_1 Reverse -66 -76 8.63269 0.0481
NP_442808.1_1 Reverse -172 -182 5.97777 0.134
NP_440145.1_3 Forward -86 -67 6.58763 0.0509
NP_442050.1_5 Forward -78 -68 16.3025 0.0091
NP_442050.1_5 Reverse -65 -75 9.12434 0.193
NP_440630.1_5 Forward -203 -184 6.88262 0.274
NP_441518.1_3 Forward -86 -67 -15.1435 0.287
NP_441518.1_3 Reverse -57 -76 -15.8318 0.299
NP_441878.1_6 Forward -77 -67 0.766681 0.134
NP_441878.1_6 Reverse -66 -76 0.57002 0.14
NP_441878.1_6 Forward -183 -173 -7.29646 0.217
NP_441036.1_8 Forward -77 -67 15.418 0.00944
NP_441036.1_8 Reverse -66 -76 13.8447 0.0353
NP_441557.1_5 Reverse -67 -76 18.6826 0.0015
NP_441557.1_5 Forward -76 -67 10.5211 0.00695
NP_442066.2_4 Reverse -67 -86 7.57094 0.0828
NP_440084.1_8 Reverse -195 -209 11.0887 0.252
NP_441308.1_8 Reverse -65 -75 10.1081 0.22
NP_442183.1_1 Forward -76 -62 12.0943 0.0648
NP_442183.1_1 Reverse -67 -81 11.701 0.0693
NP_442347.1_2 Forward -75 -66 11.1111 0.056
NP_441037.1_4 Forward -78 -68 7.51261 0.237
NP_441037.1_4 Reverse -65 -75 7.02532 0.237
NP_441633.1_3 Reverse -65 -78 -3.91395 0.177
NP_441633.1_3 Forward -355 -342 -4.7006 0.209
NP_441633.1_3 Reverse -171 -184 -5.97891 0.236
NP_440136.1_2 Forward -75 -68 15.9687 0.0123
NP_440136.1_2 Reverse -68 -75 15.9687 0.0123
NP_442998.1_10 Forward -74 -67 15.5754 0.0102
NP_442998.1_10 Reverse -69 -76 5.74231 0.255
NP_440299.1_1 Reverse -63 -76 8.2785 0.0962
NP_441799.1_1 Reverse -63 -77 10.2254 0.0778
NP_441799.1_1 Forward -80 -66 6.58715 0.167
NP_441007.1_10 Reverse -330 -343 4.05085 0.182
NP_441007.1_10 Forward -81 -68 3.36254 0.182
NP_441007.1_10 Reverse -333 -346 1.88757 0.203
NP_442201.1_10 Reverse -56 -75 -13.1769 0.27
NP_440256.1_1 Forward -79 -60 4.62101 0.0429
NP_440256.1_1 Reverse -64 -83 -2.85214 0.123
NP_441559.1_8 Forward -187 -173 1.86788 0.153
NP_440525.1_1 Forward -235 -216 10.2259 0.224
NP_440915.1_6 Forward -80 -66 12.1926 0.0218
NP_440915.1_6 Reverse -63 -77 3.24451 0.104
NP_442158.1_4 Forward -116 -106 15.5163 0.156
NP_442866.1_4 Forward -376 -357 6.78429 0.209
NP_442993.1_1 Forward -76 -60 -7.41462 0.146
NP_442993.1_1 Reverse -67 -83 -7.70961 0.146
NP_442386.1_9 Reverse -66 -75 15.7322 0.0144
NP_442386.1_9 Reverse -172 -181 10.914 0.111
NP_442386.1_9 Forward -77 -68 7.37413 0.219
NP_441340.1_5 Forward -75 -68 15.6737 0.0124
NP_441340.1_5 Reverse -68 -75 15.6737 0.0124
NP_441340.1_5 Reverse -174 -181 4.07068 0.239
NP_441340.1_9 Reverse -121 -131 8.25522 0.256
NP_440146.1_2 Forward -82 -68 15.3392 0.23
NP_442240.1_1 Reverse -327 -346 11.0117 0.192
NP_440161.1_3 Forward -78 -59 7.57094 0.295
NP_440586.1_8 Forward -75 -68 13.2151 0.026
NP_440586.1_8 Reverse -68 -75 13.2151 0.026
NP_440586.1_8 Reverse -174 -181 7.70858 0.227
NP_442251.1_6 Forward -75 -68 15.2804 0.0124
NP_442251.1_6 Reverse -68 -75 15.2804 0.0124
NP_442251.1_6 Forward -256 -249 6.43063 0.298
NP_440684.1_9 Reverse -61 -75 16.5192 0.0691
NP_441262.1_3 Reverse -67 -74 14.7888 0.0223
NP_441262.1_3 Forward -76 -69 13.9038 0.0336
NP_440027.1_3 Forward -344 -326 7.98318 0.2
NP_440027.1_3 Forward -86 -68 3.36165 0.273
NP_443051.1_1 Reverse -66 -75 10.4228 0.00754
NP_443051.1_1 Forward -77 -68 10.2261 0.00842
NP_439984.1_10 Forward -346 -332 11.1104 0.253
NP_439937.1_8 Reverse -65 -84 -1.47551 0.249
NP_439937.1_8 Reverse -333 -352 -2.95047 0.264
NP_440408.1_7 Forward -60 -41 11.7992 0.213
NP_440439.1_1 Reverse -64 -77 8.77074 0.0497
NP_440439.1_1 Forward -79 -66 0.60927 0.182
NP_440372.1_2 Forward -75 -68 16.3621 0.0124
NP_440372.1_2 Reverse -68 -75 16.3621 0.0124
NP_441789.1_9 Reverse -335 -354 12.4875 0.191
NP_440819.1_5 Reverse -182 -190 17.424 0.185
NP_440819.1_5 Reverse -181 -189 6.41093 0.285
NP_440139.1_1 Reverse -61 -80 10.4217 0.0919
NP_441572.1_7 Forward -82 -63 2.55606 0.131
NP_440267.1_2 Forward -81 -67 5.01387 0.285
NP_442384.1_10 Forward -76 -63 6.90245 0.092
NP_442114.1_4 Forward -76 -65 10.3834 0.17
NP_442790.1_4 Forward -85 -66 -7.67036 0.156
NP_442790.1_4 Reverse -58 -77 -14.8485 0.282
NP_442262.1_10 Forward -75 -68 14.1988 0.0123
NP_442262.1_10 Reverse -68 -75 14.1988 0.0123
NP_441689.1_5 Forward -78 -68 10.6976 0.132
NP_441689.1_5 Reverse -65 -75 8.53436 0.132
NP_441689.1_5 Reverse -114 -124 4.99446 0.285
NP_440163.1_10 Reverse -64 -74 15.2213 0.0762
NP_440344.1_10 Forward -83 -66 -1.73112 0.0566
NP_440344.1_10 Reverse -60 -77 -7.72931 0.119
NP_440531.1_6 Forward -84 -65 -0.0988766 0.203
NP_440531.1_6 Forward -190 -171 -2.85214 0.258
NP_441965.1_10 Reverse -48 -64 2.8118 0.282
NP_440297.1_9 Forward -75 -65 9.32148 0.0917
NP_442280.1_10 Forward -124 -106 5.06482 0.291
NP_441896.1_3 Reverse -51 -70 1.47442 0.214
NP_441896.1_3 Reverse -164 -183 1.17943 0.22
NP_440999.1_9 Forward -80 -66 5.21113 0.113
NP_440999.1_9 Forward -357 -343 -2.75368 0.276
NP_440888.1_2 Forward -76 -62 14.5519 0.0168
NP_440888.1_2 Reverse -67 -81 12.8803 0.0369
NP_440600.1_4 Forward -84 -66 1.88744 0.125
NP_440491.1_1 Reverse -341 -360 7.50176 0.265
NP_442277.1_4 Reverse -58 -77 1.08032 0.286
NP_442512.1_4 Forward -39 -21 6.50899 0.286
NP_441543.1_2 Forward -75 -66 18.486 0.00236
NP_441543.1_2 Reverse -68 -77 12.8811 0.0311
NP_441543.1_2 Reverse -174 -183 6.78456 0.138
NP_442845.1_2 Forward -82 -68 12.1926 0.114
NP_442845.1_2 Reverse -61 -75 5.89945 0.22
NP_442845.1_6 Forward -157 -138 16.5182 0.103
NP_441551.1_5 Reverse -63 -79 8.90762 0.225
NP_441469.1_8 Reverse -66 -75 16.126 0.00797
NP_441469.1_8 Reverse -172 -181 5.80125 0.253
NP_441469.1_8 Forward -183 -174 5.70292 0.257
NP_442578.1_7 Forward -75 -68 14.5921 0.026
NP_442578.1_7 Reverse -68 -75 14.5921 0.026
NP_441462.1_2 Reverse -67 -77 19.2529 0.00159
NP_441462.1_2 Forward -76 -66 1.84832 0.081
NP_441621.1_7 Reverse -65 -79 -3.63866 0.192
NP_441621.1_7 Reverse -171 -185 -3.83532 0.195
NP_443062.1_1 Forward -76 -58 13.3238 0.0638
NP_443062.1_1 Reverse -67 -85 9.03346 0.142
NP_443062.1_6 Reverse -59 -78 4.12936 0.221
NP_440936.1_10 Forward -279 -260 8.83258 0.178
NP_440516.1_2 Reverse -167 -185 3.95239 0.142
NP_440516.1_8 Reverse -67 -76 9.4395 0.0183
NP_440516.1_8 Forward -76 -67 7.17789 0.0754
NP_442428.1_5 Forward -75 -68 15.8704 0.0124
NP_442428.1_5 Reverse -68 -75 15.8704 0.0124
NP_442428.1_5 Forward -181 -174 4.66067 0.244
NP_440673.1_3 Reverse -69 -76 14.0021 0.0426
NP_440673.1_3 Forward -74 -67 12.4288 0.0426
NP_440673.1_3 Reverse -331 -338 7.70893 0.249
NP_440673.1_3 Forward -351 -344 7.51227 0.252
NP_441714.1_3 Forward -83 -65 13.1947 0.248
NP_441052.1_2 Forward -76 -66 2.04498 0.22
NP_441052.1_2 Reverse -67 -77 0.57002 0.256
NP_442219.1_9 Reverse -68 -77 8.94785 0.0681
NP_442219.1_9 Forward -75 -66 8.35786 0.0681
NP_440436.1_4 Forward -75 -66 18.1905 0.00233
NP_440436.1_4 Reverse -68 -77 7.96411 0.119
NP_440436.1_4 Reverse -174 -183 5.80084 0.182
NP_441884.1_8 Reverse -66 -85 0.0977854 0.138
NP_441884.1_8 Reverse -324 -343 -11.8003 0.271
NP_441884.1_9 Reverse -64 -83 -13.2752 0.138
NP_441884.1_9 Forward -72 -53 -20.3551 0.183
NP_441719.1_2 Forward -128 -114 14.1173 0.278
NP_441719.1_4 Forward -75 -68 16.3621 0.0124
NP_441719.1_4 Reverse -68 -75 16.3621 0.0124
NP_441733.1_10 Forward -79 -66 16.2439 0.0489
NP_442813.1_2 Forward -29 -10 1.67108 0.25
NP_442813.1_4 Reverse -292 -311 -9.14533 0.299
NP_442366.1_3 Forward -77 -59 0.609134 0.167
NP_442366.1_3 Reverse -66 -84 -3.12744 0.242
NP_440129.1_10 Forward -345 -331 5.89945 0.185
NP_440129.1_10 Reverse -60 -74 3.53951 0.194
NP_442873.1_5 Forward -342 -323 13.9616 0.179
NP_441115.1_4 Forward -77 -59 7.58986 0.279
NP_442206.1_10 Reverse -67 -82 3.42148 0.185
NP_443054.1_2 Reverse -65 -79 2.65453 0.242
NP_443054.1_2 Forward -184 -170 -0.197071 0.288
NP_441851.1_10 Reverse -66 -76 17.188 0.00552
NP_441851.1_10 Forward -183 -173 4.79825 0.247
NP_442026.1_3 Forward -154 -135 2.16274 0.237
NP_442011.1_1 Reverse -66 -85 0.392778 0.268
NP_442856.1_7 Forward -362 -343 -3.63879 0.244
NP_442515.1_1 Forward -348 -334 -4.32697 0.298
NP_440165.1_5 Reverse -66 -85 11.1109 0.0486
NP_441349.1_10 Reverse -57 -76 10.8159 0.0232
NP_441107.1_10 Forward -348 -334 12.1926 0.297
NP_440432.1_9 Reverse -68 -83 5.78142 0.0512
NP_442843.1_1 Reverse -117 -136 -6.58872 0.245
NP_440474.1_8 Forward -75 -61 17.5018 0.0432
NP_440474.1_8 Forward -346 -332 4.91554 0.263
NP_440431.1_4 Reverse -186 -205 -9.97933 0.295
NP_442450.1_5 Reverse -65 -75 9.32148 0.115
NP_442243.1_1 Forward -334 -316 -0.374908 0.248
NP_441570.1_1 Reverse -67 -85 1.49411 0.0304
NP_441570.1_1 Reverse -338 -356 -7.94566 0.0989
NP_441570.1_1 Forward -76 -58 -15.8121 0.234
NP_441078.1_4 Forward -76 -67 9.93116 0.0203
NP_441078.1_4 Reverse -67 -76 9.83282 0.0226
NP_441078.1_4 Forward -182 -173 -1.86856 0.272
NP_442729.1_5 Reverse -334 -344 14.0414 0.22
NP_442388.1_2 Forward -218 -199 21.828 0.0495
NP_442443.1_4 Forward -254 -244 13.0576 0.264
NP_440526.1_3 Forward -364 -353 6.35136 0.205
NP_440526.1_3 Reverse -68 -79 2.31981 0.267
NP_440526.1_3 Forward -75 -64 1.92649 0.267
NP_441432.1_8 Reverse -343 -352 11.9961 0.0519
NP_441432.1_8 Reverse -66 -75 8.25953 0.0755
NP_441432.1_8 Forward -77 -68 7.07956 0.105
NP_441432.1_8 Forward -183 -174 2.75299 0.287
NP_442320.1_8 Forward -82 -68 5.1128 0.0437
NP_442320.1_8 Reverse -61 -75 4.52282 0.0482
NP_442003.1_4 Reverse -339 -358 16.3224 0.19
NP_442797.1_1 Forward -345 -326 -2.95047 0.264
NP_440199.1_10 Reverse -64 -74 14.533 0.0861
NP_441057.1_4 Reverse -328 -346 -1.65248 0.272
NP_441072.1_2 Forward -87 -68 6.88262 0.264
NP_442400.1_1 Forward -79 -60 -6.09707 0.299
NP_442400.1_10 Reverse -1 -14 8.56056 0.278
NP_440713.1_4 Forward -86 -67 2.85105 0.256
NP_442489.1_7 Forward -76 -67 10.4228 0.0151
NP_442489.1_7 Reverse -67 -76 10.3245 0.0193
NP_442489.1_7 Forward -182 -173 -1.37691 0.195
NP_440559.1_1 Reverse -68 -77 8.75118 0.0586
NP_440559.1_1 Forward -75 -66 8.75118 0.0586
NP_441659.2_8 Reverse -67 -77 11.2881 0.0189
NP_441659.2_8 Forward -76 -66 9.7148 0.0271
NP_441040.1_2 Reverse -327 -346 -5.11376 0.174
NP_442849.1_1 Reverse -342 -356 12.6843 0.201
NP_440708.1_6 Forward -360 -341 -2.45882 0.202
NP_441800.1_7 Forward -343 -325 -1.35749 0.242
NP_441800.1_7 Forward -352 -334 -3.71743 0.279
NP_442346.1_5 Forward -77 -67 14.1397 0.0164
NP_442346.1_5 Reverse -66 -76 8.53483 0.133
NP_440545.1_3 Forward -89 -72 -3.79607 0.212
NP_440545.1_3 Forward -80 -63 -4.97604 0.237
NP_440004.1_5 Forward -81 -62 15.0441 0.293
NP_441653.1_2 Forward -87 -68 2.65991 0.289
NP_441653.1_3 Forward -117 -103 12.1926 0.279
NP_440010.1_4 Forward -86 -67 -1.57461 0.267
NP_441888.1_7 Reverse -62 -76 3.53951 0.225
NP_441888.1_7 Forward -81 -67 1.76955 0.239
NP_441948.1_4 Reverse -166 -184 -1.25915 0.145
NP_441948.1_9 Reverse -346 -364 13.8838 0.249
NP_441047.1_2 Reverse -168 -187 -1.18052 0.267
NP_441833.1_4 Forward -75 -68 15.9687 0.0124
NP_441833.1_4 Reverse -68 -75 15.9687 0.0124
NP_441895.1_10 Reverse -261 -280 -19.3717 0.282
NP_442162.1_9 Forward -75 -68 16.2637 0.0124
NP_442162.1_9 Reverse -68 -75 16.2637 0.0124
NP_440671.1_4 Reverse -61 -75 17.9942 0.0156
NP_440671.1_4 Forward -82 -68 7.17775 0.226
NP_442140.1_3 Forward -75 -65 8.33817 0.119
NP_442140.1_3 Reverse -68 -78 7.64985 0.133
NP_442140.1_3 Reverse -336 -346 7.35486 0.142
NP_442140.1_3 Forward -181 -171 6.66654 0.159
NP_440875.1_9 Reverse -69 -79 13.2389 0.0789
NP_440875.1_9 Forward -74 -64 8.37203 0.233
NP_441813.1_5 Reverse -65 -75 17.188 0.00979
NP_441813.1_5 Forward -78 -68 7.94484 0.0517
NP_441813.1_5 Forward -184 -174 0.176696 0.215
NP_442089.1_6 Reverse -67 -86 2.94938 0.281
NP_440590.1_4 Forward -75 -62 -3.81562 0.255
NP_440590.1_4 Reverse -68 -81 -4.20895 0.258
NP_440567.1_1 Forward -75 -61 14.3559 0.0187
NP_440567.1_1 Reverse -68 -82 13.5693 0.0212
NP_442497.1_10 Reverse -68 -77 15.7327 0.0087
NP_442497.1_10 Forward -75 -66 10.4228 0.0087
NP_440821.1_4 Reverse -65 -75 19.0562 0.00399
NP_440821.1_4 Forward -78 -68 2.04498 0.131
NP_441239.1_9 Forward -78 -66 15.8703 0.0178
NP_441239.1_9 Reverse -65 -77 9.18376 0.113
NP_441239.1_9 Reverse -171 -183 6.03717 0.202
NP_441239.1_9 Forward -184 -172 3.08724 0.296
NP_440706.1_1 Forward -80 -61 -3.83545 0.258
NP_441892.1_1 Forward -85 -68 20.7867 0.0156
NP_442643.1_1 Reverse -61 -80 -11.7019 0.231
NP_442138.1_10 Reverse -67 -86 16.3224 0.0229
NP_440546.1_4 Reverse -67 -77 15.1848 0.0459
NP_440546.1_4 Forward -76 -66 12.6639 0.0641
NP_440462.1_6 Forward -78 -68 18.7612 0.00454
NP_440462.1_6 Reverse -65 -75 15.418 0.0142
NP_442340.1_3 Forward -351 -332 -7.57203 0.236
NP_442144.1_1 Forward -39 -23 17.1681 0.152
NP_440868.1_4 Reverse -63 -75 8.79043 0.0582
NP_440868.1_4 Forward -186 -174 0.333971 0.217
NP_441249.1_1 Forward -373 -354 4.42435 0.197
NP_442402.1_4 Reverse -218 -237 -9.04772 0.285
NP_441848.1_7 Forward -135 -116 -1.18128 0.246
NP_441084.1_6 Forward -78 -64 10.8954 0.226
NP_440653.1_10 Reverse -247 -266 3.53937 0.271
NP_442039.1_4 Forward -75 -68 15.1821 0.0124
NP_442039.1_4 Reverse -68 -75 15.1821 0.0124
NP_442039.1_7 Forward -180 -170 7.84651 0.271
NP_442679.1_1 Reverse -109 -128 -0.885524 0.226
NP_442679.1_1 Reverse -110 -129 -2.95047 0.245
NP_442409.1_3 Reverse -373 -392 15.7324 0.245
NP_440825.1_7 Forward -256 -246 12.2265 0.177
NP_442837.1_3 Forward -75 -68 15.7721 0.0124
NP_442837.1_3 Reverse -68 -75 15.7721 0.0124
NP_442053.1_1 Reverse -67 -76 9.24284 0.068
NP_442053.1_1 Forward -76 -67 8.94785 0.07
NP_440505.1_3 Reverse -65 -75 13.8447 0.0247
NP_440505.1_3 Forward -78 -68 5.68323 0.217
NP_441102.1_8 Reverse -131 -150 19.3707 0.175
NP_442532.1_7 Reverse -67 -81 5.30946 0.171
NP_440914.1_1 Forward -76 -66 7.34642 0.241
NP_440914.1_1 Reverse -67 -77 7.24882 0.242
NP_441011.1_8 Reverse -68 -77 17.896 0.00602
NP_441011.1_8 Forward -75 -66 16.9127 0.00602
NP_441011.1_8 Reverse -319 -328 8.06287 0.16
NP_442533.1_6 Reverse -67 -76 15.1427 0.00675
NP_442533.1_6 Forward -76 -67 7.47288 0.0898
NP_442232.1_4 Forward -109 -90 13.4708 0.17
NP_441482.1_7 Reverse -61 -75 -10.8168 0.216
NP_441482.1_7 Forward -82 -68 -12.2918 0.292
NP_439944.1_9 Reverse -68 -78 16.1063 0.0127
NP_439944.1_9 Forward -75 -65 10.3048 0.0887
NP_441697.1_5 Forward -286 -267 -11.1252 0.292
NP_441697.1_5 Forward -218 -199 -11.1252 0.292
NP_441028.1_6 Forward -164 -154 8.43603 0.216
NP_442202.1_10 Reverse -172 -186 2.94952 0.282
NP_441527.1_4 Reverse -186 -205 -4.15432 0.179
NP_441527.1_4 Reverse -110 -129 -7.40105 0.232
NP_441527.1_4 Reverse -113 -132 -7.68752 0.236
NP_441527.1_4 Forward -310 -291 -9.1199 0.255
NP_441527.1_4 Forward -307 -288 -10.7433 0.274
NP_441527.1_4 Reverse -112 -131 -11.2207 0.278
NP_441527.1_4 Reverse -252 -271 -12.0802 0.285
NP_441527.1_4 Reverse -185 -204 -13.0351 0.298
NP_441527.1_4 Reverse -109 -128 -13.1306 0.298
NP_440115.1_6 Reverse -341 -351 13.0581 0.0818
NP_440115.1_6 Forward -79 -69 6.56821 0.178
NP_440007.1_9 Reverse -63 -77 1.57289 0.285
NP_440608.1_6 Forward -352 -333 6.68515 0.238
NP_441106.1_1 Reverse -66 -75 18.191 0.0028
NP_441106.1_1 Forward -77 -68 17.601 0.00462
NP_441106.1_1 Forward -183 -174 5.50626 0.145
NP_441869.1_2 Forward -189 -170 11.7992 0.232
NP_439903.1_6 Forward -79 -60 0.785326 0.256
NP_439903.1_7 Forward -185 -166 3.04771 0.281
NP_440797.1_2 Reverse -56 -75 14.1282 0.215
NP_441286.1_1 Forward -77 -65 -4.09092 0.149
NP_441286.1_1 Reverse -66 -78 -4.09092 0.149
NP_440670.1_8 Reverse -67 -76 8.94785 0.0606
NP_440670.1_8 Forward -76 -67 8.84951 0.0606
NP_440886.1_7 Reverse -66 -76 8.43603 0.0805
NP_439995.1_5 Reverse -57 -76 4.42435 0.285
NP_442072.1_9 Reverse -66 -84 -13.3539 0.11
NP_442072.1_9 Reverse -59 -77 -14.2388 0.137
NP_442072.1_9 Forward -77 -59 -22.6953 0.253
NP_442401.1_4 Reverse -142 -152 15.1326 0.291
NP_442213.1_5 Reverse -327 -346 -2.36049 0.295
NP_440907.2_8 Reverse -68 -78 16.3025 0.0161
NP_440907.2_8 Forward -75 -65 7.84605 0.117
NP_441463.1_3 Reverse -57 -76 -3.93378 0.189
NP_441626.1_2 Forward -75 -68 15.7721 0.0124
NP_441626.1_2 Reverse -68 -75 15.7721 0.0124
NP_442365.1_5 Forward -75 -56 12.2908 0.133
NP_440107.1_5 Reverse -60 -79 3.34271 0.175
NP_442615.1_1 Reverse -58 -76 -4.60241 0.19
NP_441962.1_4 Forward -81 -62 -8.35868 0.199
NP_441962.1_4 Reverse -330 -349 -13.9635 0.28
NP_440387.1_1 Reverse -67 -83 0.255197 0.129
NP_440387.1_1 Forward -76 -60 -1.21977 0.142
NP_441431.1_2 Forward -185 -171 6.68548 0.263
NP_441431.1_2 Forward -79 -65 6.58715 0.266
NP_441431.1_2 Reverse -64 -78 5.99717 0.281
NP_440114.1_10 Forward -76 -62 14.1593 0.0429
NP_440114.1_10 Reverse -67 -81 7.37441 0.236
NP_441510.2_7 Forward -344 -330 15.4369 0.28
NP_440766.1_4 Forward -80 -66 9.73436 0.0871
NP_441531.1_7 Reverse -323 -342 24.9755 0.00291
NP_442930.1_1 Forward -275 -265 9.91099 0.28
NP_440457.1_1 Reverse -63 -75 9.57708 0.092
NP_440798.1_6 Reverse -319 -332 0.412608 0.267
NP_441436.1_2 Reverse -341 -360 -6.68705 0.296
NP_441436.1_6 Reverse -67 -86 7.66927 0.26
NP_440473.1_9 Forward -87 -68 2.3594 0.0985
NP_440473.1_9 Reverse -56 -75 -6.78538 0.236
NP_442509.1_9 Forward -76 -66 6.66608 0.259
NP_442509.1_9 Reverse -60 -70 6.17443 0.286
NP_442936.1_10 Forward -278 -264 11.9436 0.226
NP_442514.1_5 Reverse -19 -38 -9.14605 0.294
NP_440554.1_4 Reverse -68 -78 17.4829 0.0175
NP_440554.1_4 Forward -75 -65 14.6313 0.02
NP_440554.1_4 Reverse -174 -184 4.10993 0.201
NP_442862.1_3 Forward -193 -176 6.52869 0.263
NP_441885.1_5 Reverse -67 -77 10.1081 0.0145
NP_441885.1_5 Forward -76 -66 1.74999 0.0991
NP_442703.1_4 Forward -76 -57 2.35861 0.283
NP_442341.1_7 Reverse -66 -80 2.94952 0.239
NP_440409.1_1 Reverse -336 -355 -0.4922 0.216
NP_440423.1_6 Reverse -336 -355 -12.3902 0.195
NP_440423.1_6 Forward -84 -65 -12.9802 0.204
NP_443000.1_7 Forward -78 -68 10.1081 0.0376
NP_443000.1_7 Reverse -65 -75 8.73149 0.0437
NP_441842.1_10 Reverse -60 -74 6.88276 0.271
NP_440275.1_3 Forward -78 -68 10.1081 0.0449
NP_440275.1_3 Reverse -65 -75 8.4365 0.0602
NP_440091.1_1 Reverse -63 -75 20.1968 0.00953
NP_440091.1_1 Forward -80 -68 5.54551 0.114
NP_440679.1_10 Reverse -331 -350 -17.8968 0.275
NP_443010.1_10 Forward -79 -62 15.0433 0.0582
NP_443010.1_10 Reverse -64 -81 5.66981 0.202
NP_441105.1_3 Forward -87 -68 -1.96717 0.154
NP_441105.1_3 Reverse -56 -75 -7.86702 0.261
NP_440216.1_1 Forward -76 -62 -2.16369 0.0482
NP_440216.1_1 Reverse -67 -81 -11.7018 0.212
NP_440216.1_9 Reverse -106 -115 11.0128 0.284
NP_440216.1_9 Reverse -107 -116 6.19458 0.289
NP_440172.1_1 Reverse -67 -77 19.8429 0.00421
NP_442015.1_10 Forward -357 -344 -0.865694 0.285
NP_441226.1_7 Forward -75 -68 14.4934 0.0123
NP_441226.1_7 Reverse -68 -75 14.4934 0.0123
NP_441226.1_7 Reverse -174 -181 11.2485 0.0971
NP_441111.1_7 Forward -75 -67 18.7023 0.00294
NP_441111.1_7 Reverse -68 -76 8.86921 0.0589
NP_441111.1_7 Reverse -174 -182 -0.570565 0.233
NP_442379.1_10 Forward -83 -66 -1.53445 0.223
NP_441766.1_2 Reverse -67 -76 17.896 0.00297
NP_441766.1_2 Forward -76 -67 9.4395 0.0285
NP_442417.1_5 Reverse -329 -343 6.58777 0.216
NP_442179.1_3 Reverse -319 -338 9.0459 0.214
NP_443052.1_9 Forward -345 -326 6.09597 0.138
NP_440591.1_9 Reverse -60 -78 3.95239 0.294
NP_442154.1_1 Reverse -327 -345 -15.6155 0.222
NP_440261.1_5 Reverse -174 -187 -4.89726 0.178
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTTCTTGCTGTTCGATGTTCTGTTGAGTGGGTTGACCTTCCTCCCTCTGATTGCCACCACCGCAACCGGTAACCGTTAGCAAACAGCCCACAACAAGCAAAGACAAAAGTAAGCTGGGTTTAAACATTATTTTCAATTCCCTTAGATTGCAAAAAACACAACGGTGGTTACCTTTAAGTAACAACAGTTACAATTTGTGATTTTAACGTTTTTCCCGGCGTTGGCAGATAATGTTTTCCCTCTGGGAGCCTAAATCCAGCAGACGTAAATTTCTCCTATTGCTTTTTCATGGGGCCCACAAGCGGAATTAGTAGCCGACAGAAGCGATCGCCGTTCTCAGACAGGGCTTTCAGTACAGATTTTGAGATAGGCTAGGAGTTATTATTTCCGGGTAGTTT

CDS

ATGACTGTTGACATCAAGACCACCTTGGTCACCATTCCCAACCAAAATTTGCAAATTGCAGGCTATTTGGCCGAGCCGGTGGCCGTGGGTCAATATCCCGTGGTGATTGTGATTCAGGAAATTTTTGGAGTTAATAGCCATATCCGGGACGTGACAGAACGGGTGGCTAAAGAAGGTTACGTGGCGATCGCCCCGGCCATTTATCAACGGCAAGCGCCAGGTTTTGAAGAGGGTTATACCCCAGAAGGTATTGAAGCGGGTAGAAAGCTCAAAGATCAGACTAGTAGTGCAGAAATTTTGAGCGATCTGGAAGCCACCATTGCCTACGCCCAAACTTTACCCAACGTTAAACCGGAAGAAGTAGGATTAATTGGTTTTTGTTTTGGTGGTTGGATTGTCTATTTAGGGGCTAGTTTACCCACAGTCAAGGCCACGGCTTCCTTTTACGGCGCGGGTATTCCCCATTGGGCTCCAGGGACAGCGGAACCGCCCATTACCTATACCGATAAAATTCAGGGCACTTTATACGCCTTCTTCGGCTTGGAAGATACCAGCATTCCCATGGCAGATACGGAGCAGATTGAACAGGCTTTAACCAAGTATCAGGTGAACCATAAAATTTTCCGTTACCCAGGCGCAGACCATGGCTTTTTCTGTGACCAAAGGGCTAGCTATAACGCCGAAGCGGCCGCCGATGCTTGGCAAAAAGTGAAACAACTTTTCCAAACCGAATTGAAATGA

Protein

MTVDIKTTLVTIPNQNLQIAGYLAEPVAVGQYPVVIVIQEIFGVNSHIRDVTERVAKEGYVAIAPAIYQRQAPGFEEGYTPEGIEAGRKLKDQTSSAEILSDLEATIAYAQTLPNVKPEEVGLIGFCFGGWIVYLGASLPTVKATASFYGAGIPHWAPGTAEPPITYTDKIQGTLYAFFGLEDTSIPMADTEQIEQALTKYQVNHKIFRYPGADHGFFCDQRASYNAEAAADAWQKVKQLFQTELK