Your browser is old and dusty. Try Google Chrome!

Details for sll1293

ORF sll1293
Accession NP_440520.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442291.1_5 Reverse -124 -140 -4.26803 0.269
NP_441623.1_1 Reverse -174 -192 -2.24246 0.241
NP_442151.1_6 Reverse -209 -223 8.35772 0.175
NP_440150.1_6 Reverse -231 -250 0.786102 0.296
NP_440996.1_3 Forward -76 -58 12.9005 0.221
NP_442655.1_2 Forward -394 -375 0.392778 0.293
NP_442975.1_10 Reverse -121 -135 3.53891 0.257
NP_441934.1_8 Forward -21 -2 10.9142 0.292
NP_441859.1_3 Forward -300 -281 5.50519 0.198
NP_441035.1_3 Reverse -92 -111 6.58763 0.209
NP_441935.1_1 Reverse -315 -334 4.916 0.293
NP_442896.1_6 Reverse -261 -280 17.8957 0.161
NP_442398.1_4 Reverse -179 -198 13.7649 0.139
NP_440747.1_10 Reverse -107 -119 -11.8591 0.161
NP_440403.1_10 Forward -122 -103 4.52268 0.255
NP_440842.1_10 Reverse -109 -123 3.93283 0.254
NP_440842.1_10 Forward -122 -108 2.2612 0.277
NP_441014.1_8 Reverse -104 -123 -3.04881 0.242
NP_442848.1_4 Forward -122 -108 8.45605 0.282
NP_443018.1_3 Reverse -325 -332 7.11894 0.16
NP_443018.1_3 Forward -74 -67 5.34899 0.212
NP_441634.1_8 Forward -329 -315 -3.04867 0.295
NP_441588.1_4 Reverse -176 -186 5.68323 0.245
NP_442088.1_4 Forward -298 -279 17.3057 0.196
NP_441013.1_2 Reverse -105 -123 -3.6191 0.29
NP_441422.1_7 Reverse -104 -121 -4.28772 0.24
NP_441763.1_5 Reverse -5 -24 -4.52377 0.24
NP_442653.1_8 Forward -178 -161 12.4285 0.3
NP_442937.1_5 Forward -173 -154 10.0292 0.173
NP_440610.1_2 Forward -292 -273 12.8808 0.219
NP_441127.1_1 Reverse -110 -124 9.2427 0.278
NP_441913.1_3 Forward -198 -185 15.3405 0.218
NP_442002.1_1 Forward -21 -3 -1.55415 0.196
NP_441294.1_7 Reverse -205 -219 8.48272 0.298
NP_442438.1_10 Forward -326 -312 -0.197071 0.253
NP_442771.1_1 Reverse -96 -114 -3.32411 0.166
NP_441110.1_1 Forward -302 -283 3.83436 0.297
NP_440569.1_7 Reverse -98 -117 8.16093 0.298
NP_440289.1_2 Forward -86 -73 2.57589 0.0936
NP_440260.1_8 Reverse -101 -119 -6.96235 0.295
NP_441164.1_4 Reverse -58 -77 13.5683 0.208
NP_441556.1_7 Forward -334 -315 3.14526 0.265
NP_441644.1_6 Forward -168 -158 8.73102 0.0944
NP_441644.1_6 Reverse -324 -334 5.68278 0.18
NP_442029.1_10 Reverse -186 -205 4.42435 0.292
NP_440891.1_8 Forward -287 -268 16.09 0.233
NP_442554.1_8 Forward -332 -322 3.71661 0.215
NP_440775.1_8 Reverse -87 -104 24.2274 0.0156
NP_440785.1_8 Forward -105 -88 17.0501 0.297
NP_442227.1_2 Reverse -97 -116 -2.95047 0.285
NP_442542.1_2 Reverse -72 -85 17.0305 0.0513
NP_442789.1_4 Reverse -55 -74 -5.9004 0.281
NP_441878.1_6 Forward -121 -111 -0.0199663 0.163
NP_441433.1_8 Forward -118 -99 1.27776 0.236
NP_442777.1_1 Forward -82 -63 14.4533 0.158
NP_441914.1_10 Forward -33 -14 8.4551 0.293
NP_441549.1_9 Forward -247 -229 -5.68405 0.198
NP_442645.1_2 Forward -36 -17 -17.6018 0.259
NP_442645.1_2 Forward -191 -172 -22.8133 0.296
NP_442047.1_2 Reverse -106 -120 15.9292 0.161
NP_440563.1_6 Forward -36 -23 20.1771 0.089
NP_442998.1_10 Forward -81 -74 10.4622 0.0819
NP_440299.1_1 Forward -138 -125 4.73861 0.201
NP_441799.1_1 Forward -247 -233 4.52221 0.247
NP_441435.1_4 Reverse -284 -303 7.66927 0.255
NP_441090.1_6 Forward -120 -106 17.6992 0.111
NP_441090.1_6 Forward -333 -319 10.9143 0.221
NP_440915.1_6 Reverse -106 -120 -1.27871 0.229
NP_442158.1_4 Reverse -141 -151 13.943 0.21
NP_441296.1_7 Forward -124 -105 12.5858 0.29
NP_442386.1_10 Forward -115 -102 3.16588 0.291
NP_442186.1_9 Reverse -150 -169 10.5209 0.205
NP_441271.1_8 Reverse -106 -116 16.4996 0.229
NP_439937.1_9 Reverse -179 -196 -1.04349 0.122
NP_439937.1_9 Reverse -180 -197 -9.59824 0.196
NP_439943.1_1 Forward -174 -155 -6.29373 0.237
NP_440316.1_10 Reverse -73 -83 8.33817 0.24
NP_441803.1_2 Forward -332 -313 -0.0988766 0.267
NP_441572.1_1 Forward -115 -96 -2.85214 0.212
NP_442384.1_10 Reverse -234 -247 6.50913 0.0995
NP_442384.1_10 Forward -296 -283 6.4108 0.102
NP_441018.1_7 Forward -247 -228 9.83255 0.218
NP_442790.1_4 Forward -21 -2 0.0977854 0.0927
NP_442262.1_10 Reverse -325 -332 8.20058 0.25
NP_442262.1_10 Forward -74 -67 7.6106 0.274
NP_440888.1_2 Forward -119 -105 10.422 0.0946
NP_441178.1_6 Reverse -101 -120 6.1935 0.268
NP_442966.1_3 Forward -191 -172 8.94757 0.29
NP_441918.1_7 Forward -141 -122 10.4225 0.211
NP_440148.1_1 Forward -201 -182 -6.29373 0.259
NP_441410.1_4 Reverse -268 -287 12.7816 0.23
NP_440519.1_3 Forward -139 -120 9.83255 0.268
NP_440516.1_8 Reverse -74 -83 -0.590259 0.283
NP_441052.1_2 Reverse -209 -219 2.04498 0.22
NP_441851.1_9 Forward -116 -97 13.1758 0.183
NP_441545.1_2 Forward -260 -241 15.4374 0.0213
NP_440347.1_3 Forward -101 -82 3.83436 0.3
NP_440347.1_7 Forward -257 -238 16.6174 0.169
NP_441668.1_4 Reverse -245 -264 1.96607 0.207
NP_442689.1_8 Reverse -267 -284 -7.82764 0.292
NP_442314.1_1 Forward -115 -97 0.904127 0.231
NP_439960.1_10 Reverse -103 -121 6.214 0.142
NP_442006.1_2 Forward -113 -96 -9.69592 0.197
NP_441003.1_9 Reverse -101 -120 3.44104 0.292
NP_442243.1_1 Reverse -104 -122 3.26332 0.204
NP_442348.1_2 Reverse -296 -305 11.9961 0.225
NP_441091.1_5 Reverse -314 -333 8.35759 0.19
NP_441432.1_8 Reverse -158 -167 2.55633 0.298
NP_441432.1_9 Reverse -133 -146 8.69532 0.287
NP_441732.1_2 Reverse -205 -221 -16.2644 0.165
NP_442797.1_7 Reverse -103 -121 4.9357 0.217
NP_440199.1_9 Forward -162 -143 19.8614 0.216
NP_440199.1_10 Forward -246 -236 6.8632 0.257
NP_440913.1_1 Forward -245 -227 4.44404 0.268
NP_442727.1_1 Reverse -137 -151 15.7325 0.199
NP_441659.2_8 Forward -168 -158 2.53664 0.198
NP_442913.1_10 Reverse -150 -169 -4.6221 0.242
NP_442346.1_5 Forward -219 -209 4.40493 0.29
NP_442346.1_10 Reverse -93 -112 4.916 0.168
NP_440486.1_6 Forward -120 -101 10.5209 0.219
NP_441943.1_8 Reverse -102 -121 -3.04881 0.183
NP_442551.1_4 Reverse -109 -124 -3.85501 0.297
NP_441671.1_1 Forward -302 -283 0.884433 0.263
NP_441239.1_9 Reverse -102 -114 4.8572 0.239
NP_441892.1_1 Reverse -102 -119 -6.15601 0.298
NP_440665.1_1 Reverse -98 -117 -5.60541 0.197
NP_440833.1_6 Forward -36 -22 7.47213 0.278
NP_441617.1_6 Forward -174 -155 -7.37537 0.292
NP_440546.1_4 Reverse -74 -84 8.97947 0.16
NP_441230.1_6 Forward -210 -191 9.73422 0.282
NP_441084.1_6 Reverse -157 -171 12.5437 0.16
NP_440696.1_3 Forward -193 -175 -4.20908 0.298
NP_440351.1_1 Forward -236 -217 -4.13045 0.277
NP_440520.1_1 Forward -122 -103 34.022 0.0000513
NP_440520.1_2 Forward -244 -226 24.7002 0.00424
NP_440520.1_3 Forward -388 -369 32.547 0.0000673
NP_440520.1_4 Forward -173 -154 28.8104 0.00117
NP_440520.1_5 Forward -99 -80 27.3355 0.00103
NP_440520.1_6 Forward -146 -127 26.0572 0.00467
NP_440520.1_7 Forward -212 -193 29.8921 0.000421
NP_440520.1_8 Forward -296 -277 29.6954 0.000194
NP_440520.1_9 Forward -268 -249 25.3688 0.0144
NP_440520.1_10 Forward -74 -55 22.0247 0.103
NP_440914.1_1 Reverse -234 -244 11.1525 0.105
NP_440914.1_1 Forward -305 -295 9.7862 0.172
NP_440914.1_1 Reverse -159 -169 8.71269 0.186
NP_442533.1_6 Reverse -324 -333 3.83464 0.202
NP_442533.1_6 Forward -119 -110 2.55633 0.25
NP_442541.1_10 Reverse -180 -194 6.78381 0.248
NP_442322.1_4 Reverse -104 -121 -8.71327 0.286
NP_441527.1_4 Forward -285 -266 -4.91826 0.191
NP_001035870.1_3 Reverse -63 -82 -5.21209 0.278
NP_442306.1_10 Reverse -154 -173 -20.5517 0.213
NP_442674.1_3 Forward -245 -226 2.6536 0.3
NP_440886.1_4 Reverse -110 -129 16.7157 0.183
NP_440907.2_8 Forward -82 -72 4.69947 0.25
NP_441463.1_3 Forward -38 -19 -8.85033 0.274
NP_441463.1_6 Forward -335 -321 7.96207 0.25
NP_441836.1_2 Forward -30 -11 5.11266 0.128
NP_441836.1_2 Forward -339 -320 -5.11376 0.272
NP_440114.1_10 Forward -190 -176 5.80112 0.292
NP_442867.1_8 Reverse -97 -116 5.30933 0.276
NP_442514.1_5 Reverse -103 -122 -2.65624 0.222
NP_441173.1_9 Forward -153 -145 11.0321 0.228
NP_442495.1_4 Forward -334 -324 13.353 0.191
NP_440416.1_9 Forward -122 -103 -18.3884 0.256
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGTGAAAACTGTTTTAGTTGTGGAAGATACCAAGTCTGACCAGTTATTGGTTCAGGGGCTTTTAAAGTCCATGGGCACAGAGGCTGTCATTTGTAACAATGCCGATGAAGCCCTGGAATGGTTAAACAAAAATACGGTGCCTGACCTAATTATGCTGGACATCGTTATGCCGGATATTAGTGGTTATGACCTATGTCGCAAAATTCGGGGAGAATTGGCCCTAGAAGATGTGCCCATTGTCTTCTGTTCCACCAAAAATGAGGATTACGACCGTTTTTGGGCCCTGCGCCAGGGGGGTAATGCTTATTTGATTAAGCCCTATAGCCCCATTGAGTTGATGAAAACCGTTAAGCCCTATATTTCCTAGAACTTGCCAATGCTGACTACGGTGATGAGGTT

CDS

ATGGTAGAGGACTATTTTTGGATTGATTTGGGTCTGCCCCTGACGGTGGCTATTCCTTTAGCTAAAACCCGGGAGGTGTTGTCCTTTCCCCTCAGTTCCCTTTGTCTCATTCCTGGGGTAAGACCGGAGTTATTGGGGGTGAGCAATCAACGGGGAAATCTGCTTTGGGTGATGGATTTGCCCCGCCTATTGTCCCCGGCTACGGCTAACCCCCTCAATTACCGTACCTTGAGCAATACTAAAGCAGTGGTACTGGTGGGAGAATCTGCCCAGGTGGCGGCGATCGCCGAAGGATTGAAGGGCATTGTTAGCTTTAGTACAGAGGAAATTAAGCCACTGCGGGAGCCCTTTTTATTGGGAGAAGGCAACAAAGACGGGGAAACCATTCTGATTTTGGATGTGGATCGAATTTTTGCCTGGCTCCAGGGTGGGGGTTCCATTAAACCGCTTCACCCATTGGAGAAATAG

Protein

MVEDYFWIDLGLPLTVAIPLAKTREVLSFPLSSLCLIPGVRPELLGVSNQRGNLLWVMDLPRLLSPATANPLNYRTLSNTKAVVLVGESAQVAAIAEGLKGIVSFSTEEIKPLREPFLLGEGNKDGETILILDVDRIFAWLQGGGSIKPLHPLEK