Your browser is old and dusty. Try Google Chrome!

Details for sll1291

ORF sll1291
Accession NP_440522.1
Symbol
Category two-component response regulator PatA subfamily
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Reverse -265 -272 11.6422 0.298
NP_441453.1_8 Forward -211 -194 10.0686 0.239
NP_441623.1_1 Forward -272 -254 -0.472507 0.23
NP_441818.1_9 Reverse -111 -130 -7.57203 0.272
NP_441098.1_3 Reverse -93 -112 3.73847 0.25
NP_441812.1_3 Forward -188 -174 6.98109 0.287
NP_442975.1_10 Reverse -192 -206 1.96562 0.288
NP_442000.2_10 Forward -217 -199 7.09898 0.286
NP_441145.1_1 Forward -22 -3 6.98095 0.254
NP_442062.1_3 Forward -117 -98 2.65439 0.212
NP_442062.1_3 Forward -94 -75 -2.55715 0.272
NP_442062.1_8 Reverse -12 -22 3.51995 0.267
NP_440761.1_4 Forward -215 -196 -20.7484 0.295
NP_441781.1_7 Forward -268 -249 -2.16383 0.288
NP_441434.1_1 Forward -90 -76 8.89237 0.251
NP_442889.1_8 Forward -134 -120 4.62054 0.26
NP_442889.1_10 Forward -99 -80 18.4891 0.147
NP_441713.1_1 Forward -274 -255 -9.93197 0.188
NP_442462.1_2 Forward -218 -199 4.22769 0.255
NP_441716.1_2 Forward -346 -327 -0.185394 0.268
NP_441327.1_1 Reverse -273 -292 6.03945 0.25
NP_441327.1_5 Forward -268 -259 14.2577 0.233
NP_441387.1_8 Forward -109 -90 14.1801 0.253
NP_441486.1_1 Reverse -217 -231 0.589577 0.132
NP_441486.1_1 Forward -232 -218 0.196253 0.143
NP_442145.1_4 Reverse -76 -95 7.68668 0.212
NP_442634.1_4 Reverse -109 -123 -3.44199 0.161
NP_442848.1_1 Reverse -6 -20 -3.54032 0.268
NP_441012.1_4 Reverse -374 -387 8.08242 0.272
NP_441588.1_4 Reverse -222 -232 5.48657 0.258
NP_442687.1_7 Forward -223 -213 5.19158 0.217
NP_440642.1_10 Reverse -304 -318 7.66879 0.221
NP_442658.1_1 Reverse -4 -14 9.22267 0.165
NP_440184.1_10 Reverse -81 -100 13.8633 0.206
NP_441127.1_1 Forward -295 -281 8.16106 0.3
NP_443001.1_7 Forward -307 -288 4.62101 0.279
NP_442690.1_1 Reverse -78 -97 -12.7836 0.249
NP_442690.1_1 Reverse -274 -293 -15.9302 0.282
NP_442690.1_1 Forward -194 -175 -16.9135 0.294
NP_440138.1_6 Reverse -35 -54 0.981987 0.291
NP_442598.1_1 Forward -103 -89 18.0925 0.126
NP_441550.1_8 Forward -224 -214 4.7978 0.283
NP_442996.1_7 Forward -94 -75 12.4153 0.296
NP_442004.1_6 Forward -55 -41 1.86788 0.276
NP_440260.1_8 Forward -58 -40 0.412472 0.2
NP_441514.1_1 Reverse -135 -145 14.536 0.274
NP_442177.1_5 Forward -207 -193 8.84938 0.267
NP_440253.1_2 Reverse -271 -289 2.57575 0.136
NP_442933.1_6 Forward -156 -137 13.7027 0.287
NP_442554.1_8 Reverse -123 -133 2.04498 0.285
NP_442142.1_4 Forward -18 -5 6.0169 0.175
NP_441525.1_1 Reverse -2 -15 11.7207 0.291
NP_442476.1_2 Reverse -281 -299 13.5383 0.265
NP_442271.1_1 Reverse -90 -108 17.3246 0.191
NP_441758.1_10 Forward -120 -101 -0.0996487 0.225
NP_441826.1_2 Reverse -6 -20 -2.06536 0.264
NP_441251.1_2 Reverse -194 -212 8.67227 0.291
NP_441433.1_8 Reverse -117 -136 -1.57384 0.262
NP_442347.1_2 Reverse -155 -164 3.7363 0.284
NP_442645.1_2 Forward -237 -218 -15.3402 0.197
NP_442888.1_6 Forward -240 -221 6.88262 0.216
NP_442998.1_5 Forward -267 -257 9.12481 0.252
NP_440899.1_2 Forward -279 -260 6.48849 0.266
NP_441027.1_1 Forward -267 -253 10.0287 0.299
NP_440684.1_9 Forward -228 -214 6.58777 0.298
NP_439937.1_9 Reverse -374 -391 -11.1715 0.245
NP_439937.1_9 Reverse -183 -200 -13.4331 0.286
NP_440522.1_4 Forward -396 -382 21.0424 0.164
NP_440522.1_5 Forward -274 -255 23.5989 0.0333
NP_440267.1_2 Forward -125 -111 17.2068 0.0445
NP_441689.1_5 Reverse -257 -267 5.38779 0.265
NP_440163.1_10 Reverse -9 -19 11.7798 0.169
NP_442917.1_1 Forward -98 -79 10.52 0.181
NP_440562.1_1 Reverse -217 -236 12.0933 0.269
NP_442280.1_10 Reverse -112 -130 10.4218 0.223
NP_442710.1_6 Forward -80 -61 8.94757 0.204
NP_442637.1_1 Forward -237 -218 -4.32711 0.168
NP_443064.1_6 Reverse -213 -223 12.6639 0.0796
NP_440220.1_4 Reverse -279 -298 0.0970122 0.257
NP_440148.1_1 Forward -358 -339 -3.93378 0.219
NP_440148.1_1 Forward -82 -63 -6.68705 0.265
NP_443062.1_1 Reverse -111 -129 4.54812 0.258
NP_442780.1_3 Forward -82 -63 10.1695 0.221
NP_440436.1_4 Forward -14 -5 7.47246 0.129
NP_442366.1_3 Reverse -212 -230 -2.0458 0.219
NP_442001.1_1 Forward -112 -93 -1.47628 0.21
NP_440165.1_5 Reverse -29 -48 -5.31042 0.22
NP_441046.1_2 Reverse -1 -20 -0.295539 0.278
NP_441062.1_1 Forward -328 -310 20.3746 0.284
NP_440431.1_4 Forward -315 -296 -7.49654 0.262
NP_441570.1_1 Reverse -111 -129 -17.2871 0.269
NP_442729.1_7 Forward -164 -146 5.42735 0.288
NP_442348.1_2 Forward -377 -368 11.7994 0.225
NP_442797.1_9 Forward -350 -332 12.7038 0.137
NP_442079.1_7 Reverse -260 -279 0.196116 0.286
NP_441022.1_1 Reverse -389 -398 11.1625 0.284
NP_442346.1_5 Forward -230 -220 7.64985 0.162
NP_440847.1_3 Reverse -186 -200 10.6187 0.287
NP_442828.1_2 Forward -93 -74 14.4666 0.242
NP_441329.1_1 Forward -105 -86 6.54077 0.256
NP_441329.1_6 Forward -102 -83 1.28872 0.24
NP_441895.1_10 Forward -208 -189 -18.2901 0.282
NP_440671.1_4 Reverse -6 -20 12.7826 0.101
NP_440224.1_1 Forward -279 -260 1.17943 0.132
NP_442140.1_3 Forward -130 -120 3.81494 0.278
NP_440590.1_4 Reverse -214 -227 -0.177378 0.179
NP_442497.1_3 Reverse -305 -324 18.5853 0.228
NP_440219.1_4 Forward -311 -298 14.4699 0.282
NP_440462.1_6 Forward -270 -260 3.32329 0.25
NP_442899.1_4 Reverse -174 -190 5.56438 0.29
NP_442402.1_4 Reverse -198 -217 -9.34271 0.288
NP_441848.1_4 Forward -181 -165 12.0388 0.213
NP_441848.1_4 Forward -302 -286 7.55067 0.288
NP_441848.1_7 Reverse -229 -248 -0.984623 0.244
NP_439942.1_5 Forward -365 -351 17.4866 0.267
NP_442533.1_6 Reverse -220 -229 2.16301 0.27
NP_442229.1_10 Reverse -192 -211 19.9598 0.173
NP_441697.1_5 Reverse -50 -69 0.0473228 0.197
NP_441028.1_6 Reverse -155 -165 7.74772 0.218
NP_441527.1_4 Forward -315 -296 -11.9847 0.285
NP_441347.1_8 Forward -105 -86 25.5437 0.00659
NP_441972.1_5 Forward -20 -1 -7.57203 0.25
NP_442674.1_10 Forward -265 -246 13.0775 0.205
NP_442264.1_5 Forward -55 -41 12.9793 0.253
NP_442365.1_3 Forward -58 -39 15.2408 0.245
NP_441174.1_4 Forward -165 -155 10.1081 0.288
NP_440766.1_2 Forward -274 -258 18.0524 0.203
NP_440643.1_6 Reverse -35 -54 1.57275 0.271
NP_442703.1_9 Forward -253 -235 5.03403 0.244
NP_443000.1_7 Forward -122 -112 1.35667 0.251
NP_440552.1_8 Forward -352 -335 11.8931 0.236
NP_441397.1_8 Forward -298 -285 13.2397 0.245
NP_441122.1_1 Reverse -288 -303 9.41967 0.28
NP_441122.1_1 Forward -233 -218 2.8315 0.294
NP_440216.1_9 Forward -129 -120 7.76787 0.286
NP_440216.1_9 Forward -299 -290 7.27622 0.286
NP_441135.1_4 Reverse -33 -52 5.80098 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAAAGCTTTTTGAGGGACGACTCGGGATTTTCCTCCTACTTAAGTAATTAGGGATACTTAACTAAAAAGAGTTGAACCTATATCAAAAAAGGGAATTTGATCATGGCAAATGTAACAATAGATACTTCCCAAGGGATAGATTTCCCATAGATTGAAGAGCAAAAACGATTAGTCATGGCTGATCGTTGAAGAAATGGGATAAGGGATGAAATGGTGCTTGATTTTAGAAATAGTATGGGGTTAAACTCTACTCATTAATTTGCATTGTTCCCATAGCAAAGTGATCAACTATAGTTAACTTAAGATTAAGAAAATAGTTAACTTTAGGGCTAATAATTATTGACAGGTTTCGCTCTCACCTTAGATGGACTTTATTTGTTCAACCGCCATTGTTGTCCC

CDS

ATGCAATCTCCCCTGTCTTCTTCCCCGGCCACGAATCAGACCACACTAGGGTTGGCCTACCCCCTGCCATCTCCCCCGAACGCTATGGAAGCTTCTCCCCCCTCCGCCAGTGAAAGCCCTAACTTGTACCAGGTTTTACAGAACCTCATTGCCAAAGAGAGCTCTGGCAAATTGATCGTTCATAGCAAGGGCAATCCCCGCATCCAATGGCGGATCTATCTGGGCAACGGACGCATTCACTATGCCGGAAGTGACCAAGGGCAATCGGAAAGGCTGAACTATCTGTTCCAACGCTACACTCCCACTAAAAGACTTCGCCTTGAGCAGCCCATCACCAGCGATTATCAGTACCTCTGTGAGTTGTGGGATTCCCAGCAGTTTTCTTTTCAGGAAATCCGCTCCATTCTGGCCAAGTTAACCCAGGAAGCTTTGATCCAAATTCTTTCCCTGTCCCAGCCGGTTTGCACTTTCGAGGAAACGGTGGGGCTAGATCGTTTACTGCTCTATCTGGACTTCAAGCAGTTAATGCAACCTGCCGCCCAGGAAATCAAACATTGGCTCAAAATTTGTACTGTCATCAACTCCCCTTTCCAACGGGCGATCGCCGAGAATGTGGATACCATCTTGCCTGGGCTATGTAAGCTCGAACACATCACCAGTGACTTGCTGAACCGCTACCAAAAATTGCCGGAATTAATCGCCCAGGAAATGTGTGTGTATGAAATTGCCGAGTCTCTGCACACCAGTAGCCTTAGTGTGGCCATTATTCTCAAAACCCTAGTGGGCCTAGGTCTCATCACCATGGGACCCTACGAACCGGAGCAGGAGGATAACCGCCCGGTCATTGCCTGTGTGGATGACAGTCCTTCCATTCAACGGGTGGTGAGCTTTGCCCTCGAAGCCACGGGTTTTAAGGTGATCAACATCAAACAAGCCTCTAGTGCCCTAACTACTTTGATGCACGCCAAACCGGCCCTGATTTTAATGGACATCAATATGCCCGACATCGACGGCTATCAACTGTGCAGTATTTGCAATAAATCCGAAGCCCTCAAGCATATTCCCATTGTCATGTTGACCGGCCGCAGTGGAGTTTTAGACCGGGTAAAAGCAAAAATGCACGGCTCCGTTGGCTACATTTGCAAACCGTTCCAGCCCCAGGAATTAGTGGAAACAGTGCAGAGCTTTATCTCCGCAGCTGTTTAA

Protein

MQSPLSSSPATNQTTLGLAYPLPSPPNAMEASPPSASESPNLYQVLQNLIAKESSGKLIVHSKGNPRIQWRIYLGNGRIHYAGSDQGQSERLNYLFQRYTPTKRLRLEQPITSDYQYLCELWDSQQFSFQEIRSILAKLTQEALIQILSLSQPVCTFEETVGLDRLLLYLDFKQLMQPAAQEIKHWLKICTVINSPFQRAIAENVDTILPGLCKLEHITSDLLNRYQKLPELIAQEMCVYEIAESLHTSSLSVAIILKTLVGLGLITMGPYEPEQEDNRPVIACVDDSPSIQRVVSFALEATGFKVINIKQASSALTTLMHAKPALILMDINMPDIDGYQLCSICNKSEALKHIPIVMLTGRSGVLDRVKAKMHGSVGYICKPFQPQELVETVQSFISAAV