Your browser is old and dusty. Try Google Chrome!

Details for sll1289

ORF sll1289
Accession NP_440524.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_1 Reverse -147 -165 17.4492 0.222
NP_441061.1_2 Forward -127 -113 2.06454 0.179
NP_441061.1_2 Reverse -120 -134 0.982901 0.196
NP_441061.1_2 Reverse -239 -253 -0.0987402 0.221
NP_441453.1_4 Forward -128 -120 6.80426 0.121
NP_441453.1_4 Reverse -119 -127 6.11594 0.121
NP_442151.1_6 Forward -128 -114 13.6676 0.0474
NP_441818.1_1 Reverse -120 -131 12.2512 0.135
NP_441818.1_9 Forward -271 -252 -5.80207 0.257
NP_441818.1_9 Forward -259 -240 -8.65367 0.279
NP_441465.1_5 Forward -68 -54 17.0108 0.286
NP_441465.1_8 Reverse -155 -173 4.54237 0.299
NP_442169.1_1 Reverse -155 -174 -3.24547 0.293
NP_442623.1_3 Forward -127 -108 9.73422 0.0232
NP_442655.1_2 Forward -258 -239 7.7676 0.147
NP_442173.1_1 Reverse -120 -128 12.0158 0.0316
NP_442173.1_1 Forward -127 -119 10.7375 0.0611
NP_442752.1_4 Forward -128 -121 13.8055 0.0199
NP_442752.1_4 Reverse -166 -173 12.1338 0.0546
NP_442752.1_4 Forward -330 -323 9.47889 0.109
NP_442752.1_4 Forward -276 -269 5.44732 0.202
NP_443027.1_4 Forward -379 -369 7.74818 0.235
NP_440784.1_7 Forward -127 -120 6.23397 0.241
NP_440784.1_7 Reverse -120 -127 6.13563 0.241
NP_442909.1_7 Reverse -120 -134 10.5204 0.136
NP_440061.1_9 Reverse -319 -333 5.01387 0.298
NP_441054.1_2 Forward -145 -126 10.8159 0.283
NP_441499.1_7 Reverse -156 -174 19.9803 0.0751
NP_442062.1_8 Forward -128 -118 7.25653 0.104
NP_440761.1_4 Forward -139 -120 -20.1584 0.285
NP_440839.1_8 Forward -261 -248 21.6521 0.0621
NP_439918.1_2 Forward -259 -240 5.30933 0.159
NP_439918.1_2 Forward -258 -239 3.44104 0.186
NP_439918.1_2 Forward -264 -245 -2.65548 0.248
NP_440893.1_3 Forward -191 -172 0.392004 0.275
NP_440370.1_9 Reverse -245 -264 18.1898 0.289
NP_442110.1_7 Forward -128 -114 15.7325 0.0387
NP_441082.1_10 Forward -288 -275 11.1307 0.236
NP_441082.1_10 Forward -226 -213 8.86907 0.258
NP_440300.1_1 Forward -181 -162 6.98015 0.281
NP_441925.1_4 Reverse -185 -204 -12.9809 0.257
NP_440273.1_3 Forward -265 -246 6.29264 0.232
NP_440856.1_4 Reverse -112 -131 -3.04881 0.226
NP_441083.1_3 Reverse -210 -220 12.5659 0.249
NP_441083.1_5 Reverse -119 -129 9.7148 0.0231
NP_441083.1_5 Forward -128 -118 8.04317 0.046
NP_441434.1_3 Forward -243 -224 -2.0655 0.262
NP_441738.1_2 Reverse -121 -128 15.28 0.0102
NP_441738.1_2 Reverse -269 -276 10.2652 0.101
NP_441645.1_8 Forward -142 -123 10.8159 0.298
NP_440209.1_1 Forward -128 -120 8.57422 0.0425
NP_440655.1_9 Reverse -224 -243 17.7974 0.237
NP_442059.1_8 Reverse -203 -222 15.5349 0.244
NP_442570.1_3 Forward -261 -242 -2.36049 0.212
NP_442570.1_3 Forward -256 -237 -3.93378 0.225
NP_442570.1_3 Forward -301 -282 -9.44032 0.299
NP_441792.1_1 Forward -234 -215 7.86593 0.176
NP_441792.1_5 Reverse -239 -255 9.39998 0.234
NP_440538.1_10 Forward -378 -359 12.3892 0.235
NP_441716.1_2 Forward -96 -77 -0.281098 0.271
NP_442111.1_4 Reverse -118 -132 9.83269 0.0575
NP_442111.1_4 Forward -129 -115 2.75286 0.266
NP_441624.1_1 Forward -52 -33 19.2723 0.108
NP_440906.1_5 Forward -127 -120 6.23397 0.234
NP_440906.1_5 Reverse -120 -127 6.13563 0.241
NP_440906.1_5 Forward -49 -42 5.64398 0.292
NP_440747.1_10 Reverse -116 -128 -2.4193 0.0434
NP_440747.1_10 Forward -131 -119 -12.0557 0.199
NP_441265.1_3 Reverse -113 -127 5.70279 0.181
NP_441014.1_2 Forward -254 -235 14.0608 0.245
NP_441014.1_10 Reverse -118 -137 -0.492971 0.252
NP_442848.1_1 Forward -134 -120 7.76774 0.0791
NP_443018.1_3 Reverse -120 -127 11.7405 0.0655
NP_443018.1_3 Forward -127 -120 5.44732 0.193
NP_441634.1_9 Forward -258 -239 14.4533 0.166
NP_440376.1_1 Forward -128 -119 5.99792 0.111
NP_440376.1_1 Reverse -166 -175 0.0980582 0.285
NP_440376.1_1 Forward -276 -267 -0.000272808 0.285
NP_440376.1_1 Reverse -119 -128 -0.196935 0.285
NP_441588.1_4 Forward -111 -101 6.37155 0.2
NP_441588.1_4 Reverse -121 -131 6.37155 0.2
NP_442687.1_7 Reverse -103 -113 4.89658 0.23
NP_442191.1_4 Forward -339 -325 10.6053 0.294
NP_442485.1_3 Forward -161 -142 -2.26216 0.262
NP_441846.1_10 Forward -259 -240 -6.39206 0.19
NP_441846.1_10 Forward -340 -321 -13.0786 0.197
NP_441846.1_10 Forward -276 -257 -21.6334 0.256
NP_441846.1_10 Forward -275 -256 -21.7317 0.256
NP_441846.1_10 Forward -265 -246 -23.4033 0.285
NP_441846.1_10 Reverse -217 -236 -23.4033 0.285
NP_441846.1_10 Forward -270 -251 -23.6983 0.295
NP_442583.1_1 Reverse -72 -91 16.1257 0.146
NP_442530.1_2 Forward -363 -353 12.8614 0.269
NP_441013.1_2 Forward -294 -276 0.314141 0.254
NP_442770.1_1 Forward -296 -282 13.9619 0.3
NP_441763.1_10 Forward -169 -150 5.50519 0.284
NP_441855.2_6 Forward -348 -329 16.6174 0.284
NP_442782.1_2 Forward -252 -238 5.89945 0.234
NP_442496.1_5 Reverse -223 -241 12.7038 0.197
NP_442205.1_9 Reverse -230 -246 -3.67804 0.291
NP_442544.1_2 Reverse -158 -172 -1.27871 0.272
NP_441414.1_9 Forward -128 -109 3.24438 0.0596
NP_441414.1_9 Reverse -119 -138 -10.9153 0.297
NP_441256.1_8 Forward -282 -263 11.3075 0.164
NP_441958.1_5 Forward -129 -119 0.865012 0.12
NP_441127.1_1 Reverse -230 -244 12.7826 0.206
NP_439905.1_2 Reverse -185 -199 18.3875 0.159
NP_439905.1_2 Reverse -135 -149 14.9459 0.188
NP_441097.1_2 Forward -285 -268 2.89044 0.293
NP_442911.1_2 Reverse -109 -128 9.43923 0.0177
NP_442911.1_2 Forward -138 -119 3.44104 0.0436
NP_440153.1_8 Reverse -104 -117 2.18257 0.22
NP_442536.1_7 Forward -134 -115 7.47261 0.273
NP_443055.1_3 Reverse -258 -277 13.0324 0.192
NP_443055.1_6 Reverse -230 -248 1.98502 0.222
NP_440993.1_2 Reverse -114 -130 2.41848 0.265
NP_440993.1_3 Reverse -109 -128 0.490334 0.252
NP_440993.1_4 Reverse -238 -255 4.56207 0.275
NP_441099.1_5 Reverse -109 -128 -7.67036 0.179
NP_441099.1_5 Reverse -257 -276 -8.45701 0.194
NP_442002.1_1 Reverse -219 -237 -0.0791831 0.192
NP_442002.1_1 Reverse -157 -175 -6.76569 0.249
NP_442002.1_1 Forward -285 -267 -9.32229 0.279
NP_440411.1_10 Reverse -188 -207 14.4581 0.197
NP_442438.1_10 Reverse -114 -128 8.55439 0.0769
NP_441752.1_5 Forward -302 -283 5.01433 0.2
NP_441752.1_6 Reverse -273 -292 3.73603 0.235
NP_440147.1_4 Forward -130 -117 0.412608 0.255
NP_440147.1_4 Reverse -102 -115 -0.669033 0.294
NP_441550.1_8 Reverse -117 -127 12.5659 0.0336
NP_441550.1_8 Forward -130 -120 11.091 0.0555
NP_441331.1_1 Reverse -24 -43 -9.63698 0.297
NP_440206.1_4 Reverse -257 -276 2.16195 0.289
NP_440206.1_4 Reverse -246 -265 -1.67294 0.292
NP_440345.1_3 Reverse -81 -95 10.8977 0.267
NP_441041.1_4 Forward -259 -240 -4.91709 0.145
NP_441041.1_4 Forward -128 -109 -10.817 0.237
NP_440016.1_9 Forward -177 -158 9.63589 0.278
NP_441725.1_4 Reverse -36 -50 3.34225 0.279
NP_441725.1_5 Reverse -120 -130 1.455 0.135
NP_439966.1_7 Reverse -117 -127 11.2876 0.0688
NP_439966.1_7 Forward -130 -120 6.0761 0.195
NP_439966.1_7 Reverse -265 -275 4.40448 0.273
NP_442941.1_3 Reverse -120 -130 10.1081 0.024
NP_442281.1_1 Reverse -114 -128 4.91554 0.176
NP_442281.1_8 Forward -131 -112 20.2135 0.184
NP_440018.1_3 Reverse -238 -257 8.06259 0.209
NP_442847.1_3 Reverse -323 -342 11.6017 0.217
NP_440375.1_8 Forward -174 -155 -0.4922 0.266
NP_441644.1_6 Reverse -119 -129 7.74772 0.117
NP_441644.1_6 Forward -128 -118 5.28945 0.199
NP_441644.1_6 Forward -175 -165 3.32285 0.288
NP_443049.1_6 Reverse -50 -60 13.3 0.191
NP_443049.1_6 Forward -129 -119 11.8361 0.24
NP_442215.1_2 Reverse -209 -225 -6.92296 0.281
NP_442177.1_5 Forward -268 -254 9.5377 0.239
NP_442029.1_6 Reverse -150 -169 4.42435 0.268
NP_442029.1_6 Forward -264 -245 2.65439 0.291
NP_440253.1_2 Reverse -119 -137 5.42735 0.0933
NP_440929.1_8 Reverse -119 -128 14.651 0.0105
NP_440929.1_8 Forward -128 -119 7.66954 0.0624
NP_442554.1_8 Forward -127 -117 12.3697 0.0269
NP_442554.1_8 Reverse -120 -130 6.07655 0.126
NP_441762.1_7 Reverse -139 -151 -5.76255 0.238
NP_442142.1_4 Forward -296 -283 3.55864 0.251
NP_442142.1_4 Forward -152 -139 3.46031 0.255
NP_442292.1_1 Reverse -120 -129 8.65285 0.0335
NP_442292.1_1 Forward -127 -118 8.1612 0.0478
NP_442301.1_2 Forward -185 -166 6.09517 0.263
NP_441715.1_4 Reverse -120 -130 4.99491 0.24
NP_441198.1_1 Forward -376 -357 9.73422 0.217
NP_441468.1_1 Forward -127 -120 6.13563 0.209
NP_441468.1_1 Reverse -120 -127 6.0373 0.223
NP_441020.2_7 Reverse -291 -310 7.07848 0.269
NP_441015.1_10 Reverse -218 -237 -5.11376 0.217
NP_441673.1_1 Forward -128 -119 1.37636 0.114
NP_441673.1_1 Reverse -119 -128 1.1797 0.163
NP_441876.1_9 Forward -243 -233 10.501 0.292
NP_441826.1_2 Forward -134 -120 1.86788 0.14
NP_441826.1_2 Reverse -113 -127 -3.44199 0.285
NP_442490.1_9 Forward -205 -186 -3.24547 0.229
NP_441764.1_4 Reverse -12 -29 9.31325 0.29
NP_442868.1_6 Forward -130 -120 0.176696 0.247
NP_442719.1_2 Forward -247 -229 -10.0113 0.268
NP_441056.1_1 Reverse -119 -138 -5.11376 0.257
NP_441612.1_2 Forward -69 -59 8.83972 0.21
NP_442227.1_2 Forward -238 -219 1.57275 0.245
NP_442427.1_8 Forward -137 -118 4.81767 0.293
NP_442808.1_1 Forward -61 -51 1.45457 0.285
NP_442775.1_1 Reverse -147 -166 11.9958 0.285
NP_442050.1_5 Reverse -117 -127 12.8609 0.0496
NP_442050.1_5 Reverse -265 -275 7.74772 0.243
NP_442050.1_5 Forward -130 -120 6.76441 0.282
NP_440342.1_1 Reverse -223 -242 13.1758 0.228
NP_440558.1_2 Reverse -247 -266 2.75272 0.165
NP_440558.1_2 Reverse -241 -260 -0.39387 0.203
NP_440558.1_2 Reverse -110 -129 -3.14714 0.234
NP_440923.1_1 Reverse -12 -30 14.178 0.188
NP_442650.1_2 Forward -128 -114 14.3559 0.0885
NP_441557.1_5 Reverse -119 -128 7.57121 0.049
NP_441557.1_5 Forward -128 -119 1.08137 0.0794
NP_441557.1_8 Reverse -275 -285 12.8609 0.235
NP_441557.1_8 Forward -238 -228 12.2709 0.236
NP_441445.1_8 Forward -225 -206 -11.8003 0.277
NP_441590.1_4 Reverse -268 -287 6.29183 0.26
NP_442066.2_9 Forward -343 -330 6.31247 0.297
NP_442419.1_2 Reverse -191 -210 -3.14714 0.252
NP_441458.1_10 Reverse -193 -212 7.96426 0.192
NP_441564.1_2 Forward -276 -257 3.73603 0.119
NP_442347.1_2 Reverse -120 -129 10.3245 0.058
NP_442347.1_2 Forward -174 -165 3.7363 0.284
NP_442645.1_2 Forward -301 -282 -19.8634 0.288
NP_442594.1_8 Reverse -221 -240 14.0608 0.146
NP_442594.1_8 Reverse -166 -185 10.2259 0.184
NP_442594.1_8 Forward -146 -127 2.85105 0.293
NP_442594.1_8 Forward -283 -264 1.96607 0.295
NP_440151.1_5 Forward -265 -246 7.37428 0.222
NP_442764.1_8 Forward -231 -212 5.01433 0.241
NP_440136.1_2 Forward -127 -120 6.23397 0.171
NP_440136.1_2 Reverse -120 -127 6.13563 0.193
NP_442998.1_5 Forward -69 -59 13.8447 0.157
NP_442998.1_10 Reverse -121 -128 15.5754 0.0102
NP_440899.1_1 Forward -264 -245 5.96765 0.291
NP_440899.1_5 Reverse -241 -260 10.8159 0.182
NP_440299.1_1 Reverse -115 -128 10.7368 0.0541
NP_440299.1_1 Forward -132 -119 4.64028 0.205
NP_440299.1_1 Reverse -151 -164 3.06699 0.261
NP_440299.1_1 Reverse -121 -134 2.87033 0.269
NP_440256.1_1 Forward -296 -277 -1.27885 0.102
NP_440256.1_1 Reverse -163 -182 -9.047 0.273
NP_441090.1_6 Forward -227 -213 15.8309 0.111
NP_440709.1_1 Forward -33 -14 -0.492971 0.295
NP_441559.1_8 Reverse -262 -276 3.73617 0.143
NP_440525.1_1 Reverse -12 -31 15.3391 0.16
NP_440915.1_6 Reverse -162 -176 -3.147 0.29
NP_441296.1_9 Forward -236 -223 10.0485 0.276
NP_441704.1_8 Reverse -108 -127 6.29183 0.262
NP_440215.1_10 Reverse -49 -68 17.109 0.142
NP_440749.1_3 Reverse -227 -243 16.3815 0.155
NP_442866.1_1 Forward -265 -246 -5.60541 0.243
NP_442866.1_1 Forward -259 -240 -5.70374 0.244
NP_442866.1_1 Reverse -321 -340 -8.45701 0.279
NP_440748.1_5 Forward -57 -38 -2.36049 0.273
NP_440748.1_5 Reverse -247 -266 -3.44213 0.297
NP_441464.1_10 Reverse -164 -178 12.291 0.201
NP_441464.1_10 Reverse -49 -63 8.06273 0.287
NP_440306.1_5 Forward -327 -308 0.491109 0.234
NP_440695.1_6 Forward -85 -71 12.6414 0.26
NP_441939.1_3 Forward -127 -108 6.09597 0.253
NP_442386.1_9 Reverse -118 -127 8.75075 0.184
NP_440570.1_5 Forward -168 -149 1.86774 0.234
NP_441750.1_1 Reverse -217 -236 -6.68705 0.241
NP_441750.1_7 Reverse -50 -60 16.7946 0.254
NP_441340.1_5 Forward -127 -120 13.5105 0.0314
NP_441340.1_5 Reverse -120 -127 5.84064 0.208
NP_440168.1_8 Reverse -143 -162 2.0644 0.277
NP_440327.1_6 Reverse -155 -174 4.22769 0.274
NP_440327.1_6 Forward -259 -240 3.04771 0.285
NP_440586.1_8 Reverse -120 -127 9.47853 0.146
NP_440586.1_8 Forward -127 -120 5.74197 0.283
NP_441262.1_3 Forward -128 -121 14.7888 0.0223
NP_440027.1_8 Reverse -247 -266 4.52188 0.287
NP_443051.1_1 Forward -129 -120 7.47288 0.0571
NP_439937.1_8 Forward -198 -179 -5.21209 0.288
NP_442294.1_3 Reverse -54 -68 18.1901 0.113
NP_440408.1_7 Forward -211 -192 11.9958 0.212
NP_440408.1_7 Forward -128 -109 10.3242 0.247
NP_440408.1_7 Forward -134 -115 9.3409 0.262
NP_439943.1_4 Reverse -353 -372 12.7825 0.178
NP_440372.1_2 Forward -127 -120 13.8055 0.0214
NP_440372.1_2 Reverse -120 -127 6.52896 0.188
NP_442783.1_10 Reverse -253 -263 17.4824 0.149
NP_440819.1_5 Forward -69 -61 7.68924 0.266
NP_441803.1_2 Reverse -199 -218 -0.39387 0.275
NP_439977.1_5 Reverse -113 -132 5.40766 0.15
NP_442384.1_10 Reverse -119 -132 5.62415 0.124
NP_442384.1_10 Forward -175 -162 1.29759 0.263
NP_441877.1_7 Reverse -279 -298 4.71854 0.218
NP_442572.1_6 Reverse -275 -294 9.53756 0.229
NP_441018.1_7 Reverse -180 -199 7.27595 0.273
NP_442262.1_10 Reverse -120 -127 13.2155 0.0213
NP_441689.1_5 Forward -130 -120 12.7626 0.113
NP_441689.1_5 Forward -177 -167 5.68278 0.215
NP_440163.1_10 Forward -131 -121 10.4031 0.201
NP_440163.1_10 Reverse -47 -57 9.32148 0.235
NP_440163.1_10 Forward -119 -109 8.92815 0.256
NP_440075.1_2 Reverse -214 -233 4.42435 0.292
NP_440531.1_6 Forward -291 -272 -3.3438 0.265
NP_441640.1_8 Forward -133 -114 -5.50708 0.288
NP_442529.1_6 Forward -259 -240 15.3391 0.267
NP_440297.1_9 Reverse -120 -130 -0.511621 0.289
NP_442280.1_10 Forward -230 -212 5.35702 0.287
NP_441896.1_1 Reverse -13 -32 15.9282 0.0753
NP_440894.1_2 Forward -240 -221 -3.54046 0.296
NP_440894.1_10 Reverse -55 -74 4.32602 0.254
NP_441679.1_5 Forward -305 -286 18.0924 0.0288
NP_440999.1_2 Reverse -239 -258 11.4058 0.214
NP_440999.1_9 Reverse -115 -129 1.76955 0.158
NP_440888.1_2 Reverse -250 -264 9.34041 0.13
NP_440888.1_2 Reverse -119 -133 7.3738 0.198
NP_440888.1_2 Forward -175 -161 6.58715 0.228
NP_440600.1_1 Forward -30 -11 14.5621 0.207
NP_440491.1_1 Forward -131 -112 9.74328 0.206
NP_442033.1_10 Reverse -147 -166 -6.39206 0.186
NP_441543.1_2 Reverse -120 -129 7.07956 0.131
NP_441543.1_3 Reverse -189 -203 10.5204 0.212
NP_442845.1_2 Reverse -160 -174 7.17775 0.198
NP_442845.1_2 Forward -134 -120 6.29277 0.212
NP_442845.1_2 Forward -282 -268 4.71948 0.254
NP_441551.1_5 Forward -243 -227 7.13767 0.249
NP_442315.1_2 Reverse -161 -173 10.0687 0.291
NP_443064.1_6 Reverse -321 -331 9.85209 0.193
NP_442578.1_7 Forward -127 -120 6.0373 0.18
NP_440071.1_6 Forward -286 -272 13.7079 0.261
NP_441462.1_2 Forward -128 -118 0.963343 0.109
NP_443062.1_1 Forward -128 -110 9.6185 0.131
NP_442204.1_1 Reverse -360 -371 5.66354 0.198
NP_442204.1_1 Forward -132 -121 0.255333 0.282
NP_440504.1_6 Forward -91 -73 5.62325 0.262
NP_440255.1_9 Forward -152 -133 17.5223 0.212
NP_440516.1_8 Forward -128 -119 9.53783 0.0136
NP_440516.1_8 Reverse -119 -128 5.01461 0.118
NP_441785.1_1 Forward -299 -285 12.9322 0.236
NP_442080.1_7 Reverse -319 -338 -4.52377 0.296
NP_442428.1_5 Forward -127 -120 6.13563 0.209
NP_442428.1_5 Reverse -120 -127 6.0373 0.212
NP_442120.1_10 Forward -265 -246 -15.7335 0.294
NP_441867.1_2 Forward -146 -127 -13.2752 0.277
NP_441867.1_2 Reverse -165 -184 -14.0619 0.277
NP_441867.1_2 Reverse -221 -240 -16.6185 0.291
NP_440673.1_2 Forward -159 -140 12.5357 0.145
NP_440673.1_3 Reverse -121 -128 12.4288 0.0426
NP_440673.1_3 Forward -291 -284 10.5605 0.123
NP_441052.1_2 Reverse -119 -129 1.55333 0.238
NP_441052.1_2 Forward -128 -118 0.668351 0.256
NP_442219.1_9 Reverse -120 -129 7.96454 0.0696
NP_440436.1_4 Reverse -120 -129 7.57079 0.124
NP_440436.1_10 Reverse -47 -66 12.5858 0.282
NP_441893.1_3 Reverse -296 -315 5.50599 0.264
NP_440314.1_9 Reverse -120 -139 -9.047 0.258
NP_440041.1_6 Forward -247 -228 12.6833 0.285
NP_441719.1_4 Forward -127 -120 6.82395 0.0855
NP_441719.1_4 Reverse -120 -127 6.52896 0.188
NP_441719.1_6 Forward -243 -224 6.09517 0.288
NP_441004.1_1 Reverse -150 -169 -4.32711 0.169
NP_441004.1_1 Forward -143 -124 -8.65367 0.201
NP_442813.1_5 Forward -304 -285 1.17943 0.296
NP_442873.1_3 Reverse -109 -128 5.80018 0.248
NP_442206.1_10 Forward -128 -113 9.81299 0.151
NP_443054.1_2 Reverse -294 -308 7.9644 0.134
NP_441851.1_10 Forward -129 -119 5.97822 0.19
NP_441851.1_10 Reverse -165 -175 4.60159 0.259
NP_441851.1_10 Reverse -118 -128 4.40493 0.271
NP_442208.1_5 Forward -345 -326 -3.04881 0.252
NP_441501.1_9 Reverse -141 -160 16.2232 0.214
NP_442856.1_7 Reverse -110 -129 -5.40875 0.279
NP_440593.1_3 Reverse -114 -133 -4.52377 0.251
NP_440593.1_3 Reverse -206 -225 -7.57203 0.297
NP_440463.1_7 Reverse -236 -250 14.1593 0.296
NP_440432.1_9 Reverse -141 -156 -4.64166 0.216
NP_442843.1_1 Forward -292 -273 -5.99873 0.244
NP_442843.1_1 Reverse -141 -160 -11.3086 0.288
NP_439960.1_10 Reverse -210 -228 1.78911 0.191
NP_440726.1_2 Forward -224 -205 -0.688862 0.295
NP_440943.1_5 Reverse -365 -379 11.701 0.273
NP_442006.1_2 Reverse -217 -234 -13.0392 0.197
NP_442006.1_3 Reverse -224 -242 3.16574 0.238
NP_442243.1_1 Reverse -113 -131 3.55831 0.203
NP_441570.1_1 Forward -128 -110 -11.1906 0.189
NP_441078.1_4 Forward -128 -119 0.196389 0.205
NP_441078.1_4 Reverse -119 -128 -0.000272808 0.205
NP_442729.1_8 Forward -132 -119 5.13249 0.263
NP_441663.1_7 Forward -131 -112 16.6174 0.181
NP_442443.1_1 Reverse -215 -234 0.196116 0.219
NP_440526.1_3 Forward -127 -116 6.94134 0.172
NP_441432.1_8 Forward -129 -120 14.0611 0.0258
NP_441333.1_1 Reverse -81 -91 12.2572 0.238
NP_442320.1_8 Forward -134 -120 2.2612 0.0779
NP_441732.1_2 Forward -132 -116 -16.5594 0.174
NP_442540.1_3 Forward -235 -216 18.1066 0.242
NP_440629.1_4 Forward -78 -59 10.7175 0.238
NP_440760.1_1 Reverse -119 -138 -15.4385 0.147
NP_440199.1_10 Forward -131 -121 7.64985 0.231
NP_441945.1_10 Forward -299 -280 6.98095 0.291
NP_441805.1_2 Forward -175 -156 -2.85214 0.255
NP_441072.1_2 Forward -264 -245 7.37428 0.257
NP_440713.1_4 Forward -258 -239 6.58763 0.188
NP_440713.1_4 Reverse -161 -180 1.47442 0.286
NP_442489.1_7 Forward -128 -119 0.688044 0.152
NP_442489.1_7 Reverse -119 -128 0.688044 0.152
NP_440559.1_1 Forward -127 -118 13.7661 0.0357
NP_440559.1_1 Reverse -120 -129 7.76787 0.0918
NP_441659.2_8 Reverse -119 -129 5.48657 0.106
NP_441659.2_8 Forward -128 -118 5.28991 0.112
NP_441659.2_8 Reverse -104 -114 1.84832 0.224
NP_441659.2_8 Forward -175 -165 0.865012 0.256
NP_442913.1_10 Reverse -110 -129 10.2259 0.0421
NP_440708.1_6 Reverse -313 -332 -9.14533 0.261
NP_440708.1_6 Forward -257 -238 -9.93197 0.275
NP_440708.1_6 Forward -235 -216 -10.4236 0.278
NP_442346.1_5 Reverse -103 -113 8.82982 0.124
NP_442346.1_5 Forward -129 -119 6.27322 0.208
NP_440545.1_3 Reverse -115 -132 -6.05768 0.268
NP_440486.1_6 Forward -345 -326 8.84924 0.235
NP_442603.1_7 Forward -128 -114 11.897 0.109
NP_442603.1_7 Reverse -119 -133 5.60385 0.284
NP_441888.1_7 Reverse -279 -293 8.84938 0.176
NP_443022.1_3 Forward -79 -60 12.9791 0.292
NP_440449.1_6 Forward -254 -236 5.14342 0.283
NP_441833.1_4 Reverse -120 -127 6.52896 0.0924
NP_441833.1_4 Forward -127 -120 6.23397 0.163
NP_441895.1_2 Reverse -36 -55 -26.9432 0.275
NP_442060.1_10 Forward -261 -242 9.73422 0.25
NP_442162.1_8 Reverse -113 -132 -3.63879 0.291
NP_442162.1_9 Forward -127 -120 12.9205 0.0282
NP_442162.1_9 Reverse -120 -127 12.9205 0.0282
NP_440671.1_4 Forward -134 -120 9.73436 0.172
NP_440671.1_5 Forward -237 -223 13.5686 0.293
NP_443026.1_5 Forward -282 -263 -5.21209 0.293
NP_442140.1_3 Forward -127 -117 5.28991 0.216
NP_442021.1_3 Reverse -149 -168 -7.76869 0.28
NP_440875.1_9 Forward -380 -370 7.69067 0.255
NP_441813.1_5 Forward -130 -120 6.17489 0.1
NP_441813.1_5 Reverse -117 -127 4.79825 0.144
NP_440590.1_4 Forward -127 -114 2.67422 0.0835
NP_440590.1_4 Reverse -120 -133 -5.88057 0.293
NP_442497.1_10 Reverse -120 -129 0.589713 0.153
NP_442497.1_10 Forward -127 -118 -1.18024 0.256
NP_440821.1_4 Forward -130 -120 8.53483 0.0468
NP_440821.1_4 Reverse -117 -127 7.55152 0.0698
NP_441239.1_9 Reverse -138 -150 5.84051 0.206
NP_441239.1_9 Reverse -117 -129 5.84051 0.206
NP_441239.1_9 Reverse -209 -221 5.74217 0.21
NP_441951.1_9 Reverse -141 -160 0.0977854 0.261
NP_441727.1_3 Reverse -112 -131 10.8159 0.161
NP_441892.1_1 Reverse -42 -59 -2.51776 0.223
NP_442044.1_1 Forward -74 -55 -11.6036 0.271
NP_442105.1_9 Reverse -386 -400 14.2547 0.294
NP_441508.1_1 Forward -29 -10 12.0953 0.233
NP_441017.1_6 Reverse -280 -294 11.012 0.285
NP_441526.1_6 Reverse -48 -67 7.47261 0.258
NP_440546.1_4 Reverse -166 -176 12.276 0.0679
NP_442611.1_1 Forward -128 -109 11.9958 0.07
NP_442144.1_2 Forward -313 -294 12.5858 0.197
NP_440401.1_9 Forward -56 -49 12.6251 0.287
NP_442840.1_5 Forward -287 -268 12.2908 0.214
NP_441848.1_4 Forward -74 -58 8.02812 0.288
NP_440653.1_1 Reverse -356 -375 7.27595 0.225
NP_440696.1_3 Forward -303 -285 0.0191479 0.237
NP_440696.1_3 Forward -264 -246 -4.11075 0.296
NP_442039.1_4 Forward -127 -120 11.6422 0.0747
NP_440825.1_6 Reverse -156 -175 8.16093 0.285
NP_442837.1_3 Forward -127 -120 6.0373 0.25
NP_442837.1_3 Reverse -120 -127 6.0373 0.25
NP_442053.1_1 Reverse -119 -128 7.07956 0.105
NP_440505.1_3 Forward -130 -120 14.7297 0.0176
NP_440505.1_3 Reverse -48 -58 7.84651 0.147
NP_440505.1_7 Forward -252 -233 7.66927 0.162
NP_441701.1_3 Forward -269 -252 7.80699 0.257
NP_441203.1_1 Reverse -120 -139 -13.0786 0.153
NP_440914.1_1 Forward -128 -118 11.1525 0.105
NP_440914.1_1 Reverse -119 -129 6.56569 0.273
NP_442533.1_1 Forward -315 -296 -17.2085 0.281
NP_442533.1_6 Reverse -250 -259 4.91628 0.165
NP_442533.1_6 Reverse -119 -128 4.42462 0.179
NP_442533.1_6 Forward -175 -166 4.12963 0.191
NP_442533.1_6 Forward -149 -140 2.85133 0.236
NP_442533.1_6 Forward -113 -104 2.06468 0.275
NP_442541.1_10 Reverse -250 -264 4.22722 0.252
NP_442541.1_10 Reverse -244 -258 2.65393 0.254
NP_442232.1_3 Reverse -365 -384 -15.8318 0.296
NP_442322.1_4 Forward -239 -222 -0.846829 0.226
NP_442322.1_4 Forward -183 -166 -9.40158 0.295
NP_441219.1_6 Forward -159 -141 12.8022 0.188
NP_441482.1_7 Forward -134 -120 6.09611 0.0343
NP_439944.1_9 Reverse -120 -130 9.22315 0.1
NP_439944.1_9 Forward -127 -117 7.55152 0.138
NP_442269.1_10 Forward -264 -245 1.47442 0.291
NP_441028.1_6 Reverse -62 -72 7.35439 0.229
NP_441028.1_6 Forward -236 -226 3.71617 0.281
NP_440116.1_8 Forward -127 -108 -2.16383 0.126
NP_441527.1_7 Reverse -64 -83 6.78348 0.299
NP_440007.1_9 Forward -132 -118 8.65272 0.175
NP_441602.1_3 Forward -133 -114 -2.95047 0.239
NP_441106.1_1 Forward -150 -141 2.458 0.283
NP_441869.1_9 Reverse -306 -325 12.4875 0.293
NP_439903.1_3 Reverse -146 -165 10.2259 0.205
NP_441286.1_1 Reverse -118 -130 10.2654 0.0198
NP_441286.1_1 Forward -129 -117 3.08724 0.05
NP_440670.1_8 Forward -128 -119 16.0277 0.00443
NP_440670.1_8 Reverse -119 -128 12.5861 0.0253
NP_440886.1_7 Reverse -273 -283 5.09279 0.201
NP_442614.1_2 Forward -128 -114 10.1277 0.234
NP_442382.1_7 Reverse -237 -256 5.70265 0.251
NP_441403.1_4 Reverse -152 -170 5.72234 0.293
NP_441463.1_3 Reverse -109 -128 -9.34199 0.278
NP_440501.1_4 Reverse -274 -293 -7.76869 0.285
NP_442842.1_4 Forward -258 -239 3.73603 0.257
NP_442842.1_4 Forward -259 -240 2.55606 0.265
NP_441626.1_2 Forward -127 -120 12.2322 0.0511
NP_441626.1_2 Reverse -120 -127 5.93897 0.231
NP_441901.1_9 Reverse -49 -68 9.3409 0.22
NP_442365.1_7 Reverse -115 -134 -3.54046 0.221
NP_442365.1_7 Reverse -198 -217 -4.52377 0.245
NP_442238.1_3 Forward -259 -240 16.3224 0.0498
NP_442238.1_3 Forward -265 -246 8.94757 0.177
NP_442238.1_3 Forward -270 -251 5.30933 0.254
NP_442794.1_1 Reverse -115 -127 9.77374 0.0789
NP_442794.1_1 Forward -132 -120 7.11881 0.148
NP_441962.1_4 Reverse -114 -133 -12.1936 0.253
NP_441962.1_4 Forward -133 -114 -14.0619 0.282
NP_441962.1_4 Forward -127 -108 -14.1602 0.284
NP_440387.1_1 Reverse -119 -135 2.32015 0.0827
NP_440387.1_5 Forward -235 -216 13.3448 0.26
NP_441836.1_2 Forward -161 -142 -2.45882 0.23
NP_441836.1_2 Forward -259 -240 -5.31042 0.277
NP_441993.1_1 Forward -259 -240 6.42973 0.18
NP_440114.1_10 Reverse -166 -180 7.07942 0.246
NP_440293.1_3 Forward -255 -236 16.0274 0.064
NP_440293.1_3 Forward -283 -264 -2.95047 0.241
NP_440293.1_9 Forward -264 -250 11.5375 0.257
NP_440766.1_4 Reverse -115 -129 0.196253 0.298
NP_439988.1_3 Forward -252 -238 10.521 0.219
NP_441237.1_6 Reverse -211 -228 10.0686 0.127
NP_441237.1_7 Forward -255 -236 19.0757 0.275
NP_441237.1_9 Forward -127 -117 11.6814 0.164
NP_442867.1_8 Forward -234 -215 9.3409 0.224
NP_440457.1_1 Forward -132 -120 9.28209 0.0929
NP_440798.1_6 Forward -127 -114 1.10092 0.234
NP_441436.1_8 Reverse -154 -173 7.66927 0.293
NP_440473.1_9 Reverse -219 -238 -7.08038 0.236
NP_442514.1_5 Forward -183 -164 -8.45774 0.285
NP_440554.1_4 Reverse -120 -130 4.10993 0.201
NP_441885.1_5 Forward -128 -118 9.51814 0.0206
NP_441885.1_5 Reverse -119 -129 1.25834 0.11
NP_440478.1_4 Forward -132 -113 13.1758 0.2
NP_442341.1_3 Reverse -156 -175 1.57275 0.274
NP_442341.1_7 Reverse -118 -132 7.57108 0.102
NP_442341.1_7 Forward -129 -115 5.21113 0.165
NP_442369.1_6 Reverse -26 -36 16.5414 0.127
NP_442395.2_4 Reverse -113 -132 2.35861 0.223
NP_443000.1_7 Forward -130 -120 7.35486 0.0859
NP_440076.1_5 Reverse -221 -240 15.7316 0.171
NP_440507.2_3 Forward -122 -103 8.94676 0.237
NP_440275.1_3 Reverse -117 -127 8.1415 0.0602
NP_440275.1_3 Forward -130 -120 5.5849 0.14
NP_441307.1_4 Reverse -157 -176 1.37609 0.236
NP_443046.1_9 Reverse -288 -306 4.04996 0.258
NP_440679.1_10 Reverse -121 -140 -18.3884 0.278
NP_442495.1_4 Forward -152 -142 12.4681 0.226
NP_440149.1_8 Reverse -119 -138 -8.16202 0.3
NP_440216.1_9 Reverse -246 -255 5.50626 0.292
NP_440172.1_1 Forward -113 -103 3.42162 0.228
NP_440172.1_1 Reverse -119 -129 2.24165 0.279
NP_442015.1_10 Reverse -115 -128 11.9173 0.0372
NP_441226.1_7 Forward -127 -120 12.7234 0.0312
NP_441226.1_7 Reverse -120 -127 11.5435 0.0757
NP_441226.1_7 Forward -174 -167 8.29857 0.205
NP_441226.1_7 Reverse -240 -247 5.34865 0.289
NP_441111.1_7 Reverse -120 -128 8.86921 0.0589
NP_441177.1_7 Forward -185 -166 11.6017 0.2
NP_441766.1_2 Reverse -119 -128 12.6844 0.0158
NP_441766.1_9 Reverse -141 -160 -3.24547 0.298
NP_442252.1_4 Forward -258 -239 21.3373 0.0921
NP_440416.1_9 Reverse -112 -131 -13.7669 0.169
NP_443052.1_9 Forward -169 -150 1.47442 0.185
NP_442154.1_1 Reverse -167 -185 -19.2537 0.294
NP_440261.1_5 Forward -127 -114 -11.0921 0.237
NP_440988.1_10 Forward -130 -116 14.5801 0.131
NP_440988.1_10 Reverse -255 -269 7.12552 0.221
NP_440988.1_10 Reverse -111 -125 5.09245 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGGCCACTTGATTAGCTTTAATGGCATCGATCAACTGCCCATAGTTCATTTTCGGTTCAGCAGACCGGGGGGAGCCAGAGTTAAAAAAGGAGCGGGGTGTGGCTTCTCCATTGCTGGAGTTAGGGGATTGGATGGGACTGGGACTGGCCTTGGGTTGGGCCCCTTCTCCCCCTTCCTGGGCCAGGGTAGATACCGGTAGGGCTAGGGTGCCAGCTACCAGTAAACCCATCCCCAAACGGTGCCAAAAGCGGCTAGGGCTGGAGAAACTATGGCGATCGGAACGGGGACGATGACTCATGGACGTTTTAAACTAAAAAAATTCCAGCAGAGGGGAAAAACTCCAACCCCCATGATAGCTTGGGTCTTTGATTAACAAAATGTAACGAACTGCTCTAACT

CDS

ATGGTTTTAACTCCCTCCACCATGCTTGCCCTTGGTACCCAAGCACCGGACTTTTCCCTTTGGGACGTGACTGCGGAACAGCCCCTCACCCTAGGGGAAGCCATGGGAGAAAAAGGGCTATTGGTAATGTTCATCTGTTGTCATTGTCCCTTTGTCAAACACATCCAGGCCCAGTTAAGTCAGTTGGGGAAGGATTACCAAAACTCTGGTTTAGCCATGGTGGCCATCAGCGCTAACGATATAGAAAAATACCCCGATGACGCTCCCCCAGGCCTGAAAAAAATGGCCCAGGATTGGGACTATTGCTTCCCGGTACTGTACGACGAAACCCAGGCGATCGCCAAGGCCTACCGAGCAGCCTGCACCCCCGACTTCTTTTTGTTTGATGCCCAGGGGAAATTGGCCTACCGGGGCCAGTTAGATGACAGTCGCCCTAGCAATGGTTTGCCCGTTACCGGAGTGGACCTGAGACAGGCCATGGATCTAGTGCTGGCCGGCAGTCCTGTGCCGACGGAACAAAAGCCCAGCATTGGTTGCAACATTAAATGGAAACCCGGCAATGAACCTGATTATCAAAGTAATTAG

Protein

MVLTPSTMLALGTQAPDFSLWDVTAEQPLTLGEAMGEKGLLVMFICCHCPFVKHIQAQLSQLGKDYQNSGLAMVAISANDIEKYPDDAPPGLKKMAQDWDYCFPVLYDETQAIAKAYRAACTPDFFLFDAQGKLAYRGQLDDSRPSNGLPVTGVDLRQAMDLVLAGSPVPTEQKPSIGCNIKWKPGNEPDYQSN