Your browser is old and dusty. Try Google Chrome!

Details for sll1286

ORF sll1286
Accession NP_440532.1
Symbol
Category transcriptional regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -97 -83 9.73436 0.0698
NP_441061.1_2 Forward -85 -71 2.65453 0.173
NP_441061.1_2 Forward -396 -382 2.06454 0.179
NP_441061.1_3 Reverse -67 -86 19.4681 0.0638
NP_441418.1_6 Reverse -307 -326 -21.535 0.153
NP_441453.1_7 Forward -221 -214 12.1338 0.295
NP_441818.1_9 Reverse -221 -240 -10.0303 0.292
NP_442287.1_1 Reverse -192 -202 13.4509 0.277
NP_443002.1_5 Forward -396 -378 12.998 0.212
NP_441721.1_6 Reverse -116 -135 8.75091 0.281
NP_442173.1_6 Reverse -174 -188 14.4542 0.118
NP_440784.1_7 Forward -372 -365 6.43063 0.218
NP_439979.1_9 Reverse -356 -374 7.29564 0.288
NP_440761.1_4 Reverse -66 -85 -14.1602 0.257
NP_441859.1_3 Forward -357 -338 1.57197 0.281
NP_440304.1_4 Forward -318 -308 3.12662 0.299
NP_440044.1_8 Reverse -149 -168 6.4893 0.0914
NP_441935.1_1 Forward -122 -103 5.211 0.293
NP_441594.1_6 Reverse -319 -338 10.5209 0.125
NP_441594.1_6 Forward -160 -141 6.78429 0.186
NP_442367.1_1 Reverse -381 -400 -10.522 0.26
NP_442827.1_7 Forward -319 -301 12.6055 0.263
NP_442136.1_4 Reverse -349 -368 5.50519 0.295
NP_440410.1_10 Forward -390 -371 10.5209 0.199
NP_440447.1_1 Forward -121 -103 8.37728 0.194
NP_441713.1_1 Reverse -88 -107 -16.0285 0.275
NP_440178.1_7 Forward -281 -262 -22.42 0.265
NP_442570.1_3 Reverse -74 -93 -4.13045 0.227
NP_442570.1_3 Reverse -75 -94 -5.50708 0.244
NP_442570.1_3 Reverse -53 -72 -6.78538 0.259
NP_441624.1_7 Reverse -382 -396 9.14437 0.223
NP_441163.1_1 Reverse -300 -317 4.26636 0.291
NP_440747.1_10 Reverse -385 -397 -12.0557 0.199
NP_441854.1_10 Reverse -105 -124 -0.000545616 0.286
NP_442634.1_4 Reverse -69 -83 -3.34366 0.161
NP_442848.1_9 Forward -79 -60 1.76941 0.255
NP_441634.1_8 Reverse -102 -116 3.24451 0.154
NP_441634.1_8 Reverse -386 -400 -4.13031 0.295
NP_442191.1_4 Reverse -105 -119 12.4475 0.209
NP_441077.1_6 Forward -37 -21 2.80187 0.276
NP_442485.1_3 Reverse -371 -390 5.11266 0.169
NP_442485.1_3 Forward -327 -308 0.196116 0.247
NP_440642.1_1 Reverse -208 -227 9.63589 0.239
NP_441746.1_2 Reverse -381 -400 13.9625 0.248
NP_440667.1_2 Reverse -175 -194 -7.96535 0.288
NP_441950.1_8 Reverse -318 -332 5.21113 0.281
NP_441763.1_10 Forward -246 -227 4.81688 0.297
NP_442782.1_2 Reverse -71 -85 9.34103 0.198
NP_441487.1_9 Forward -281 -262 -3.04881 0.298
NP_442937.1_5 Reverse -137 -156 13.0775 0.095
NP_441127.1_1 Forward -122 -108 8.45605 0.295
NP_440203.1_5 Reverse -310 -320 11.6809 0.182
NP_439905.1_1 Reverse -314 -327 11.3273 0.204
NP_440984.1_7 Reverse -317 -331 6.6861 0.204
NP_440153.1_8 Reverse -158 -171 2.67422 0.21
NP_442064.1_4 Reverse -378 -397 8.25844 0.235
NP_443055.1_3 Reverse -62 -81 14.3693 0.132
NP_443055.1_6 Reverse -374 -392 -2.04653 0.287
NP_440993.1_3 Forward -129 -110 -1.08295 0.276
NP_440934.1_1 Reverse -69 -88 15.2408 0.0969
NP_441348.1_3 Forward -227 -208 10.4225 0.198
NP_442853.1_5 Reverse -160 -179 5.89851 0.287
NP_442853.1_10 Forward -238 -219 9.04509 0.24
NP_440106.1_2 Forward -112 -94 11.7205 0.28
NP_441646.1_1 Reverse -76 -95 -0.787193 0.272
NP_442431.1_10 Reverse -221 -239 9.55725 0.131
NP_441292.1_8 Forward -129 -110 18.9773 0.0759
NP_441000.1_6 Reverse -60 -74 2.2612 0.145
NP_440206.1_9 Forward -323 -304 11.6025 0.272
NP_441041.1_4 Forward -280 -261 -9.047 0.211
NP_441041.1_4 Reverse -316 -335 -12.6852 0.272
NP_441041.1_7 Reverse -344 -356 5.37687 0.26
NP_440202.1_8 Forward -111 -92 10.4872 0.297
NP_440983.1_5 Forward -235 -216 -8.26035 0.294
NP_440260.1_8 Reverse -68 -86 -3.91409 0.26
NP_440260.1_8 Forward -400 -382 -4.8974 0.273
NP_442500.1_8 Forward -37 -23 9.50354 0.285
NP_441556.1_7 Forward -81 -62 -0.689632 0.3
NP_441556.1_7 Forward -332 -313 -1.47628 0.3
NP_442215.1_2 Reverse -204 -220 -4.75968 0.239
NP_442029.1_6 Reverse -78 -97 10.9142 0.17
NP_442926.1_3 Forward -91 -72 4.62101 0.251
NP_442554.1_8 Forward -390 -380 2.53664 0.268
NP_442554.1_8 Forward -79 -69 2.24165 0.276
NP_442313.1_5 Forward -396 -377 13.4708 0.185
NP_442142.1_4 Forward -394 -381 10.0485 0.0806
NP_442142.1_4 Forward -83 -70 9.36014 0.0973
NP_442301.1_2 Forward -248 -229 3.53858 0.293
NP_441715.1_4 Reverse -62 -72 6.56821 0.138
NP_441715.1_4 Forward -372 -362 4.3066 0.29
NP_440730.1_4 Reverse -292 -311 2.45773 0.237
NP_440730.1_4 Forward -317 -298 -0.885524 0.27
NP_440730.1_4 Forward -316 -297 -4.91709 0.298
NP_441448.1_1 Forward -333 -314 12.6841 0.165
NP_441448.1_1 Reverse -314 -333 4.22769 0.279
NP_440183.1_9 Reverse -105 -124 -12.6852 0.26
NP_440183.1_9 Forward -389 -370 -17.9951 0.276
NP_440379.1_5 Forward -400 -381 -2.75381 0.202
NP_441015.1_10 Reverse -72 -91 -5.21209 0.219
NP_441015.1_10 Reverse -78 -97 -9.73531 0.282
NP_441015.1_10 Forward -63 -44 -11.6036 0.298
NP_441339.1_4 Reverse -381 -400 -4.32711 0.249
NP_440265.1_7 Reverse -71 -85 17.8952 0.147
NP_441764.1_8 Forward -136 -126 12.7463 0.284
NP_441612.1_2 Forward -86 -76 11.5505 0.21
NP_442820.1_3 Reverse -151 -161 11.9759 0.3
NP_442542.1_2 Reverse -386 -399 5.32916 0.272
NP_442542.1_2 Forward -169 -156 4.54251 0.3
NP_442342.1_9 Reverse -117 -133 2.22182 0.29
NP_441114.1_3 Reverse -105 -114 7.66954 0.231
NP_440558.1_2 Forward -400 -381 -3.3438 0.234
NP_440558.1_2 Forward -107 -88 -4.32711 0.244
NP_440558.1_2 Reverse -100 -119 -6.78538 0.28
NP_441878.1_6 Reverse -381 -391 -0.0199663 0.163
NP_441590.1_4 Forward -96 -77 8.25844 0.249
NP_441590.1_4 Forward -373 -354 1.86696 0.299
NP_442066.2_4 Forward -397 -378 -5.40875 0.242
NP_441433.1_8 Forward -126 -107 -2.75381 0.27
NP_442777.1_1 Reverse -160 -179 9.83173 0.194
NP_441458.1_10 Forward -400 -381 2.85105 0.261
NP_441574.1_1 Reverse -71 -90 4.81767 0.129
NP_441574.1_1 Reverse -370 -389 -3.14714 0.236
NP_441633.1_3 Reverse -201 -214 -0.177378 0.14
NP_442590.1_10 Reverse -64 -83 10.4225 0.181
NP_442998.1_5 Forward -87 -77 11.2881 0.189
NP_441559.1_8 Forward -75 -61 7.66941 0.0715
NP_441270.1_5 Reverse -223 -242 11.7256 0.273
NP_442158.1_4 Reverse -224 -234 11.3864 0.278
NP_440717.1_1 Forward -228 -209 5.50599 0.272
NP_440748.1_5 Forward -400 -381 5.01433 0.195
NP_440748.1_5 Forward -89 -70 -2.45882 0.274
NP_441464.1_1 Forward -84 -65 10.0292 0.24
NP_440570.1_5 Reverse -378 -397 -4.03212 0.299
NP_441750.1_7 Reverse -174 -184 15.713 0.254
NP_441947.1_10 Forward -399 -381 10.6389 0.15
NP_440168.1_9 Reverse -305 -324 3.04771 0.231
NP_440327.1_6 Reverse -221 -240 3.24438 0.285
NP_442714.1_5 Reverse -266 -285 5.50599 0.238
NP_440586.1_8 Reverse -72 -79 5.8403 0.283
NP_440027.1_3 Forward -397 -379 5.22993 0.245
NP_440027.1_3 Forward -383 -365 3.55831 0.27
NP_440027.1_8 Reverse -210 -229 12.585 0.205
NP_440027.1_8 Forward -400 -381 5.30853 0.28
NP_439937.1_9 Reverse -26 -43 -17.268 0.296
NP_442239.1_8 Reverse -220 -239 6.88262 0.263
NP_441789.1_7 Forward -374 -355 7.96345 0.193
NP_440819.1_5 Reverse -305 -313 7.8859 0.266
NP_440316.1_10 Reverse -387 -397 6.8632 0.251
NP_440316.1_10 Reverse -381 -391 5.68323 0.29
NP_441877.1_7 Reverse -377 -396 -0.39464 0.284
NP_441018.1_7 Reverse -378 -397 15.1424 0.115
NP_441018.1_7 Reverse -67 -86 13.9625 0.131
NP_442262.1_10 Reverse -257 -264 7.21728 0.281
NP_442244.1_6 Reverse -370 -389 4.62101 0.291
NP_440163.1_10 Reverse -68 -78 7.84651 0.299
NP_440282.1_10 Forward -90 -71 5.80098 0.125
NP_442693.1_6 Forward -86 -67 2.3594 0.278
NP_440297.1_1 Forward -388 -369 8.94757 0.197
NP_440297.1_9 Reverse -383 -393 0.0783647 0.282
NP_440894.1_10 Reverse -156 -175 2.0644 0.298
NP_440888.1_2 Forward -397 -383 8.55376 0.156
NP_441759.1_8 Reverse -108 -127 6.98015 0.258
NP_442845.1_2 Reverse -77 -91 15.3392 0.0729
NP_442845.1_2 Forward -86 -72 6.58777 0.207
NP_443064.1_8 Reverse -315 -325 16.4991 0.189
NP_442646.1_7 Forward -130 -111 11.4058 0.214
NP_440220.1_4 Reverse -21 -40 -2.26292 0.269
NP_443062.1_1 Reverse -71 -89 5.32818 0.231
NP_442204.1_1 Forward -62 -51 5.17188 0.215
NP_442120.1_10 Reverse -71 -90 -12.1936 0.27
NP_440673.1_3 Reverse -173 -180 6.3323 0.283
NP_441052.1_2 Reverse -77 -87 1.74999 0.229
NP_441884.1_9 Forward -334 -315 -22.3217 0.277
NP_442864.1_2 Forward -153 -134 16.0274 0.214
NP_442414.1_8 Reverse -109 -128 5.50599 0.293
NP_441004.1_1 Reverse -221 -240 -17.6018 0.292
NP_442813.1_4 Reverse -212 -231 -9.24366 0.3
NP_442366.1_3 Reverse -70 -88 0.805796 0.163
NP_440129.1_10 Forward -323 -309 3.34284 0.214
NP_440094.1_9 Reverse -219 -238 -0.983855 0.199
NP_441228.1_8 Forward -378 -359 13.3725 0.151
NP_441966.1_7 Forward -395 -376 -1.77127 0.297
NP_442314.1_3 Reverse -384 -398 15.7325 0.187
NP_442843.1_1 Forward -390 -371 -2.36049 0.203
NP_442843.1_1 Reverse -365 -384 -9.73531 0.269
NP_439960.1_10 Reverse -381 -399 6.214 0.142
NP_439960.1_10 Reverse -312 -330 -2.3408 0.254
NP_440726.1_2 Forward -389 -370 11.7992 0.194
NP_440954.1_1 Reverse -214 -233 -3.93378 0.289
NP_440943.1_5 Forward -211 -197 13.3726 0.24
NP_442006.1_2 Forward -121 -104 -8.22096 0.192
NP_442006.1_2 Reverse -313 -330 -13.9242 0.198
NP_441570.1_1 Reverse -77 -95 -13.4522 0.223
NP_441078.1_9 Forward -323 -304 12.9791 0.15
NP_441663.1_8 Forward -362 -343 -3.14714 0.276
NP_442348.1_2 Forward -317 -308 13.5694 0.179
NP_442443.1_1 Reverse -365 -384 6.58763 0.152
NP_442443.1_1 Reverse -356 -375 -1.57384 0.237
NP_442443.1_1 Reverse -116 -135 -6.68705 0.295
NP_441432.1_8 Reverse -387 -396 5.80125 0.137
NP_441732.1_5 Forward -91 -77 11.8976 0.21
NP_440131.1_4 Reverse -381 -400 4.71934 0.275
NP_441057.1_4 Reverse -378 -396 -1.75081 0.272
NP_440757.1_7 Forward -133 -115 -0.7675 0.269
NP_439956.1_7 Reverse -65 -84 7.27595 0.257
NP_442346.1_5 Forward -158 -148 7.35486 0.172
NP_442346.1_5 Reverse -70 -80 5.19158 0.256
NP_442346.1_10 Reverse -371 -390 14.5524 0.0935
NP_441629.1_3 Reverse -199 -218 5.50519 0.214
NP_441585.1_5 Forward -323 -304 3.83357 0.255
NP_441948.1_4 Reverse -54 -72 -3.71743 0.203
NP_441047.1_2 Forward -396 -377 21.9273 0.0268
NP_441047.1_2 Forward -85 -66 -1.96717 0.273
NP_441895.1_2 Forward -185 -166 -26.9432 0.275
NP_442199.1_5 Forward -399 -380 -1.96717 0.184
NP_442140.1_3 Reverse -314 -324 3.42162 0.297
NP_441671.1_1 Reverse -107 -126 -0.983855 0.273
NP_441671.1_10 Reverse -340 -359 -0.197208 0.29
NP_440875.1_9 Forward -78 -68 12.7522 0.104
NP_441813.1_7 Forward -236 -222 10.9137 0.23
NP_441259.1_3 Forward -181 -162 7.17762 0.251
NP_442886.1_1 Reverse -33 -47 18.0925 0.259
NP_440821.1_10 Reverse -198 -216 17.4483 0.238
NP_441239.1_9 Reverse -380 -392 11.7404 0.0551
NP_441239.1_9 Forward -94 -82 7.70879 0.15
NP_441239.1_9 Forward -393 -381 6.52882 0.185
NP_441239.1_9 Forward -82 -70 3.97222 0.269
NP_441892.1_1 Forward -176 -159 -4.87771 0.269
NP_442105.1_9 Forward -143 -129 17.8465 0.151
NP_441508.1_4 Forward -195 -181 13.1895 0.297
NP_440546.1_4 Reverse -71 -81 10.9186 0.101
NP_440675.1_1 Reverse -304 -323 1.86774 0.283
NP_442340.1_3 Forward -329 -310 -10.0303 0.278
NP_440532.1_1 Forward -322 -303 19.0757 0.0833
NP_441474.1_1 Forward -182 -163 -3.34455 0.298
NP_442402.1_4 Reverse -22 -41 -7.86776 0.278
NP_441084.1_6 Forward -82 -68 13.1254 0.145
NP_440505.1_3 Reverse -386 -396 4.60159 0.277
NP_440914.1_1 Reverse -347 -357 6.07773 0.297
NP_441011.1_10 Forward -207 -188 13.0775 0.294
NP_442533.1_6 Reverse -71 -80 4.62128 0.179
NP_442533.1_6 Forward -391 -382 4.0313 0.194
NP_442541.1_10 Reverse -103 -117 1.27731 0.287
NP_442269.1_10 Reverse -72 -91 7.66927 0.194
NP_442269.1_10 Reverse -371 -390 1.27776 0.298
NP_441697.1_5 Reverse -9 -28 -10.6478 0.28
NP_441028.1_6 Forward -270 -260 6.86274 0.23
NP_440115.1_6 Reverse -344 -354 6.17489 0.197
NP_441544.1_1 Reverse -101 -113 15.9686 0.242
NP_441602.1_3 Reverse -78 -97 -1.67217 0.23
NP_441602.1_3 Reverse -99 -118 -2.65548 0.235
NP_442588.1_1 Reverse -310 -329 5.30933 0.29
NP_442674.1_3 Reverse -69 -88 9.63507 0.174
NP_440828.1_4 Forward -332 -313 -7.17944 0.285
NP_442022.1_4 Reverse -71 -90 7.47261 0.268
NP_442794.1_1 Reverse -384 -396 5.44718 0.221
NP_442794.1_1 Reverse -73 -85 2.79224 0.286
NP_441962.1_4 Forward -330 -311 -15.1435 0.299
NP_441431.1_2 Forward -96 -82 9.83206 0.176
NP_441993.1_1 Reverse -221 -240 3.89583 0.227
NP_441174.1_2 Reverse -370 -384 13.0776 0.222
NP_442437.1_8 Reverse -314 -333 5.50599 0.25
NP_440492.1_8 Forward -227 -208 11.5033 0.265
NP_440293.1_3 Reverse -75 -94 -5.9004 0.285
NP_442680.1_7 Forward -46 -27 -3.54046 0.265
NP_440801.1_10 Forward -120 -101 9.73422 0.272
NP_441436.1_8 Forward -135 -116 8.75091 0.277
NP_440734.1_8 Reverse -371 -390 13.4708 0.261
NP_441885.1_5 Reverse -154 -164 4.3066 0.0745
NP_442310.1_1 Reverse -69 -88 10.2259 0.284
NP_442341.1_7 Forward -87 -73 1.76955 0.281
NP_442369.1_5 Reverse -182 -201 16.1257 0.288
NP_441173.1_9 Forward -198 -190 12.1137 0.21
NP_440727.1_2 Reverse -140 -159 3.04771 0.288
NP_441902.1_1 Forward -388 -369 11.7983 0.282
NP_442451.1_2 Reverse -96 -115 -9.24366 0.259
NP_439962.1_6 Forward -400 -382 16.8337 0.169
NP_440175.1_7 Reverse -67 -85 20.0006 0.0493
NP_440175.1_7 Reverse -378 -396 13.5596 0.189
NP_441105.1_3 Forward -91 -72 11.8975 0.0363
NP_441105.1_3 Reverse -353 -372 -6.1954 0.23
NP_441105.1_3 Reverse -377 -396 -7.17871 0.248
NP_440216.1_9 Forward -111 -102 10.2261 0.286
NP_440216.1_9 Forward -41 -32 6.29291 0.289
NP_442015.1_10 Forward -395 -382 -0.177378 0.255
NP_441766.1_9 Reverse -314 -333 6.58763 0.18
NP_440416.1_9 Forward -398 -379 4.81767 0.0355
NP_443052.1_9 Reverse -377 -396 -6.09707 0.276
NP_443052.1_9 Forward -371 -352 -6.58872 0.285
NP_443052.1_9 Forward -398 -379 -7.08038 0.293
NP_442154.1_1 Reverse -169 -187 -18.1721 0.278
NP_440988.1_10 Forward -399 -385 13.1279 0.176
NP_440988.1_10 Forward -333 -319 4.60839 0.258
NP_440988.1_10 Reverse -314 -328 4.41476 0.261
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATCGCCACTGCCAGGGCCGGAATGTCCGCCAGCACTAGATCCACCCGATTGTTCCGTAAATAGTTAGACTCCGTGGCCACCAGGGCATTTTCCCGCTTGTAAATATCCTGTAAAGCTTGCAGGGTCGCCTTTTCATCCATCTGTAAACTATCTGCCTGTACCACGCCAACATCAAAAGCCACTGGGCGGTGAATAAAGGGTTTTTCCAAATAACACTCCAGCAACCAACGGGGGCTACGGGTAGCCATGATTATCAACGCATCAGGGCAAAGTTCCTGGACCCGGCGGGCAATGCAAGCAGTCCGCACCGCATGGCCAAAACCATGGCCGGTAATTGCACAGTAGAGGGTGGGACGTTTCATGGAAAAAGCTCGGAATTATGAAGATTTCTGTTGACCA

CDS

GTGAGGCGATCGGGATTTTTCCCGCACAATAACAGTAATAGCTCGGTGAATTTAGAGGTAAAGTCCGTGCAGAGCAACAAGTATTCAATCGCCCCATCGACCTTTACCAATCCGGCCGAAGCTTCCACCCATGATCGCATTTTGAAGGGAGCTTTGAAATTATTTGGCACTAAGGGTTACGAAGGTACTACCACAAAGGATTTGGCCCAGGCAGCCAACGTGGCCGAAGGAACGCTATTCCGTTATTTCACCAATAAGAAGGCCATTTTGGTGGAAGTGGCCACCGCCGGCTGGGTGGAAATTCTCACCGATTTATTGACTGAATTAAGCGAGATGGGCAGTTACAAGGCGATCGCCCAGGTGATGAAACGGCGGATGTTCCATTTGCGGGAAAACAAATATCTATTGCAAGTGTGCTTTGTGGAAGCCCAATATCACCCGGAGCTACGGGAAAAAATCCAGTCGGAAATTATCGACAAAATGACCGATGTGGCGGAAGCCTTTTTCCAAACCGCCATGGACCGAGGCATTTACCGGCGAATGAATCCCAAAATTGTCGCCCAGGTTTTTTTGGGTATGTTTGCGGTGGCTGGTTTTTCCGAACAAACGGTGATTGACCCCCACGCTTCCCCCCAGGCTTTGCAAGAAATGGCGGAAGGTTTAGCAGATATTTTTCTTAACGGAGTGTTAGCTAAAGGAGAAAAAATGTGA

Protein

MRRSGFFPHNNSNSSVNLEVKSVQSNKYSIAPSTFTNPAEASTHDRILKGALKLFGTKGYEGTTTKDLAQAANVAEGTLFRYFTNKKAILVEVATAGWVEILTDLLTELSEMGSYKAIAQVMKRRMFHLRENKYLLQVCFVEAQYHPELREKIQSEIIDKMTDVAEAFFQTAMDRGIYRRMNPKIVAQVFLGMFAVAGFSEQTVIDPHASPQALQEMAEGLADIFLNGVLAKGEKM