Your browser is old and dusty. Try Google Chrome!

Details for sll1285

ORF sll1285
Accession NP_440537.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -175 -189 15.4376 0.104
NP_441061.1_2 Forward -183 -169 9.93102 0.0668
NP_441061.1_2 Reverse -29 -43 2.85119 0.17
NP_441061.1_2 Forward -324 -310 -0.787057 0.239
NP_441061.1_2 Reverse -43 -57 -1.96703 0.278
NP_440795.1_7 Forward -183 -176 14.6904 0.0123
NP_440795.1_7 Reverse -176 -183 14.6904 0.0123
NP_441418.1_6 Forward -184 -165 -21.83 0.16
NP_441418.1_6 Reverse -175 -194 -28.3199 0.204
NP_441418.1_6 Forward -277 -258 -29.4998 0.228
NP_440815.1_5 Forward -184 -165 6.29264 0.275
NP_441453.1_4 Reverse -175 -183 16.539 0.00633
NP_441453.1_4 Forward -184 -176 16.539 0.00633
NP_441453.1_4 Reverse -210 -218 4.73931 0.252
NP_441453.1_4 Forward -277 -269 4.34598 0.257
NP_441453.1_4 Reverse -268 -276 4.34598 0.257
NP_441453.1_4 Reverse -28 -36 4.24765 0.259
NP_441453.1_7 Reverse -280 -287 12.9205 0.23
NP_441623.1_1 Reverse -280 -298 3.06741 0.202
NP_441623.1_1 Forward -63 -45 -3.22577 0.256
NP_441960.1_7 Forward -296 -277 11.0125 0.235
NP_442151.1_6 Reverse -175 -189 10.4227 0.123
NP_442151.1_6 Forward -184 -170 7.27608 0.205
NP_441818.1_1 Forward -183 -172 14.4145 0.0502
NP_441818.1_9 Reverse -186 -205 -10.3253 0.292
NP_440226.1_1 Reverse -175 -194 7.57094 0.103
NP_440120.1_4 Reverse -223 -237 13.5693 0.29
NP_442623.1_3 Reverse -176 -195 -17.9951 0.263
NP_442655.1_1 Reverse -170 -189 -0.197208 0.242
NP_442655.1_2 Reverse -176 -195 4.32602 0.23
NP_442173.1_1 Forward -183 -175 15.4574 0.00633
NP_442173.1_1 Reverse -176 -184 15.4574 0.00633
NP_442752.1_4 Forward -184 -177 13.8055 0.0199
NP_442752.1_4 Reverse -175 -182 13.8055 0.0199
NP_442752.1_4 Forward -281 -274 9.47889 0.109
NP_443027.1_4 Forward -186 -176 13.2547 0.0521
NP_443027.1_4 Reverse -46 -56 6.8632 0.262
NP_443027.1_4 Reverse -173 -183 6.46988 0.275
NP_442975.1_10 Forward -223 -209 9.73373 0.0646
NP_442975.1_10 Reverse -171 -185 3.73557 0.252
NP_440784.1_7 Forward -183 -176 15.9687 0.0123
NP_440784.1_7 Reverse -176 -183 15.9687 0.0123
NP_442909.1_7 Forward -183 -169 5.60385 0.275
NP_440061.1_9 Forward -186 -172 12.9786 0.0878
NP_440061.1_9 Forward -321 -307 8.55376 0.17
NP_440061.1_9 Forward -39 -25 5.80051 0.272
NP_440061.1_9 Forward -54 -40 5.70218 0.275
NP_440110.1_8 Reverse -173 -192 1.57275 0.211
NP_441476.1_5 Forward -205 -186 8.65258 0.0933
NP_442062.1_8 Forward -184 -174 17.6796 0.00193
NP_442062.1_8 Reverse -175 -185 10.3048 0.0493
NP_442062.1_8 Forward -37 -27 4.79825 0.198
NP_442062.1_8 Reverse -315 -325 3.22496 0.279
NP_440761.1_4 Reverse -170 -189 5.80098 0.0718
NP_441859.1_3 Forward -185 -166 11.5033 0.108
NP_440304.1_4 Reverse -173 -183 17.9746 0.00654
NP_440304.1_4 Forward -186 -176 10.8948 0.051
NP_440304.1_4 Reverse -243 -253 1.94665 0.299
NP_442242.1_4 Forward -183 -176 14.3954 0.0124
NP_442242.1_4 Reverse -176 -183 14.3954 0.0124
NP_442242.1_4 Reverse -211 -218 10.7572 0.153
NP_440044.1_8 Forward -218 -199 -2.16383 0.261
NP_441781.1_7 Forward -283 -264 -0.4922 0.259
NP_440908.1_5 Forward -182 -165 14.6902 0.161
NP_440916.1_1 Forward -236 -222 16.6175 0.177
NP_439918.1_2 Reverse -187 -206 -3.04881 0.251
NP_439918.1_2 Forward -277 -258 -4.72043 0.283
NP_439923.1_10 Reverse -193 -212 12.5858 0.291
NP_441161.1_3 Reverse -169 -187 10.5406 0.237
NP_441208.1_9 Reverse -172 -186 14.3559 0.0974
NP_441594.1_6 Reverse -201 -220 2.3594 0.252
NP_441594.1_6 Reverse -307 -326 0.982764 0.276
NP_442110.1_7 Reverse -175 -189 12.3893 0.0586
NP_442110.1_7 Reverse -28 -42 2.45787 0.222
NP_441082.1_10 Reverse -181 -194 12.409 0.236
NP_441082.1_10 Forward -348 -335 9.16406 0.256
NP_441925.1_4 Forward -202 -183 -15.0459 0.263
NP_440856.1_4 Forward -191 -172 1.67108 0.157
NP_441083.1_5 Forward -184 -174 19.3512 0.000718
NP_441083.1_5 Reverse -175 -185 11.2881 0.0159
NP_441083.1_5 Forward -219 -209 1.16001 0.215
NP_441083.1_5 Reverse -99 -109 -0.708283 0.276
NP_442827.1_8 Forward -192 -173 3.14526 0.151
NP_441738.1_2 Forward -182 -175 15.28 0.0102
NP_441738.1_2 Reverse -177 -184 15.28 0.0102
NP_441738.1_2 Forward -322 -315 6.72528 0.236
NP_441558.1_5 Forward -186 -167 11.6025 0.0789
NP_441558.1_5 Reverse -173 -192 11.0125 0.0879
NP_440209.1_1 Reverse -175 -183 18.1123 0.00295
NP_440209.1_1 Forward -184 -176 18.1123 0.00295
NP_440655.1_2 Forward -221 -202 0.884433 0.293
NP_442889.1_1 Forward -301 -282 -14.9469 0.283
NP_442889.1_1 Forward -260 -241 -15.2418 0.288
NP_442889.1_8 Forward -222 -208 9.93039 0.0933
NP_440447.1_1 Forward -189 -171 8.27895 0.194
NP_441713.1_1 Reverse -169 -188 -12.3902 0.244
NP_441770.1_4 Reverse -296 -315 -8.94866 0.246
NP_440178.1_7 Reverse -174 -193 6.88262 0.013
NP_440178.1_7 Forward -185 -166 -20.8467 0.201
NP_442570.1_3 Forward -327 -308 -2.36049 0.212
NP_442570.1_3 Reverse -183 -202 -2.45882 0.212
NP_442570.1_3 Forward -45 -26 -4.22878 0.228
NP_442570.1_3 Reverse -184 -203 -5.31042 0.242
NP_442570.1_10 Reverse -97 -116 8.75091 0.288
NP_442111.1_4 Reverse -174 -188 20.1574 0.00327
NP_441624.1_7 Forward -43 -29 14.7492 0.158
NP_440343.1_9 Reverse -176 -195 8.35759 0.26
NP_440343.1_9 Reverse -181 -200 6.4893 0.3
NP_440906.1_5 Forward -183 -176 15.8704 0.0124
NP_440906.1_5 Reverse -176 -183 15.8704 0.0124
NP_440747.1_10 Forward -187 -175 17.1486 0.000663
NP_440747.1_10 Reverse -172 -184 -1.92764 0.0192
NP_440747.1_10 Reverse -312 -324 -11.8591 0.161
NP_440747.1_10 Forward -40 -28 -11.8591 0.161
NP_440747.1_10 Reverse -25 -37 -11.8591 0.161
NP_440747.1_10 Reverse -207 -219 -11.9574 0.178
NP_440747.1_10 Reverse -282 -294 -12.0557 0.199
NP_441130.1_10 Forward -186 -172 8.94771 0.131
NP_441130.1_10 Reverse -173 -187 7.27608 0.164
NP_442634.1_4 Reverse -173 -187 14.4542 0.0192
NP_442634.1_4 Forward -186 -172 5.70279 0.0525
NP_440842.1_5 Reverse -23 -42 12.8684 0.283
NP_440842.1_6 Reverse -18 -37 11.7983 0.259
NP_442848.1_1 Reverse -169 -183 -3.54032 0.268
NP_442848.1_9 Reverse -107 -126 3.04771 0.245
NP_442848.1_9 Forward -190 -171 0.982764 0.265
NP_441012.1_4 Reverse -264 -277 17.0305 0.137
NP_443018.1_3 Forward -183 -176 14.8871 0.0123
NP_443018.1_3 Reverse -176 -183 14.8871 0.0123
NP_443018.1_3 Forward -276 -269 12.5271 0.0523
NP_443018.1_3 Reverse -269 -276 12.5271 0.0523
NP_443018.1_3 Reverse -154 -161 10.2655 0.107
NP_443018.1_3 Forward -42 -35 9.38056 0.128
NP_443018.1_3 Forward -36 -29 4.26735 0.267
NP_443018.1_3 Reverse -29 -36 4.16902 0.278
NP_441316.1_7 Reverse -173 -188 5.19144 0.121
NP_441634.1_8 Forward -186 -172 5.30946 0.114
NP_441634.1_8 Reverse -208 -222 3.63784 0.145
NP_441634.1_8 Reverse -189 -203 -0.295402 0.252
NP_440376.1_1 Forward -184 -175 19.4693 0.000692
NP_440376.1_1 Reverse -175 -184 19.4693 0.000692
NP_440376.1_1 Reverse -210 -219 8.06287 0.0463
NP_440376.1_1 Forward -37 -28 4.52295 0.156
NP_440376.1_1 Reverse -315 -324 4.22796 0.166
NP_440376.1_1 Forward -219 -210 -0.196935 0.285
NP_442730.1_8 Forward -192 -173 5.30853 0.252
NP_442687.1_7 Reverse -174 -184 18.5646 0.0028
NP_442687.1_7 Forward -185 -175 9.02648 0.0994
NP_442687.1_7 Reverse -27 -37 4.89658 0.23
NP_442191.1_4 Reverse -176 -190 17.1014 0.0243
NP_440066.1_5 Reverse -279 -298 7.4718 0.261
NP_441846.1_10 Reverse -174 -193 -14.9469 0.241
NP_441846.1_10 Reverse -192 -211 -23.305 0.282
NP_440642.1_10 Forward -66 -52 10.0287 0.175
NP_440642.1_10 Forward -230 -216 2.8506 0.277
NP_440642.1_10 Reverse -326 -340 2.5556 0.277
NP_441013.1_2 Forward -195 -177 2.77242 0.236
NP_441013.1_3 Forward -283 -264 15.6341 0.201
NP_440360.1_10 Forward -182 -168 4.62115 0.227
NP_440360.1_10 Forward -160 -146 3.53951 0.232
NP_440360.1_10 Reverse -270 -284 3.24451 0.239
NP_442658.1_1 Reverse -173 -183 17.6791 0.00565
NP_442658.1_1 Forward -186 -176 14.2375 0.0237
NP_442658.1_1 Forward -279 -269 6.56775 0.224
NP_442782.1_2 Reverse -175 -189 8.16106 0.198
NP_442205.1_9 Reverse -169 -185 -1.61309 0.264
NP_441414.1_9 Forward -184 -165 2.85105 0.0623
NP_441414.1_9 Reverse -175 -194 -8.85033 0.247
NP_442321.1_1 Forward -279 -260 -6.39206 0.24
NP_441958.1_5 Forward -185 -175 21.2195 0.000805
NP_441958.1_5 Reverse -174 -184 20.5312 0.000966
NP_441127.1_1 Reverse -34 -48 7.76774 0.3
NP_442836.1_5 Reverse -169 -188 3.83436 0.225
NP_442836.1_10 Forward -96 -86 9.22315 0.282
NP_440203.1_5 Reverse -31 -41 16.4008 0.0611
NP_440203.1_5 Forward -322 -312 13.6475 0.112
NP_439905.1_1 Forward -318 -305 11.819 0.204
NP_440984.1_7 Forward -189 -175 10.0294 0.126
NP_440984.1_7 Reverse -170 -184 9.73436 0.127
NP_439990.1_5 Forward -189 -176 10.639 0.128
NP_442376.1_2 Reverse -170 -189 -10.9153 0.286
NP_442376.1_2 Forward -282 -263 -13.0786 0.286
NP_442690.1_1 Forward -250 -231 -12.8819 0.25
NP_442911.1_2 Reverse -165 -184 11.3075 0.0131
NP_441580.1_6 Forward -195 -176 -6.78538 0.235
NP_440153.1_5 Reverse -176 -190 13.9626 0.0551
NP_440153.1_8 Reverse -268 -281 12.0157 0.16
NP_440153.1_8 Reverse -28 -41 -3.12731 0.285
NP_442064.1_4 Forward -47 -28 4.12856 0.298
NP_440993.1_2 Forward -189 -173 15.2998 0.0631
NP_441129.1_3 Reverse -24 -43 -17.6018 0.281
NP_441099.1_5 Reverse -165 -184 6.29264 0.0467
NP_441099.1_5 Forward -194 -175 1.76941 0.061
NP_441099.1_5 Reverse -89 -108 -9.14533 0.214
NP_442002.1_9 Reverse -174 -181 14.1004 0.074
NP_440411.1_10 Forward -279 -260 10.4569 0.273
NP_441646.1_7 Reverse -269 -283 13.5693 0.28
NP_442438.1_10 Forward -189 -175 1.76955 0.188
NP_441398.1_9 Forward -194 -175 13.2733 0.288
NP_441000.1_6 Reverse -174 -188 -3.04867 0.221
NP_440605.1_9 Forward -117 -101 17.5152 0.284
NP_440147.1_4 Forward -186 -173 19.9805 0.00251
NP_440147.1_4 Reverse -173 -186 11.0324 0.0341
NP_440147.1_4 Reverse -119 -132 5.32916 0.129
NP_441175.1_7 Reverse -175 -194 9.83255 0.175
NP_441295.1_4 Forward -42 -23 0.392778 0.29
NP_441550.1_8 Reverse -173 -183 19.8424 0.00352
NP_441550.1_8 Forward -186 -176 15.8108 0.0132
NP_441916.1_7 Reverse -175 -185 18.9579 0.00144
NP_441916.1_7 Forward -184 -174 16.893 0.00407
NP_441916.1_7 Reverse -210 -220 5.68323 0.124
NP_441916.1_7 Forward -277 -267 2.92996 0.235
NP_441916.1_7 Reverse -268 -278 2.92996 0.235
NP_441916.1_7 Forward -37 -27 2.53664 0.25
NP_440206.1_4 Forward -194 -175 4.71854 0.255
NP_441041.1_4 Reverse -175 -194 7.17762 0.0403
NP_441041.1_4 Forward -283 -264 -5.80207 0.159
NP_441041.1_4 Forward -43 -24 -9.93197 0.226
NP_441041.1_4 Forward -277 -258 -12.1936 0.26
NP_441041.1_7 Reverse -172 -184 21.8971 0.000853
NP_441041.1_7 Forward -187 -175 13.3454 0.0485
NP_441041.1_7 Forward -327 -315 5.86276 0.236
NP_441041.1_7 Forward -153 -141 5.57123 0.25
NP_442642.1_9 Forward -338 -321 18.5251 0.0678
NP_442004.1_6 Reverse -268 -282 5.89945 0.181
NP_442004.1_6 Forward -200 -186 1.57289 0.285
NP_441725.1_4 Forward -189 -175 13.7653 0.0693
NP_441725.1_5 Forward -183 -173 18.7612 0.0119
NP_441725.1_5 Reverse -176 -186 1.94665 0.115
NP_441725.1_5 Forward -276 -266 0.176696 0.206
NP_441725.1_5 Reverse -29 -39 -0.708283 0.267
NP_439966.1_7 Forward -186 -176 14.3359 0.0203
NP_439966.1_7 Reverse -173 -183 8.14104 0.14
NP_439966.1_9 Reverse -173 -182 0.983037 0.253
NP_442941.1_3 Reverse -176 -186 19.2529 0.00262
NP_442941.1_3 Forward -183 -173 2.43831 0.14
NP_442941.1_3 Reverse -29 -39 0.668351 0.19
NP_442941.1_3 Forward -218 -208 0.57002 0.199
NP_440289.1_2 Reverse -172 -185 14.1789 0.0118
NP_440289.1_2 Forward -187 -174 6.01747 0.0605
NP_440289.1_2 Reverse -207 -220 0.904263 0.144
NP_440289.1_2 Forward -222 -209 0.0192843 0.178
NP_440289.1_2 Reverse -23 -36 -4.7006 0.294
NP_440983.1_5 Reverse -256 -275 -4.22878 0.254
NP_440983.1_9 Forward -193 -174 9.3409 0.202
NP_440260.1_8 Forward -328 -310 6.70565 0.154
NP_440260.1_8 Forward -297 -279 -2.14413 0.243
NP_440260.1_8 Reverse -295 -313 -2.43913 0.243
NP_441514.1_4 Forward -399 -380 12.4059 0.292
NP_441514.1_6 Reverse -314 -321 12.8221 0.252
NP_442281.1_1 Reverse -170 -184 18.3868 0.00441
NP_442281.1_1 Forward -189 -175 16.5185 0.00772
NP_442281.1_1 Reverse -23 -37 9.53707 0.0685
NP_442281.1_1 Forward -329 -315 5.01387 0.172
NP_442281.1_1 Reverse -263 -277 3.53891 0.228
NP_442281.1_1 Reverse -50 -64 1.5723 0.296
NP_441334.1_7 Reverse -173 -192 -10.817 0.12
NP_441079.1_7 Reverse -378 -397 -3.34455 0.233
NP_442256.1_2 Reverse -173 -191 0.314141 0.123
NP_440437.1_1 Forward -190 -171 19.0757 0.0125
NP_440498.1_1 Forward -204 -186 -3.12744 0.256
NP_442982.1_5 Reverse -38 -57 11.2092 0.114
NP_442068.1_7 Reverse -110 -129 17.0107 0.0308
NP_441644.1_6 Reverse -175 -185 19.0557 0.000803
NP_441644.1_6 Forward -184 -174 15.7125 0.0048
NP_441644.1_6 Reverse -106 -116 3.91283 0.256
NP_441644.1_6 Reverse -28 -38 3.8145 0.261
NP_443049.1_2 Reverse -266 -285 20.944 0.0322
NP_442215.1_2 Reverse -173 -189 -2.30141 0.195
NP_442215.1_2 Reverse -26 -42 -5.64466 0.254
NP_442215.1_2 Forward -256 -240 -6.13632 0.264
NP_442029.1_6 Reverse -181 -200 2.75272 0.289
NP_440253.1_2 Reverse -210 -228 3.3624 0.118
NP_440929.1_8 Forward -184 -175 19.2726 0.000701
NP_440929.1_8 Reverse -175 -184 19.2726 0.000701
NP_440780.1_1 Reverse -376 -395 9.7875 0.274
NP_442933.1_10 Forward -184 -175 17.601 0.00325
NP_442933.1_10 Reverse -175 -184 17.601 0.00325
NP_442933.1_10 Forward -37 -28 5.01461 0.204
NP_442933.1_10 Reverse -268 -277 4.42462 0.246
NP_442933.1_10 Forward -277 -268 4.42462 0.246
NP_441751.2_8 Forward -183 -169 20.4524 0.00617
NP_441751.2_8 Reverse -176 -190 -2.26202 0.132
NP_441751.2_8 Forward -218 -204 -5.70361 0.231
NP_442554.1_8 Reverse -176 -186 17.2863 0.00543
NP_442554.1_8 Forward -183 -173 16.9913 0.0065
NP_442554.1_8 Reverse -35 -45 6.27322 0.123
NP_442554.1_8 Reverse -107 -117 5.5849 0.145
NP_442554.1_8 Reverse -29 -39 5.38824 0.15
NP_442554.1_8 Reverse -269 -279 5.19158 0.157
NP_442554.1_8 Reverse -211 -221 4.20827 0.193
NP_442554.1_8 Forward -276 -266 3.02829 0.245
NP_442554.1_8 Reverse -122 -132 2.92996 0.249
NP_441762.1_7 Forward -185 -173 2.69391 0.0676
NP_441762.1_7 Reverse -174 -186 1.7106 0.0735
NP_441762.1_7 Reverse -209 -221 -7.04085 0.285
NP_442142.1_4 Reverse -172 -185 12.5067 0.0442
NP_442142.1_4 Forward -187 -174 6.21356 0.17
NP_442142.1_9 Reverse -168 -187 2.75272 0.282
NP_442292.1_1 Reverse -176 -185 17.5026 0.00435
NP_442292.1_1 Forward -183 -174 9.53783 0.0183
NP_442292.1_1 Reverse -29 -38 6.09625 0.116
NP_442292.1_5 Reverse -171 -190 -0.39387 0.257
NP_442476.1_6 Forward -199 -185 6.88276 0.118
NP_442476.1_6 Forward -183 -169 2.65453 0.177
NP_442476.1_6 Reverse -176 -190 0.982901 0.233
NP_443009.1_5 Forward -185 -174 17.0694 0.00659
NP_443009.1_5 Reverse -174 -185 16.7744 0.00677
NP_443009.1_5 Reverse -315 -326 6.74468 0.15
NP_443009.1_5 Forward -325 -314 4.8764 0.226
NP_442301.1_2 Reverse -261 -280 6.48849 0.263
NP_442301.1_2 Forward -204 -185 4.91521 0.27
NP_441715.1_4 Reverse -176 -186 16.7946 0.0106
NP_440015.1_9 Reverse -268 -286 2.37909 0.207
NP_441448.1_1 Reverse -32 -51 4.12936 0.279
NP_441198.1_8 Reverse -173 -183 15.2245 0.0427
NP_441198.1_8 Reverse -41 -51 13.076 0.108
NP_441198.1_8 Forward -279 -269 11.8064 0.183
NP_441198.1_8 Reverse -314 -324 11.2205 0.217
NP_440379.1_5 Forward -280 -261 -10.1286 0.276
NP_441468.1_1 Forward -183 -176 15.8704 0.0124
NP_441468.1_1 Reverse -176 -183 15.8704 0.0124
NP_441468.1_1 Forward -36 -29 4.36568 0.237
NP_441468.1_1 Reverse -269 -276 3.97235 0.277
NP_441468.1_1 Forward -276 -269 3.97235 0.277
NP_441020.2_6 Reverse -173 -190 14.2968 0.0573
NP_441015.1_10 Reverse -170 -189 -10.6203 0.286
NP_441015.1_10 Forward -276 -257 -11.0136 0.29
NP_441673.1_1 Forward -184 -175 20.8459 0.000698
NP_441673.1_1 Reverse -175 -184 20.8459 0.000698
NP_441673.1_1 Reverse -210 -219 1.37636 0.114
NP_441673.1_1 Forward -219 -210 1.1797 0.163
NP_441876.1_9 Forward -47 -37 10.4026 0.293
NP_441826.1_2 Reverse -169 -183 11.8976 0.0334
NP_441826.1_2 Forward -190 -176 5.80112 0.096
NP_441826.1_2 Forward -43 -29 -3.54032 0.286
NP_441330.1_1 Forward -120 -101 -12.2919 0.183
NP_442811.1_2 Reverse -161 -180 -1.67217 0.269
NP_442868.1_6 Reverse -173 -183 16.7946 0.0131
NP_442868.1_6 Forward -186 -176 10.4031 0.038
NP_442868.1_6 Forward -326 -316 2.83163 0.205
NP_441056.1_1 Reverse -175 -194 -6.09707 0.267
NP_442559.1_3 Reverse -77 -96 8.45592 0.285
NP_443058.1_7 Reverse -86 -105 1.67108 0.295
NP_442808.1_1 Reverse -174 -184 8.73102 0.0481
NP_442808.1_1 Forward -185 -175 8.73102 0.0481
NP_442808.1_1 Forward -326 -316 1.45457 0.285
NP_441101.1_10 Forward -188 -169 4.42435 0.173
NP_442692.1_1 Forward -211 -192 -3.54046 0.274
NP_442692.1_1 Reverse -89 -108 -6.78538 0.3
NP_440145.1_3 Forward -194 -175 2.0644 0.121
NP_441906.1_2 Forward -197 -178 16.4199 0.105
NP_442542.1_2 Reverse -173 -186 11.9173 0.114
NP_442542.1_2 Forward -221 -208 8.9674 0.142
NP_442050.1_5 Forward -186 -176 15.9091 0.0091
NP_442050.1_5 Reverse -173 -183 14.9258 0.0175
NP_440038.1_4 Forward -249 -230 0.687771 0.275
NP_442342.1_9 Reverse -173 -189 5.46674 0.237
NP_440558.1_2 Forward -280 -261 -2.85214 0.231
NP_440558.1_2 Reverse -19 -38 -4.81876 0.249
NP_440558.1_2 Reverse -265 -284 -5.01543 0.251
NP_440558.1_5 Forward -37 -23 16.6175 0.239
NP_441518.1_3 Reverse -165 -184 -14.3569 0.275
NP_441878.1_6 Reverse -174 -184 20.2362 0.0046
NP_441878.1_6 Forward -185 -175 10.5014 0.0176
NP_441878.1_6 Forward -278 -268 0.668351 0.139
NP_441878.1_6 Reverse -267 -277 0.668351 0.139
NP_441878.1_6 Reverse -27 -37 0.0783647 0.152
NP_441878.1_6 Forward -38 -28 -7.39479 0.222
NP_441878.1_6 Reverse -315 -325 -7.49312 0.231
NP_441878.1_6 Reverse -209 -219 -7.49312 0.231
NP_441878.1_6 Forward -325 -315 -7.68978 0.255
NP_441036.1_8 Forward -185 -175 15.713 0.00724
NP_441036.1_8 Reverse -174 -184 8.4365 0.174
NP_441557.1_5 Forward -184 -175 19.9609 0.000699
NP_441557.1_5 Reverse -175 -184 19.9609 0.000699
NP_441557.1_5 Reverse -210 -219 0.491382 0.144
NP_441557.1_5 Forward -219 -210 0.29472 0.174
NP_441557.1_5 Forward -37 -28 -0.590259 0.219
NP_441557.1_8 Forward -194 -184 15.0242 0.183
NP_441445.1_1 Reverse -201 -220 4.52268 0.193
NP_441445.1_1 Forward -228 -209 -0.0988766 0.286
NP_441590.1_4 Reverse -264 -283 6.39016 0.26
NP_441590.1_6 Forward -335 -316 18.1898 0.174
NP_442066.2_4 Reverse -175 -194 1.17943 0.152
NP_442066.2_9 Reverse -171 -184 10.639 0.154
NP_440084.1_8 Forward -393 -379 14.9084 0.19
NP_440101.1_3 Reverse -170 -189 7.07928 0.18
NP_440101.1_10 Forward -283 -264 14.3558 0.126
NP_442830.1_5 Forward -326 -312 13.7653 0.168
NP_441564.1_10 Forward -126 -107 1.37609 0.287
NP_442183.1_1 Forward -184 -170 21.0424 0.00378
NP_442397.1_9 Reverse -42 -61 11.7992 0.23
NP_441549.1_9 Reverse -171 -189 1.59244 0.101
NP_442347.1_2 Forward -183 -174 3.34298 0.284
NP_442347.1_2 Reverse -176 -185 3.34298 0.284
NP_442645.1_2 Forward -387 -368 -22.5183 0.291
NP_440547.1_1 Forward -48 -29 11.11 0.214
NP_441037.1_4 Reverse -173 -183 18.9151 0.00351
NP_441037.1_4 Forward -186 -176 7.22024 0.237
NP_440151.1_5 Forward -277 -258 18.1907 0.0568
NP_440690.1_3 Reverse -242 -261 19.764 0.0673
NP_442317.1_6 Forward -189 -170 6.88262 0.231
NP_441633.1_3 Forward -186 -173 15.4572 0.0103
NP_440136.1_2 Forward -183 -176 15.9687 0.0123
NP_440136.1_2 Reverse -176 -183 15.9687 0.0123
NP_442590.1_10 Reverse -175 -194 10.9142 0.173
NP_442998.1_5 Reverse -225 -235 10.8948 0.201
NP_442998.1_5 Forward -314 -304 9.32148 0.243
NP_442998.1_10 Forward -182 -175 15.5754 0.0102
NP_442998.1_10 Reverse -177 -184 15.5754 0.0102
NP_442998.1_10 Reverse -212 -219 9.28223 0.117
NP_440299.1_1 Forward -188 -175 11.1301 0.0518
NP_440299.1_1 Reverse -264 -277 4.93527 0.193
NP_440299.1_1 Forward -41 -28 3.36198 0.247
NP_441799.1_1 Reverse -171 -185 14.5519 0.0228
NP_441799.1_1 Reverse -24 -38 4.03056 0.269
NP_442802.1_6 Reverse -216 -235 0.491109 0.204
NP_441007.1_10 Reverse -170 -183 19.9805 0.0184
NP_441007.1_10 Forward -189 -176 1.29759 0.203
NP_442333.2_5 Forward -195 -176 -12.8819 0.249
NP_440256.1_1 Forward -118 -99 -4.72043 0.164
NP_440256.1_1 Reverse -172 -191 -5.70374 0.189
NP_440256.1_1 Reverse -25 -44 -10.1286 0.295
NP_441559.1_8 Forward -189 -175 10.9143 0.0574
NP_441559.1_8 Forward -299 -285 2.5562 0.143
NP_441559.1_8 Reverse -310 -324 -2.16369 0.189
NP_441559.1_8 Reverse -311 -325 -5.80194 0.27
NP_441559.1_8 Forward -288 -274 -6.19526 0.275
NP_440915.1_6 Forward -188 -174 18.3875 0.0114
NP_440915.1_6 Reverse -171 -185 15.3392 0.0183
NP_440915.1_6 Forward -154 -140 -1.37704 0.233
NP_441296.1_8 Forward -43 -24 12.8808 0.276
NP_441296.1_9 Forward -324 -311 9.85179 0.276
NP_440717.1_2 Forward -130 -111 -11.5053 0.293
NP_440717.1_3 Reverse -275 -289 14.1586 0.221
NP_442866.1_1 Forward -282 -263 0.294447 0.183
NP_442866.1_1 Reverse -170 -189 -6.09707 0.249
NP_440537.1_2 Forward -109 -91 22.0453 0.0742
NP_440537.1_4 Forward -53 -34 18.4857 0.203
NP_440537.1_5 Forward -171 -152 21.3373 0.123
NP_441464.1_1 Forward -188 -169 8.75091 0.253
NP_441464.1_8 Forward -184 -170 16.4209 0.0865
NP_440695.1_6 Reverse -229 -243 10.6053 0.265
NP_441939.1_3 Forward -183 -164 14.2574 0.0777
NP_441939.1_3 Reverse -176 -195 5.99764 0.255
NP_441199.1_6 Forward -188 -169 14.4541 0.0404
NP_441199.1_6 Reverse -137 -156 -1.18052 0.287
NP_441494.1_6 Forward -189 -176 6.01747 0.289
NP_442993.1_1 Forward -184 -168 -9.18458 0.179
NP_442993.1_1 Forward -219 -203 -9.67623 0.19
NP_442993.1_1 Reverse -316 -332 -11.6429 0.255
NP_442993.1_1 Forward -331 -315 -13.3145 0.291
NP_442386.1_9 Forward -201 -192 9.63573 0.154
NP_442386.1_9 Forward -44 -35 7.07914 0.219
NP_442386.1_9 Forward -185 -176 6.39082 0.219
NP_442386.1_9 Reverse -174 -183 6.39082 0.219
NP_442386.1_9 Forward -131 -122 6.39082 0.219
NP_440570.1_5 Forward -275 -256 3.6377 0.234
NP_440570.1_5 Forward -194 -175 1.0811 0.247
NP_441340.1_5 Forward -183 -176 15.6737 0.0124
NP_441340.1_5 Reverse -176 -183 15.6737 0.0124
NP_441340.1_5 Reverse -269 -276 4.07068 0.239
NP_441340.1_5 Reverse -29 -36 4.07068 0.239
NP_441340.1_5 Forward -276 -269 4.07068 0.239
NP_442484.1_2 Forward -324 -305 4.52268 0.186
NP_440168.1_8 Forward -300 -281 2.94938 0.25
NP_440327.1_6 Reverse -175 -194 4.52268 0.274
NP_442240.1_2 Reverse -176 -195 8.84924 0.0183
NP_441160.1_1 Reverse -278 -297 -11.5053 0.295
NP_440586.1_8 Forward -183 -176 13.2151 0.026
NP_440586.1_8 Reverse -176 -183 13.2151 0.026
NP_440586.1_8 Reverse -154 -161 9.08521 0.178
NP_440586.1_8 Reverse -29 -36 7.70858 0.227
NP_440586.1_8 Forward -276 -269 7.61025 0.227
NP_440586.1_8 Reverse -269 -276 7.61025 0.227
NP_442251.1_6 Forward -183 -176 15.2804 0.0124
NP_442251.1_6 Reverse -176 -183 15.2804 0.0124
NP_440192.1_4 Forward -99 -80 9.68867 0.268
NP_440684.1_9 Reverse -169 -183 11.3077 0.18
NP_441262.1_3 Reverse -175 -182 14.7888 0.0223
NP_441262.1_3 Forward -184 -177 14.7888 0.0223
NP_440027.1_3 Forward -194 -176 15.7513 0.0944
NP_440027.1_3 Forward -200 -182 9.85146 0.181
NP_440027.1_8 Forward -328 -309 15.0432 0.148
NP_443051.1_1 Forward -185 -176 19.5676 0.00335
NP_443051.1_1 Reverse -174 -183 18.0926 0.00402
NP_440371.1_4 Forward -51 -32 14.2566 0.161
NP_440408.1_7 Reverse -28 -47 7.17762 0.291
NP_440439.1_1 Forward -187 -174 20.0788 0.0105
NP_440439.1_1 Reverse -312 -325 2.37923 0.135
NP_440439.1_1 Reverse -172 -185 1.19926 0.159
NP_440372.1_2 Forward -183 -176 16.3621 0.0124
NP_440372.1_2 Reverse -176 -183 16.3621 0.0124
NP_441789.1_7 Forward -193 -174 3.44025 0.198
NP_441789.1_7 Reverse -263 -282 -2.65624 0.258
NP_440819.1_5 Reverse -224 -232 7.68924 0.266
NP_439977.1_5 Forward -190 -171 1.57275 0.191
NP_440139.1_1 Forward -283 -264 5.40686 0.159
NP_440139.1_1 Reverse -22 -41 0.293673 0.293
NP_441572.1_3 Forward -47 -28 5.70265 0.281
NP_441572.1_7 Reverse -169 -188 4.52268 0.0961
NP_441572.1_7 Reverse -239 -258 -2.95047 0.205
NP_441572.1_7 Reverse -180 -199 -6.1954 0.284
NP_440267.1_2 Forward -189 -175 11.5037 0.125
NP_440267.1_2 Reverse -23 -37 10.5204 0.138
NP_442384.1_10 Reverse -175 -188 18.8988 0.00338
NP_442384.1_10 Reverse -28 -41 3.75586 0.179
NP_442384.1_10 Forward -184 -171 2.67422 0.216
NP_440364.1_6 Forward -44 -31 15.26 0.275
NP_441877.1_5 Reverse -356 -375 -1.57384 0.287
NP_441018.1_7 Reverse -306 -325 15.7324 0.102
NP_441018.1_7 Reverse -181 -200 7.47261 0.269
NP_440399.1_3 Forward -108 -89 16.1257 0.239
NP_440530.1_2 Forward -88 -69 10.0292 0.223
NP_442790.1_4 Reverse -166 -185 -6.68705 0.144
NP_442262.1_10 Forward -183 -176 14.1988 0.0123
NP_442262.1_10 Reverse -176 -183 14.1988 0.0123
NP_442262.1_10 Forward -276 -269 10.4622 0.145
NP_442262.1_10 Reverse -269 -276 10.4622 0.145
NP_442262.1_10 Forward -42 -35 9.47889 0.187
NP_442262.1_10 Reverse -154 -161 9.18389 0.211
NP_441689.1_5 Forward -186 -176 8.3377 0.132
NP_442244.1_6 Forward -260 -241 -0.39387 0.291
NP_440344.1_10 Forward -207 -190 -1.43612 0.0537
NP_440344.1_10 Forward -226 -209 -2.81276 0.074
NP_440344.1_10 Reverse -168 -185 -10.5809 0.185
NP_440344.1_10 Forward -208 -191 -13.0392 0.273
NP_440282.1_3 Reverse -257 -276 9.14423 0.186
NP_440282.1_10 Reverse -258 -277 -9.047 0.269
NP_440531.1_6 Forward -45 -26 7.96426 0.0903
NP_440531.1_6 Forward -123 -104 -2.65548 0.257
NP_440531.1_6 Forward -192 -173 -5.50708 0.299
NP_441335.1_8 Reverse -110 -129 13.2741 0.198
NP_440562.1_3 Forward -183 -166 5.34871 0.165
NP_441965.1_10 Reverse -172 -188 7.92501 0.137
NP_442750.1_1 Reverse -222 -241 8.25844 0.261
NP_442529.1_4 Reverse -166 -185 16.2241 0.154
NP_440297.1_9 Forward -276 -266 10.5014 0.0917
NP_440297.1_9 Forward -183 -173 9.51814 0.0917
NP_440297.1_9 Reverse -29 -39 6.46988 0.185
NP_440297.1_9 Reverse -269 -279 0.963343 0.282
NP_440297.1_9 Forward -161 -151 -0.0199663 0.282
NP_440297.1_9 Reverse -176 -186 -0.216628 0.282
NP_442280.1_1 Reverse -175 -194 8.25926 0.162
NP_442280.1_10 Forward -47 -29 7.11023 0.268
NP_442280.1_10 Reverse -102 -120 5.45442 0.284
NP_440298.1_2 Forward -49 -30 6.29264 0.282
NP_443036.1_1 Forward -249 -230 9.63507 0.269
NP_443036.1_1 Forward -230 -211 9.53674 0.269
NP_442067.1_4 Forward -48 -29 4.52268 0.256
NP_442067.1_4 Reverse -23 -42 2.45773 0.295
NP_440999.1_9 Reverse -171 -185 8.35772 0.0764
NP_440999.1_9 Forward -188 -174 7.9644 0.0802
NP_440999.1_9 Forward -223 -209 1.96621 0.156
NP_440888.1_2 Reverse -175 -189 15.9285 0.00837
NP_440888.1_2 Reverse -28 -42 6.88214 0.217
NP_440888.1_2 Forward -184 -170 6.78381 0.22
NP_440888.1_2 Reverse -121 -135 6.29216 0.241
NP_440888.1_2 Reverse -210 -224 5.1122 0.293
NP_440600.1_4 Forward -192 -174 -6.1757 0.285
NP_440491.1_1 Reverse -172 -191 10.7178 0.184
NP_439969.1_1 Forward -196 -177 -5.50708 0.288
NP_442948.1_2 Reverse -121 -140 2.94938 0.296
NP_442033.1_10 Reverse -173 -192 9.0459 0.0493
NP_441543.1_2 Reverse -176 -185 15.9293 0.00518
NP_441543.1_2 Forward -183 -174 9.34117 0.0818
NP_441543.1_2 Reverse -211 -220 5.70292 0.181
NP_441543.1_2 Forward -218 -209 5.70292 0.181
NP_441543.1_2 Reverse -29 -38 5.21127 0.209
NP_442845.1_2 Forward -283 -269 8.94771 0.183
NP_442845.1_2 Reverse -28 -42 5.70279 0.225
NP_442845.1_2 Reverse -169 -183 5.30946 0.237
NP_442845.1_2 Forward -43 -29 5.01447 0.247
NP_441551.1_5 Forward -281 -265 19.724 0.0292
NP_441551.1_5 Reverse -171 -187 9.98926 0.2
NP_441918.1_7 Forward -248 -229 -2.95047 0.297
NP_441469.1_8 Reverse -174 -183 13.3727 0.073
NP_441469.1_8 Forward -185 -176 6.5879 0.227
NP_443064.1_6 Forward -184 -174 13.8273 0.0796
NP_443064.1_6 Reverse -175 -185 10.8217 0.13
NP_443064.1_6 Reverse -272 -282 10.143 0.173
NP_443064.1_9 Forward -218 -199 17.699 0.192
NP_442337.1_8 Reverse -359 -378 3.93269 0.21
NP_442578.1_7 Forward -183 -176 14.5921 0.026
NP_442578.1_7 Reverse -176 -183 14.5921 0.026
NP_440710.1_1 Forward -192 -174 8.96727 0.0983
NP_441462.1_2 Reverse -175 -185 20.2362 0.000805
NP_441462.1_2 Forward -184 -174 20.1379 0.000967
NP_441462.1_2 Forward -37 -27 -0.118297 0.184
NP_441621.1_7 Reverse -173 -187 12.4876 0.0393
NP_443062.1_1 Reverse -175 -193 18.8817 0.022
NP_443062.1_1 Forward -184 -166 8.05839 0.16
NP_443062.1_6 Reverse -167 -186 4.22769 0.221
NP_443062.1_6 Reverse -260 -279 2.75272 0.25
NP_440519.1_5 Reverse -272 -286 21.1407 0.162
NP_442204.1_1 Forward -188 -177 21.1015 0.0035
NP_442204.1_1 Forward -41 -30 1.14031 0.28
NP_442204.1_1 Reverse -30 -41 0.550326 0.281
NP_442600.1_4 Forward -191 -172 17.5329 0.195
NP_440255.1_8 Forward -70 -51 14.5282 0.28
NP_440516.1_8 Forward -184 -175 16.9127 0.00442
NP_440516.1_8 Reverse -175 -184 16.9127 0.00442
NP_441785.1_1 Forward -219 -205 11.5748 0.293
NP_442428.1_5 Forward -183 -176 15.8704 0.0124
NP_442428.1_5 Reverse -176 -183 15.8704 0.0124
NP_442428.1_5 Forward -36 -29 4.66067 0.244
NP_442428.1_5 Forward -276 -269 4.36568 0.271
NP_442428.1_5 Reverse -269 -276 4.36568 0.271
NP_440818.1_1 Reverse -32 -51 -5.9004 0.299
NP_442859.1_2 Reverse -269 -288 2.26107 0.28
NP_442120.1_10 Forward -331 -312 -3.93378 0.199
NP_442120.1_10 Reverse -316 -335 -15.5368 0.294
NP_440673.1_3 Forward -182 -175 12.4288 0.0426
NP_440673.1_3 Reverse -177 -184 12.4288 0.0426
NP_440865.1_9 Reverse -169 -188 4.12936 0.0862
NP_441052.1_2 Forward -184 -174 10.4031 0.0285
NP_441052.1_2 Reverse -175 -185 10.4031 0.0285
NP_441052.1_2 Forward -219 -209 7.35486 0.0742
NP_440992.1_2 Forward -142 -123 8.16093 0.293
NP_442219.1_9 Forward -183 -174 8.25953 0.0681
NP_442219.1_9 Reverse -176 -185 8.25953 0.0681
NP_440436.1_4 Forward -183 -174 15.9289 0.00508
NP_440436.1_4 Reverse -176 -185 9.24241 0.0871
NP_440436.1_4 Forward -51 -42 5.50585 0.195
NP_440436.1_4 Reverse -29 -38 4.81753 0.239
NP_441884.1_8 Reverse -174 -193 10.4225 0.0541
NP_441884.1_9 Reverse -172 -191 -14.4552 0.138
NP_440121.1_1 Reverse -80 -99 18.0924 0.248
NP_440314.1_9 Forward -183 -164 -8.752 0.253
NP_440648.1_1 Reverse -175 -194 3.73603 0.238
NP_442577.1_10 Reverse -337 -356 2.9486 0.292
NP_441719.1_4 Forward -183 -176 16.3621 0.0124
NP_441719.1_4 Reverse -176 -183 16.3621 0.0124
NP_441733.1_10 Reverse -172 -185 9.95071 0.106
NP_441733.1_10 Forward -284 -271 6.1158 0.203
NP_441733.1_10 Forward -187 -174 4.05085 0.276
NP_441004.1_1 Reverse -169 -188 -8.85033 0.204
NP_440296.1_10 Reverse -172 -191 -14.0619 0.269
NP_441115.1_4 Reverse -174 -192 8.57317 0.244
NP_442206.1_1 Forward -52 -33 -4.6221 0.19
NP_442206.1_10 Reverse -175 -190 1.84819 0.215
NP_442854.1_6 Reverse -175 -194 14.9458 0.143
NP_440328.1_4 Forward -190 -171 13.9625 0.0413
NP_443054.1_2 Forward -186 -172 17.5025 0.0359
NP_443054.1_2 Reverse -208 -222 11.0127 0.0761
NP_443054.1_2 Reverse -314 -328 10.521 0.0761
NP_443054.1_2 Reverse -313 -327 2.85119 0.24
NP_442430.1_10 Forward -194 -175 10.6184 0.262
NP_441966.1_7 Reverse -258 -277 6.09517 0.192
NP_441851.1_10 Reverse -174 -184 17.4829 0.0027
NP_441851.1_10 Forward -185 -175 8.53483 0.114
NP_441851.1_10 Forward -38 -28 5.97822 0.19
NP_441851.1_10 Forward -131 -121 4.40493 0.271
NP_442814.1_10 Reverse -34 -53 7.07928 0.269
NP_442622.1_1 Forward -53 -34 -3.3438 0.177
NP_442622.1_8 Forward -184 -166 -18.9587 0.293
NP_441668.1_4 Reverse -165 -184 2.3594 0.2
NP_441668.1_4 Forward -257 -238 -2.95047 0.299
NP_442515.1_1 Forward -185 -171 7.47274 0.0913
NP_442515.1_1 Reverse -174 -188 -4.7203 0.298
NP_440463.1_8 Reverse -104 -123 7.40308 0.264
NP_442709.1_3 Reverse -168 -187 20.4523 0.0214
NP_441349.1_10 Reverse -200 -219 7.37428 0.0314
NP_441349.1_10 Forward -194 -175 -1.86883 0.109
NP_441409.1_6 Reverse -169 -188 -14.9469 0.27
NP_440432.1_9 Forward -183 -168 8.33803 0.0427
NP_440432.1_9 Reverse -176 -191 2.63483 0.111
NP_440432.1_9 Reverse -107 -122 0.27489 0.159
NP_442843.1_1 Reverse -35 -54 0.196116 0.17
NP_442843.1_1 Forward -276 -257 -6.58872 0.245
NP_442843.1_1 Forward -105 -86 -9.63698 0.267
NP_439960.1_4 Forward -314 -295 16.1249 0.153
NP_439960.1_10 Reverse -278 -296 -2.43913 0.255
NP_440474.1_8 Forward -183 -169 9.6354 0.158
NP_440726.1_2 Forward -194 -175 3.53937 0.233
NP_441477.1_3 Reverse -77 -96 19.7631 0.127
NP_441124.1_5 Forward -242 -232 10.1434 0.297
NP_440431.1_7 Reverse -62 -81 -0.295539 0.258
NP_442450.1_5 Reverse -173 -183 10.1081 0.115
NP_440588.1_2 Forward -193 -174 -1.27885 0.155
NP_440943.1_2 Reverse -362 -380 11.2289 0.167
NP_442006.1_2 Forward -115 -98 11.2486 0.0595
NP_442006.1_2 Reverse -34 -51 -9.59759 0.197
NP_440483.1_1 Forward -189 -170 -5.21209 0.223
NP_442243.1_1 Forward -190 -172 10.5398 0.122
NP_441570.1_1 Reverse -175 -193 9.95058 0.00991
NP_441570.1_1 Forward -219 -201 -11.4856 0.197
NP_440078.1_10 Reverse -175 -194 3.34271 0.269
NP_441078.1_4 Forward -184 -175 19.6659 0.0007
NP_441078.1_4 Reverse -175 -184 19.6659 0.0007
NP_441078.1_4 Forward -219 -210 8.45619 0.0281
NP_441078.1_4 Reverse -210 -219 7.37455 0.0688
NP_441078.1_4 Forward -324 -315 -1.6719 0.266
NP_441078.1_4 Forward -37 -28 -1.96689 0.282
NP_442729.1_8 Reverse -171 -184 10.344 0.125
NP_441663.1_8 Forward -190 -171 10.2259 0.0776
NP_440707.1_6 Forward -192 -173 17.7965 0.109
NP_442443.1_1 Reverse -308 -327 -2.85214 0.264
NP_440526.1_3 Forward -183 -172 20.7076 0.0073
NP_440526.1_3 Reverse -122 -133 0.64819 0.273
NP_441432.1_8 Forward -185 -176 16.8143 0.00595
NP_441432.1_8 Forward -38 -29 11.3078 0.0569
NP_441432.1_8 Reverse -174 -183 8.35786 0.0755
NP_443024.1_3 Reverse -41 -51 10.3048 0.289
NP_442320.1_8 Reverse -169 -183 -3.44199 0.122
NP_442320.1_8 Reverse -204 -218 -5.50694 0.228
NP_442320.1_8 Forward -43 -29 -6.09693 0.265
NP_441732.1_2 Forward -188 -172 3.10679 0.0141
NP_441732.1_2 Reverse -206 -222 -16.8544 0.207
NP_441030.1_6 Reverse -173 -192 14.103 0.195
NP_440760.1_1 Forward -184 -165 6.68596 0.0115
NP_440760.1_1 Reverse -175 -194 -10.9153 0.0849
NP_440760.1_7 Reverse -62 -81 5.40686 0.211
NP_440199.1_10 Reverse -207 -217 6.56821 0.296
NP_441057.1_3 Forward -303 -284 -12.0953 0.255
NP_440913.1_1 Forward -186 -168 7.88563 0.195
NP_440913.1_1 Reverse -173 -191 5.52568 0.24
NP_440713.1_4 Reverse -181 -200 7.27595 0.182
NP_440713.1_4 Forward -194 -175 2.55606 0.26
NP_442489.1_2 Reverse -257 -276 1.37609 0.293
NP_442489.1_7 Forward -184 -175 20.1576 0.000695
NP_442489.1_7 Reverse -175 -184 20.1576 0.000695
NP_442489.1_7 Reverse -210 -219 1.1797 0.101
NP_442489.1_7 Forward -219 -210 0.491382 0.178
NP_442489.1_7 Forward -37 -28 -1.47524 0.203
NP_442489.1_7 Reverse -315 -324 -1.57357 0.213
NP_441830.1_2 Forward -199 -180 -4.81876 0.279
NP_442079.1_7 Forward -276 -257 9.24257 0.113
NP_440559.1_1 Forward -183 -174 17.306 0.00658
NP_440559.1_1 Reverse -176 -185 8.65285 0.0586
NP_441659.2_8 Reverse -175 -185 20.9245 0.000805
NP_441659.2_8 Forward -184 -174 19.3512 0.000966
NP_441659.2_8 Reverse -28 -38 4.50326 0.132
NP_441022.1_1 Reverse -228 -237 13.2728 0.216
NP_441022.1_1 Forward -239 -230 12.4095 0.232
NP_441022.1_1 Reverse -13 -22 10.587 0.294
NP_442913.1_10 Forward -193 -174 1.47442 0.142
NP_442913.1_10 Reverse -166 -185 -1.7705 0.176
NP_440336.1_4 Reverse -164 -183 18.7798 0.048
NP_442008.1_2 Reverse -138 -157 6.68596 0.217
NP_440708.1_6 Reverse -264 -283 -5.9004 0.234
NP_441800.1_3 Forward -276 -258 4.05072 0.289
NP_442776.1_1 Forward -195 -176 16.6174 0.0672
NP_440779.1_5 Forward -184 -167 -14.5141 0.246
NP_442346.1_5 Reverse -174 -184 17.9746 0.00128
NP_442346.1_5 Forward -185 -175 16.303 0.00248
NP_442346.1_5 Forward -278 -268 13.353 0.0261
NP_442346.1_5 Reverse -267 -277 13.353 0.0261
NP_442346.1_5 Forward -38 -28 5.87989 0.225
NP_442346.1_5 Reverse -27 -37 5.28991 0.253
NP_442346.1_5 Forward -116 -106 4.50326 0.286
NP_442346.1_10 Forward -54 -35 -0.4922 0.27
NP_440352.1_5 Reverse -215 -234 10.8063 0.27
NP_440545.1_3 Reverse -171 -188 8.98696 0.0411
NP_440545.1_3 Forward -188 -171 8.29864 0.0451
NP_440545.1_3 Forward -281 -264 3.57876 0.0817
NP_440545.1_3 Reverse -264 -281 -6.35267 0.276
NP_441856.1_3 Reverse -172 -191 2.55606 0.195
NP_440743.1_6 Forward -328 -310 19.0954 0.0195
NP_440459.1_2 Reverse -26 -43 12.1336 0.158
NP_440459.1_2 Forward -124 -107 10.7569 0.192
NP_441653.1_2 Reverse -164 -183 8.26467 0.189
NP_441653.1_2 Forward -195 -176 4.59259 0.255
NP_441653.1_2 Forward -161 -142 4.39932 0.258
NP_441653.1_4 Forward -390 -378 16.4603 0.272
NP_440847.1_3 Forward -50 -36 17.2068 0.115
NP_442603.1_7 Reverse -175 -189 10.5204 0.125
NP_442603.1_7 Forward -184 -170 5.40719 0.296
NP_442603.1_9 Forward -45 -27 5.72234 0.293
NP_441888.1_7 Forward -189 -175 3.8345 0.225
NP_441050.1_5 Reverse -171 -189 -3.02911 0.286
NP_440449.1_6 Reverse -167 -185 11.66 0.129
NP_440449.1_6 Forward -65 -47 8.06131 0.206
NP_441047.1_2 Reverse -29 -48 -1.47551 0.267
NP_441833.1_4 Forward -183 -176 15.9687 0.0124
NP_441833.1_4 Reverse -176 -183 15.9687 0.0124
NP_442162.1_9 Forward -183 -176 16.2637 0.0124
NP_442162.1_9 Reverse -176 -183 16.2637 0.0124
NP_440671.1_4 Forward -190 -176 8.16106 0.202
NP_440671.1_4 Forward -43 -29 8.16106 0.202
NP_440671.1_4 Forward -137 -123 7.37441 0.219
NP_440671.1_4 Reverse -28 -42 5.80112 0.271
NP_440671.1_4 Reverse -204 -218 5.1128 0.292
NP_440671.1_4 Reverse -262 -276 4.91614 0.3
NP_440224.1_1 Forward -48 -29 0.491109 0.133
NP_442821.1_2 Forward -202 -183 3.34271 0.223
NP_442140.1_3 Forward -183 -173 14.828 0.0433
NP_442140.1_3 Reverse -269 -279 9.7148 0.103
NP_442140.1_3 Reverse -176 -186 4.69992 0.238
NP_442140.1_3 Reverse -211 -221 4.20827 0.254
NP_440875.1_9 Reverse -177 -187 16.5483 0.0145
NP_440875.1_9 Forward -182 -172 8.5667 0.233
NP_440875.1_9 Reverse -108 -118 8.17736 0.24
NP_441813.1_5 Forward -186 -176 18.1713 0.00743
NP_441813.1_5 Reverse -173 -183 8.92815 0.0347
NP_440590.1_4 Reverse -176 -189 4.44418 0.0601
NP_440590.1_4 Reverse -122 -135 1.00259 0.136
NP_440590.1_4 Forward -183 -170 -4.11062 0.258
NP_440590.1_4 Reverse -211 -224 -5.09393 0.274
NP_440567.1_1 Forward -183 -169 13.2743 0.0213
NP_440567.1_1 Reverse -269 -283 1.67122 0.196
NP_440567.1_1 Reverse -176 -190 -0.688726 0.298
NP_442497.1_10 Forward -183 -174 19.8626 0.00532
NP_442497.1_10 Reverse -176 -185 17.601 0.00813
NP_440821.1_4 Reverse -173 -183 19.5479 0.00399
NP_440821.1_4 Forward -186 -176 2.24165 0.131
NP_441239.1_9 Forward -186 -174 16.5586 0.0166
NP_441239.1_9 Reverse -173 -185 14.4936 0.0272
NP_441239.1_9 Forward -279 -267 12.4287 0.0477
NP_441239.1_9 Reverse -266 -278 9.67541 0.0987
NP_441239.1_9 Forward -45 -33 3.48056 0.285
NP_441727.1_3 Reverse -21 -40 9.63589 0.178
NP_441892.1_1 Reverse -259 -276 5.05372 0.105
NP_441892.1_1 Forward -286 -269 4.07041 0.116
NP_441892.1_1 Forward -193 -176 1.8088 0.147
NP_441892.1_1 Reverse -25 -42 -4.58271 0.264
NP_441892.1_1 Reverse -166 -183 -5.36936 0.279
NP_440665.1_1 Forward -49 -30 -12.2919 0.244
NP_440665.1_2 Reverse -278 -297 -5.40875 0.247
NP_440604.1_6 Reverse -175 -194 -4.6221 0.253
NP_442044.1_1 Forward -189 -170 -5.70374 0.189
NP_441017.1_8 Forward -298 -283 10.7963 0.188
NP_441017.1_8 Forward -280 -265 6.6664 0.292
NP_442138.1_10 Reverse -315 -334 2.0644 0.12
NP_442052.1_8 Forward -279 -269 13.5497 0.253
NP_440546.1_4 Reverse -175 -185 13.5365 0.0459
NP_440546.1_4 Forward -277 -267 13.0517 0.0572
NP_440546.1_4 Reverse -268 -278 13.0517 0.0572
NP_440546.1_4 Forward -184 -174 12.8578 0.0572
NP_440546.1_4 Forward -130 -120 8.00989 0.209
NP_441230.1_5 Forward -330 -311 -0.590531 0.29
NP_440462.1_6 Forward -186 -176 18.7612 0.00454
NP_440462.1_6 Reverse -173 -183 10.4031 0.0396
NP_442340.1_3 Forward -113 -94 -10.6203 0.291
NP_440868.1_4 Forward -188 -176 8.00379 0.0602
NP_440868.1_4 Reverse -171 -183 2.79224 0.148
NP_440868.1_8 Reverse -171 -190 -4.03212 0.263
NP_441497.1_3 Reverse -278 -297 -11.4069 0.294
NP_442499.1_4 Reverse -236 -250 24.0907 0.00804
NP_442812.1_7 Forward -156 -137 14.8474 0.24
NP_441474.1_1 Forward -194 -175 -1.27961 0.261
NP_442402.1_4 Forward -392 -373 -4.03287 0.22
NP_442402.1_10 Forward -293 -283 13.2542 0.204
NP_441084.1_6 Forward -117 -103 15.6463 0.0798
NP_440653.1_10 Forward -336 -317 4.32602 0.252
NP_440653.1_10 Reverse -305 -324 2.55606 0.288
NP_440696.1_3 Forward -281 -263 13.6872 0.0931
NP_440696.1_3 Reverse -175 -193 5.91901 0.19
NP_440696.1_3 Forward -47 -29 0.412472 0.232
NP_442039.1_4 Forward -183 -176 15.1821 0.0124
NP_442039.1_4 Reverse -176 -183 15.1821 0.0124
NP_442039.1_4 Reverse -211 -218 8.29892 0.213
NP_442039.1_7 Reverse -281 -291 11.2881 0.257
NP_441811.1_1 Reverse -269 -288 4.62101 0.285
NP_441811.1_1 Forward -52 -33 4.52268 0.285
NP_441811.1_8 Forward -283 -269 8.35772 0.238
NP_442837.1_3 Forward -183 -176 15.7721 0.0124
NP_442837.1_3 Reverse -176 -183 15.7721 0.0124
NP_440160.1_9 Forward -325 -306 7.86593 0.27
NP_439994.1_4 Forward -249 -230 9.24257 0.288
NP_442053.1_1 Forward -184 -175 18.3876 0.0007
NP_442053.1_1 Reverse -175 -184 18.3876 0.0007
NP_442053.1_1 Forward -219 -210 4.91628 0.218
NP_440505.1_3 Forward -186 -176 17.188 0.00332
NP_440505.1_3 Reverse -173 -183 7.84651 0.147
NP_440505.1_3 Reverse -208 -218 5.78156 0.211
NP_440505.1_3 Reverse -283 -293 4.99491 0.252
NP_442659.1_3 Forward -50 -31 19.2723 0.0715
NP_441701.1_3 Forward -286 -269 20.885 0.0662
NP_440914.1_1 Reverse -175 -185 16.3248 0.00196
NP_440914.1_1 Forward -184 -174 8.51751 0.186
NP_440914.1_1 Forward -200 -190 6.07773 0.297
NP_441011.1_8 Reverse -176 -185 16.6177 0.00602
NP_441011.1_8 Forward -183 -174 14.356 0.0249
NP_442101.1_10 Forward -192 -173 2.3594 0.0714
NP_440037.1_2 Reverse -233 -252 7.27595 0.248
NP_442533.1_6 Forward -184 -175 17.2076 0.00137
NP_442533.1_6 Reverse -175 -184 17.2076 0.00137
NP_442533.1_6 Forward -115 -106 5.21127 0.15
NP_442533.1_6 Forward -37 -28 4.81794 0.172
NP_442533.1_6 Forward -277 -268 4.71961 0.177
NP_442533.1_6 Reverse -268 -277 4.71961 0.177
NP_442533.1_6 Forward -247 -238 2.16301 0.27
NP_442533.1_6 Forward -130 -121 1.47469 0.298
NP_442541.1_10 Forward -319 -305 2.75226 0.254
NP_442541.1_10 Forward -213 -199 2.75226 0.254
NP_442541.1_10 Reverse -268 -282 1.17898 0.29
NP_442232.1_3 Forward -285 -266 -5.9004 0.172
NP_443016.1_1 Forward -168 -149 -8.16202 0.291
NP_441482.1_7 Forward -190 -176 16.4209 0.00702
NP_441482.1_7 Reverse -262 -276 -9.73518 0.209
NP_441482.1_7 Reverse -169 -183 -10.5218 0.209
NP_441482.1_7 Reverse -28 -42 -11.9968 0.288
NP_442293.1_6 Forward -309 -290 15.7324 0.266
NP_439944.1_9 Forward -183 -173 17.4829 0.00423
NP_439944.1_9 Forward -218 -208 12.4681 0.0887
NP_439944.1_9 Reverse -176 -186 9.12481 0.1
NP_441697.1_5 Reverse -378 -397 -6.06416 0.232
NP_440116.1_8 Reverse -176 -195 -1.18052 0.117
NP_440116.1_8 Forward -276 -257 -4.91709 0.182
NP_440115.1_6 Forward -187 -177 14.0414 0.0615
NP_440115.1_6 Reverse -172 -182 10.1081 0.115
NP_440007.1_9 Forward -61 -47 3.93283 0.267
NP_440007.1_9 Forward -188 -174 1.96621 0.281
NP_440007.1_9 Reverse -182 -196 1.86788 0.282
NP_440007.1_9 Reverse -171 -185 1.08123 0.29
NP_441680.1_4 Reverse -270 -289 8.65258 0.157
NP_441347.1_5 Reverse -309 -323 11.4053 0.255
NP_441347.1_5 Reverse -185 -199 8.45543 0.286
NP_441961.1_4 Forward -327 -308 11.4058 0.23
NP_441602.1_3 Reverse -186 -205 5.99764 0.141
NP_441972.1_5 Reverse -305 -324 -4.52377 0.211
NP_441106.1_1 Forward -185 -176 18.486 0.0028
NP_441106.1_1 Reverse -174 -183 9.73449 0.0311
NP_439903.1_6 Forward -187 -168 7.4718 0.154
NP_439903.1_6 Forward -238 -219 -1.18128 0.293
NP_442306.1_10 Forward -189 -170 -20.2567 0.202
NP_441286.1_1 Forward -185 -173 14.7886 0.00418
NP_441286.1_1 Reverse -174 -186 -3.50094 0.145
NP_441286.1_1 Reverse -209 -221 -4.68091 0.168
NP_440670.1_8 Forward -184 -175 18.3876 0.000699
NP_440670.1_8 Reverse -175 -184 18.3876 0.000699
NP_440670.1_8 Forward -219 -210 5.3096 0.167
NP_440886.1_7 Forward -220 -210 15.3192 0.0296
NP_440886.1_7 Forward -176 -166 8.82935 0.0805
NP_440886.1_7 Forward -185 -175 8.04271 0.0805
NP_440886.1_7 Reverse -174 -184 8.04271 0.0805
NP_442614.1_2 Forward -184 -170 7.07942 0.275
NP_442382.1_7 Forward -197 -178 5.80098 0.247
NP_442717.1_4 Forward -273 -254 1.17943 0.297
NP_442072.1_9 Reverse -174 -192 5.13236 0.0169
NP_442072.1_9 Forward -185 -167 -1.65248 0.0316
NP_442072.1_9 Reverse -209 -227 -23.2853 0.288
NP_442295.1_7 Forward -194 -176 12.8997 0.289
NP_441069.1_5 Forward -206 -188 4.6407 0.191
NP_440907.2_8 Forward -183 -173 19.449 0.00351
NP_440907.2_8 Reverse -176 -186 9.616 0.103
NP_442264.1_2 Reverse -143 -160 6.62702 0.251
NP_442264.1_2 Reverse -306 -323 6.52869 0.254
NP_442264.1_5 Forward -325 -311 12.4876 0.253
NP_441021.1_1 Forward -183 -164 0.58944 0.088
NP_441021.1_1 Reverse -269 -288 -12.7836 0.295
NP_440841.1_4 Forward -39 -20 -6.88371 0.215
NP_441463.1_3 Forward -62 -43 -8.752 0.273
NP_441463.1_6 Forward -327 -313 6.41593 0.273
NP_442893.1_3 Reverse -330 -349 21.6314 0.117
NP_441626.1_2 Forward -183 -176 15.7721 0.0124
NP_441626.1_2 Reverse -176 -183 15.7721 0.0124
NP_441589.1_3 Forward -286 -272 19.5675 0.15
NP_442238.1_3 Forward -330 -311 10.3242 0.146
NP_442794.1_1 Forward -188 -176 10.5604 0.0721
NP_442794.1_1 Forward -41 -29 7.61046 0.136
NP_441401.1_1 Reverse -49 -68 8.45592 0.293
NP_442615.1_1 Reverse -166 -184 -4.99573 0.201
NP_442615.1_1 Reverse -201 -219 -5.48739 0.215
NP_441962.1_4 Forward -189 -170 -7.86702 0.195
NP_441962.1_4 Reverse -29 -48 -10.0303 0.223
NP_440387.1_1 Forward -184 -168 7.72835 0.0282
NP_440387.1_1 Reverse -175 -191 5.6634 0.0311
NP_440387.1_1 Forward -283 -267 -2.98973 0.153
NP_440855.1_5 Reverse -272 -291 3.34192 0.287
NP_441431.1_2 Forward -187 -173 13.4703 0.0891
NP_441431.1_2 Forward -118 -104 9.93039 0.172
NP_441431.1_2 Forward -280 -266 7.76712 0.234
NP_441431.1_2 Reverse -172 -186 7.27547 0.244
NP_441431.1_2 Reverse -25 -39 6.58715 0.266
NP_441488.1_8 Forward -189 -175 9.73373 0.146
NP_441836.1_2 Forward -283 -264 -1.67217 0.223
NP_440634.1_7 Forward -117 -98 18.4857 0.0885
NP_441993.1_1 Reverse -175 -194 14.5187 0.0768
NP_441993.1_1 Forward -43 -24 13.9339 0.0786
NP_441993.1_1 Reverse -169 -188 6.42973 0.18
NP_440814.1_4 Reverse -166 -185 -1.86883 0.136
NP_440114.1_10 Forward -184 -170 16.4209 0.0185
NP_440114.1_10 Reverse -268 -282 8.55439 0.2
NP_440114.1_10 Reverse -43 -57 8.45605 0.202
NP_442323.1_7 Forward -189 -170 13.0766 0.0928
NP_440293.1_3 Reverse -179 -198 7.37428 0.184
NP_440293.1_3 Reverse -104 -123 -4.03212 0.257
NP_440293.1_3 Reverse -308 -327 -4.81876 0.265
NP_440293.1_3 Reverse -260 -279 -5.40875 0.276
NP_440766.1_4 Forward -188 -174 5.21113 0.113
NP_441237.1_9 Forward -183 -173 17.2863 0.00348
NP_442743.1_4 Forward -293 -274 -7.37537 0.279
NP_442930.1_1 Forward -237 -227 12.5659 0.239
NP_439910.1_2 Reverse -167 -184 -21.3973 0.183
NP_442867.1_8 Reverse -362 -381 7.96426 0.242
NP_440457.1_1 Reverse -171 -183 8.10212 0.101
NP_440457.1_1 Forward -188 -176 7.70879 0.101
NP_440798.1_6 Reverse -176 -189 2.08423 0.186
NP_442297.1_4 Reverse -281 -300 15.8366 0.145
NP_441436.1_8 Reverse -174 -193 14.2574 0.215
NP_440473.1_1 Reverse -31 -50 10.8718 0.289
NP_440473.1_9 Reverse -164 -183 0.294447 0.127
NP_442509.1_9 Forward -184 -174 17.3841 0.00128
NP_442509.1_9 Reverse -175 -185 8.04271 0.192
NP_441496.1_1 Forward -74 -60 15.4813 0.265
NP_442514.1_5 Reverse -47 -66 -1.67294 0.202
NP_442514.1_5 Forward -327 -308 -8.75273 0.29
NP_442514.1_5 Reverse -302 -321 -9.34271 0.295
NP_442514.1_5 Forward -255 -236 -9.73604 0.298
NP_441610.1_6 Forward -330 -311 25.3688 0.0075
NP_440554.1_4 Reverse -176 -186 17.9746 0.0131
NP_440554.1_4 Forward -183 -173 6.27322 0.123
NP_442862.1_3 Forward -395 -378 6.82368 0.263
NP_441885.1_5 Forward -184 -174 11.3864 0.00668
NP_441885.1_5 Reverse -175 -185 11.3864 0.00668
NP_441885.1_5 Forward -219 -209 10.1081 0.0145
NP_441428.1_8 Reverse -167 -186 5.211 0.228
NP_442341.1_7 Forward -185 -171 6.88276 0.116
NP_442341.1_7 Forward -220 -206 3.93283 0.208
NP_442341.1_9 Forward -186 -172 12.192 0.109
NP_442341.1_9 Forward -285 -271 6.88214 0.21
NP_441756.1_5 Reverse -171 -190 -4.22878 0.294
NP_441173.1_9 Forward -291 -283 10.9338 0.242
NP_440423.1_6 Reverse -167 -186 -3.73712 0.126
NP_443000.1_7 Forward -186 -176 20.3345 0.00223
NP_443000.1_7 Forward -39 -29 4.79825 0.169
NP_443000.1_7 Reverse -173 -183 2.14332 0.226
NP_440507.2_3 Reverse -201 -220 9.43841 0.221
NP_440507.2_3 Forward -280 -261 8.4551 0.253
NP_440275.1_3 Reverse -173 -183 19.5479 0.00756
NP_440275.1_3 Forward -186 -176 16.1063 0.0155
NP_440275.1_3 Reverse -134 -144 3.42162 0.229
NP_440091.1_1 Reverse -171 -183 3.2839 0.163
NP_440091.1_1 Forward -223 -211 2.59558 0.191
NP_442354.1_8 Reverse -367 -386 7.57094 0.266
NP_443010.1_10 Forward -187 -170 5.18664 0.207
NP_442451.1_2 Forward -192 -173 -5.01543 0.217
NP_439962.1_6 Reverse -194 -212 8.96727 0.23
NP_440175.1_7 Forward -47 -29 18.4392 0.081
NP_442495.1_4 Reverse -179 -189 16.303 0.0771
NP_442495.1_5 Reverse -305 -324 9.24257 0.287
NP_442495.1_5 Reverse -44 -63 5.99764 0.291
NP_440149.1_8 Reverse -204 -223 -1.67217 0.162
NP_440149.1_8 Reverse -175 -194 -2.75381 0.175
NP_440149.1_8 Forward -277 -258 -6.1954 0.244
NP_441105.1_3 Reverse -199 -218 -2.95047 0.171
NP_441105.1_3 Reverse -164 -183 -3.04881 0.172
NP_441105.1_3 Forward -63 -44 -4.72043 0.204
NP_441105.1_3 Reverse -44 -63 -6.29373 0.232
NP_440216.1_1 Reverse -175 -189 17.1092 0.00188
NP_440216.1_1 Forward -184 -170 -1.5737 0.034
NP_440216.1_1 Reverse -210 -224 -11.8001 0.219
NP_440216.1_1 Forward -324 -310 -12.6851 0.296
NP_440216.1_9 Reverse -57 -66 14.651 0.172
NP_440216.1_9 Reverse -281 -290 11.9961 0.252
NP_440172.1_1 Reverse -175 -185 17.5813 0.00421
NP_440172.1_1 Forward -184 -174 16.303 0.00854
NP_440172.1_1 Forward -37 -27 6.27322 0.107
NP_440172.1_1 Forward -219 -209 3.51995 0.224
NP_440172.1_1 Forward -130 -120 3.12662 0.244
NP_442015.1_10 Forward -188 -175 13.4906 0.0354
NP_441226.1_7 Forward -183 -176 14.4934 0.0123
NP_441226.1_7 Reverse -176 -183 14.4934 0.0123
NP_441226.1_7 Reverse -29 -36 11.2485 0.0971
NP_441226.1_7 Reverse -122 -129 9.47853 0.147
NP_441226.1_7 Forward -194 -187 5.34865 0.289
NP_441111.1_7 Forward -183 -175 18.7023 0.00294
NP_441111.1_7 Reverse -176 -184 18.7023 0.00294
NP_441111.1_7 Reverse -29 -37 -0.570565 0.233
NP_442379.1_10 Reverse -168 -185 6.72535 0.114
NP_442379.1_10 Forward -191 -174 1.90713 0.223
NP_441766.1_2 Forward -184 -175 17.5026 0.00297
NP_441766.1_2 Reverse -175 -184 17.5026 0.00297
NP_441766.1_2 Forward -219 -210 3.83464 0.202
NP_442417.1_5 Reverse -175 -189 14.3559 0.0633
NP_442417.1_5 Reverse -28 -42 5.40779 0.263
NP_440416.1_9 Forward -44 -25 -10.3253 0.14
NP_440416.1_9 Forward -191 -172 -14.8485 0.18
NP_440416.1_9 Reverse -277 -296 -15.4385 0.191
NP_440416.1_9 Forward -59 -40 -19.3717 0.274
NP_443052.1_8 Reverse -165 -184 -10.522 0.21
NP_440820.2_4 Reverse -205 -224 5.30933 0.228
NP_440885.1_6 Reverse -244 -263 8.17337 0.227
NP_442403.1_10 Forward -116 -97 17.3057 0.157
NP_440591.1_9 Reverse -168 -186 4.34571 0.283
NP_442564.1_10 Forward -248 -234 9.83269 0.296
NP_442564.1_10 Forward -320 -306 8.35772 0.296
NP_440261.1_5 Forward -183 -170 8.67241 0.0244
NP_440261.1_5 Reverse -176 -189 6.70579 0.0318
NP_440261.1_5 Forward -161 -148 -5.29059 0.19
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGTCAAAATTTTGAAGGTTTGGCCCAAGCAAGACAGGGTTTACGAGCCTATTTATTGGGTTTAGCAGAGGAAACGGGCATTCCCCTGGCCAGAACTATACTGGGAGGCTTTTCCCAGGGGGGAGCCATGGCTCTGGATGTGGGCTTAACATTGCCCCTGGCTAAAATTTTTTCCCTGAGCGGCTATCTCCATTTCCAGCCGGAATCCCAACCCCAGGCGATCGCCCCTATCTTGTTAATCCATGGCACCGAAGATCCGGTAGTACCACTGCGGATGGCTCAACAGGCCAAGGCTGAACTGGAAAGCATTGGGGCCTCAGTGGAATATCAAGAATTTCCCATGGGTCATGCCATTCCTCCCATGGCGTTGGCTCGGTTAAAGTCTTTTTTGAGTTGAAGT

CDS

GTGTTGTCTATCACTTACAGTCCCGCCTATACTCTGGTTCCCACCTACGAGTGTTTTAACCGTTGTAGTTACTGCAATTTCCGGCAGGAGCCAAGAAAAGACCAATGGTTAACCGAAAGCGTTGCTAAACAGCGACTGGAAAGTTTGGCAGGGCGGGGGATAAGGGAAATTTTAATTCTGGCGGGGGAAGTGCATCCCCAATCTTCCCGCCGAAAAGCTTGGTTTGAACTTATTTATAACCTAGGCAAAATCGCCCTAGATTTGGGATTTTATCCCCACACCAATGCGGGGCCTTTAAGTCGATCAGAAATAGCTCGTTTAAAGGAAGTGAATTTTTCCCTGGGGTTGATGCTGGAACAGGTTTCTCCCCGACTATTAACCACAGTGCATCGTCAAGCCCCCAGTAAAGAACCCCAGCTCAGGTTAGAACAATTACGATTAGCAGGGGAATTGGGTATTCCTTTCACCACTGGCTTATTACTGGGCATTGGGGAAACTGACCAGGAAGTGGAAGAGAGTTTAATGGCGATCGCCAATGTTCAACAAGAATACGGCCACATTCAAGAGGTGATTTTGCAACCCCATAGCCCTGGGCAAAAACAAACAGATAATATTTCCGCCTACAGCCCACAAAAATTGGTGCAAGTTATTACCTTAGCAAGGGCAATATTACCCGCAGAAATTACCCTACAAATACCGCCTAATTTAGTGCCAAATTTCAGTGATCTACTAGCTTGTTTAGCTGCTGGAGTTAGGGATTTAGGTGGCATTGTACCCATTGATGAAGTTAACCCTGATTATCATCACCAATCGGTGAATCAACTAAGTCAATTGCTAGAAGAAAATGGCTATTTATTGCAACCAAGGTTTCCAGTTTATCCCACTTATTTTTCCTGGCTCAATTGTGATTTACAGCAACGGCTATCAGTTTTTATCAACTAA

Protein

MLSITYSPAYTLVPTYECFNRCSYCNFRQEPRKDQWLTESVAKQRLESLAGRGIREILILAGEVHPQSSRRKAWFELIYNLGKIALDLGFYPHTNAGPLSRSEIARLKEVNFSLGLMLEQVSPRLLTTVHRQAPSKEPQLRLEQLRLAGELGIPFTTGLLLGIGETDQEVEESLMAIANVQQEYGHIQEVILQPHSPGQKQTDNISAYSPQKLVQVITLARAILPAEITLQIPPNLVPNFSDLLACLAAGVRDLGGIVPIDEVNPDYHHQSVNQLSQLLEENGYLLQPRFPVYPTYFSWLNCDLQQRLSVFIN