Your browser is old and dusty. Try Google Chrome!

Details for sll1283

ORF sll1283
Accession NP_440539.1
Symbol
Category Adaptations and atypical conditions
Definition similar to stage II sporulation protein D
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -204 -190 16.1259 0.104
NP_441061.1_2 Reverse -196 -210 6.88276 0.112
NP_441061.1_2 Reverse -304 -318 1.17956 0.193
NP_440557.1_1 Reverse -337 -356 -1.47551 0.273
NP_440795.1_7 Forward -344 -337 14.6904 0.0123
NP_440795.1_7 Reverse -337 -344 14.6904 0.0123
NP_440795.1_7 Forward -311 -304 6.92228 0.26
NP_441418.1_6 Reverse -195 -214 -12.4886 0.066
NP_441418.1_6 Reverse -336 -355 -29.5982 0.23
NP_441453.1_4 Reverse -336 -344 16.539 0.00633
NP_441453.1_4 Forward -345 -337 16.539 0.00633
NP_441453.1_4 Reverse -195 -203 14.8674 0.00947
NP_441453.1_4 Forward -204 -196 6.80426 0.121
NP_441453.1_7 Reverse -111 -118 12.1338 0.295
NP_441960.1_3 Forward -345 -326 12.8414 0.291
NP_442151.1_6 Reverse -336 -350 7.66941 0.192
NP_442151.1_6 Forward -345 -331 7.57108 0.194
NP_441818.1_1 Reverse -337 -348 16.7744 0.0118
NP_441818.1_9 Reverse -223 -242 -7.67036 0.273
NP_441818.1_9 Forward -324 -305 -9.83364 0.291
NP_440226.1_1 Forward -345 -326 8.45592 0.0871
NP_440226.1_1 Reverse -195 -214 5.50599 0.154
NP_440813.1_1 Reverse -189 -203 17.9935 0.157
NP_442623.1_3 Forward -344 -325 -18.5851 0.263
NP_440150.1_6 Reverse -192 -211 1.0811 0.295
NP_442655.1_1 Reverse -331 -350 9.63589 0.0939
NP_442655.1_1 Forward -350 -331 7.86593 0.109
NP_443002.1_5 Reverse -57 -75 10.6381 0.256
NP_442173.1_1 Forward -344 -336 15.4574 0.00633
NP_442173.1_1 Reverse -337 -345 15.4574 0.00633
NP_442173.1_1 Forward -203 -195 13.8841 0.0225
NP_442173.1_1 Reverse -196 -204 12.0158 0.0316
NP_442752.1_4 Forward -345 -338 13.8055 0.0199
NP_442752.1_4 Reverse -336 -343 13.8055 0.0199
NP_442752.1_4 Forward -204 -197 13.8055 0.0199
NP_443027.1_4 Reverse -334 -344 13.2547 0.0521
NP_440784.1_7 Forward -344 -337 15.9687 0.0123
NP_440784.1_7 Reverse -337 -344 15.9687 0.0123
NP_440784.1_7 Forward -203 -196 6.23397 0.241
NP_440784.1_7 Reverse -196 -203 6.13563 0.241
NP_440061.1_9 Reverse -334 -348 13.1753 0.0839
NP_440061.1_9 Reverse -323 -337 9.34041 0.148
NP_440061.1_9 Forward -314 -300 7.96378 0.185
NP_440061.1_9 Forward -116 -102 5.89884 0.266
NP_441054.1_2 Reverse -110 -129 9.83255 0.284
NP_439979.1_3 Reverse -298 -317 16.5035 0.294
NP_442062.1_8 Reverse -336 -346 17.6796 0.00193
NP_442062.1_8 Forward -345 -335 10.3048 0.0493
NP_442062.1_8 Reverse -195 -205 7.15819 0.107
NP_440761.1_4 Forward -350 -331 -13.9635 0.257
NP_441900.1_2 Forward -310 -292 -4.50479 0.288
NP_440304.1_4 Reverse -334 -344 10.8948 0.051
NP_440304.1_4 Forward -347 -337 9.91146 0.051
NP_442242.1_1 Reverse -72 -91 16.8003 0.28
NP_442242.1_4 Forward -344 -337 14.3954 0.0124
NP_442242.1_4 Reverse -337 -344 14.3954 0.0124
NP_442602.1_3 Forward -62 -43 0.687771 0.197
NP_439918.1_2 Reverse -116 -135 -1.37718 0.24
NP_439918.1_3 Forward -333 -314 4.81767 0.264
NP_441208.1_9 Forward -348 -334 5.70279 0.262
NP_441594.1_6 Reverse -294 -313 9.63589 0.141
NP_441594.1_6 Forward -315 -296 4.81767 0.211
NP_441594.1_6 Reverse -36 -55 0.884433 0.279
NP_441594.1_6 Reverse -60 -79 0.786102 0.281
NP_441594.1_6 Forward -246 -227 -0.295539 0.298
NP_442110.1_7 Forward -345 -331 2.5562 0.222
NP_442110.1_7 Forward -204 -190 1.17956 0.236
NP_440856.1_4 Reverse -329 -348 2.3594 0.15
NP_440856.1_4 Reverse -188 -207 -5.01543 0.274
NP_441083.1_5 Reverse -336 -346 19.3512 0.000718
NP_441083.1_5 Forward -345 -335 11.2881 0.0159
NP_441083.1_5 Reverse -195 -205 0.865012 0.218
NP_441083.1_5 Forward -204 -194 -1.10161 0.295
NP_441434.1_7 Reverse -338 -352 22.6157 0.0122
NP_440109.1_6 Forward -58 -39 13.7658 0.268
NP_441738.1_2 Forward -343 -336 15.28 0.0102
NP_441738.1_2 Reverse -338 -345 15.28 0.0102
NP_441738.1_2 Reverse -197 -204 15.28 0.0102
NP_441738.1_2 Forward -50 -43 8.29857 0.176
NP_441558.1_5 Reverse -334 -353 15.8307 0.037
NP_441558.1_5 Forward -347 -328 9.14423 0.129
NP_441955.1_8 Forward -210 -193 6.62702 0.281
NP_440209.1_1 Reverse -336 -344 18.1123 0.00295
NP_440209.1_1 Forward -345 -337 18.1123 0.00295
NP_440209.1_1 Forward -204 -196 8.57422 0.0425
NP_442889.1_8 Forward -348 -334 3.04726 0.291
NP_440447.1_6 Forward -353 -335 7.29564 0.14
NP_441713.1_6 Reverse -89 -108 23.3039 0.0145
NP_441770.1_4 Reverse -202 -221 -11.4069 0.29
NP_440178.1_7 Forward -346 -327 7.86593 0.00934
NP_440178.1_7 Reverse -335 -354 -21.6334 0.232
NP_442570.1_3 Forward -31 -12 3.6377 0.166
NP_441716.1_5 Reverse -187 -200 17.6199 0.263
NP_442111.1_4 Reverse -194 -208 14.6509 0.0285
NP_442111.1_4 Forward -346 -332 10.7177 0.0518
NP_441163.1_1 Forward -60 -43 8.29791 0.232
NP_440343.1_3 Reverse -58 -76 3.26332 0.282
NP_440906.1_5 Forward -344 -337 15.8704 0.0124
NP_440906.1_5 Reverse -337 -344 15.8704 0.0124
NP_440906.1_5 Forward -203 -196 6.23397 0.234
NP_440906.1_5 Reverse -196 -203 6.13563 0.241
NP_440747.1_1 Reverse -301 -319 7.19731 0.252
NP_440747.1_10 Reverse -333 -345 17.1486 0.000663
NP_440747.1_10 Forward -348 -336 7.4138 0.00422
NP_440747.1_10 Reverse -192 -204 -2.4193 0.0434
NP_440747.1_10 Forward -207 -195 -11.8591 0.161
NP_440747.1_10 Forward -337 -325 -12.1541 0.227
NP_441130.1_10 Reverse -334 -348 9.2427 0.128
NP_441130.1_10 Forward -347 -333 5.70279 0.218
NP_442330.1_4 Reverse -67 -86 13.4822 0.286
NP_442330.1_9 Forward -239 -220 15.9291 0.106
NP_442634.1_4 Forward -347 -333 16.0275 0.0115
NP_442634.1_4 Reverse -334 -348 -2.06536 0.149
NP_442634.1_4 Reverse -193 -207 -2.65535 0.155
NP_441265.1_3 Reverse -330 -344 1.67122 0.2
NP_440403.1_4 Forward -354 -335 -8.85033 0.261
NP_441014.1_10 Forward -76 -57 0.0970122 0.246
NP_443018.1_3 Forward -344 -337 14.8871 0.0123
NP_443018.1_3 Reverse -337 -344 14.8871 0.0123
NP_443018.1_3 Reverse -196 -203 11.7405 0.0655
NP_443018.1_3 Forward -203 -196 5.44732 0.193
NP_441316.1_7 Forward -347 -332 -1.98672 0.24
NP_441634.1_8 Forward -336 -322 1.67122 0.185
NP_441634.1_8 Forward -314 -300 0.0979218 0.241
NP_441634.1_8 Reverse -295 -309 -4.22864 0.295
NP_441634.1_8 Reverse -334 -348 -4.4253 0.295
NP_440376.1_1 Forward -345 -336 19.4693 0.000692
NP_440376.1_1 Reverse -336 -345 19.4693 0.000692
NP_440376.1_1 Forward -204 -195 5.89959 0.116
NP_440376.1_1 Forward -312 -303 4.52295 0.156
NP_440376.1_1 Reverse -195 -204 -0.0986038 0.285
NP_441857.1_5 Forward -352 -334 5.72234 0.2
NP_442687.1_7 Forward -346 -336 18.5646 0.0028
NP_442687.1_7 Forward -205 -195 12.5664 0.0712
NP_442687.1_7 Forward -43 -33 9.61647 0.0994
NP_442687.1_7 Reverse -335 -345 9.02648 0.0994
NP_442191.1_4 Reverse -34 -48 15.5501 0.0585
NP_442485.1_3 Forward -71 -52 0.196116 0.247
NP_442485.1_3 Reverse -298 -317 -2.45882 0.262
NP_441013.1_2 Reverse -190 -208 -3.22577 0.29
NP_441682.1_6 Reverse -286 -305 14.0608 0.291
NP_441950.1_8 Reverse -299 -313 4.42448 0.292
NP_442658.1_1 Forward -347 -337 16.0075 0.00966
NP_442658.1_1 Reverse -334 -344 14.2375 0.0237
NP_442658.1_1 Forward -206 -196 6.17443 0.235
NP_442782.1_2 Forward -345 -331 8.84938 0.198
NP_442782.1_2 Forward -204 -190 8.35772 0.198
NP_442782.1_2 Forward -203 -189 1.76955 0.281
NP_442205.1_9 Forward -312 -296 -2.79306 0.272
NP_441414.1_9 Forward -345 -326 -0.787193 0.0943
NP_441414.1_9 Reverse -336 -355 -2.85214 0.124
NP_440607.1_8 Forward -199 -180 6.88262 0.191
NP_441487.1_9 Forward -346 -327 5.11266 0.139
NP_442937.1_5 Reverse -292 -311 17.3057 0.0323
NP_441958.1_5 Reverse -335 -345 21.2195 0.000805
NP_441958.1_5 Forward -346 -336 20.5312 0.000966
NP_441958.1_5 Forward -205 -195 8.73149 0.0255
NP_441958.1_5 Reverse -194 -204 1.65166 0.0872
NP_441127.1_1 Forward -188 -174 9.2427 0.278
NP_442836.1_5 Forward -351 -332 6.98095 0.171
NP_439905.1_1 Reverse -337 -350 11.229 0.204
NP_440984.1_7 Forward -350 -336 18.4858 0.0141
NP_440984.1_7 Reverse -331 -345 16.0275 0.0466
NP_440984.1_7 Reverse -298 -312 6.19444 0.224
NP_442911.1_2 Forward -355 -336 -4.52377 0.136
NP_442911.1_2 Forward -214 -195 -5.21209 0.153
NP_442911.1_2 Reverse -326 -345 -8.94866 0.247
NP_440153.1_5 Forward -344 -330 5.01447 0.193
NP_440153.1_5 Forward -203 -189 3.24451 0.217
NP_440153.1_8 Reverse -185 -198 -3.52063 0.295
NP_442536.1_7 Forward -210 -191 7.57094 0.273
NP_443055.1_6 Forward -218 -200 1.00172 0.237
NP_442236.1_3 Reverse -173 -192 7.86593 0.248
NP_440993.1_2 Reverse -190 -206 6.9417 0.195
NP_440993.1_2 Reverse -331 -347 4.28677 0.256
NP_441099.1_5 Reverse -326 -345 -9.24366 0.216
NP_441099.1_5 Forward -355 -336 -12.0953 0.294
NP_442002.1_9 Forward -346 -339 14.1004 0.074
NP_442002.1_9 Forward -205 -198 10.7572 0.185
NP_440809.1_9 Forward -187 -169 -8.53565 0.251
NP_442598.1_2 Forward -397 -388 14.5527 0.252
NP_441294.1_7 Forward -310 -296 11.9383 0.12
NP_441646.1_1 Reverse -296 -315 1.67108 0.23
NP_441646.1_1 Forward -313 -294 0.687771 0.245
NP_442438.1_10 Forward -311 -297 0.294584 0.232
NP_442431.1_10 Reverse -283 -301 3.85406 0.213
NP_442431.1_10 Forward -327 -309 1.98577 0.244
NP_441000.1_6 Forward -346 -332 5.40779 0.0933
NP_441000.1_6 Reverse -252 -266 1.86788 0.159
NP_441000.1_6 Reverse -335 -349 -3.34366 0.221
NP_442771.1_1 Reverse -175 -193 -10.0106 0.239
NP_440147.1_4 Reverse -334 -347 18.2105 0.00465
NP_440147.1_4 Forward -347 -334 17.6205 0.00602
NP_440147.1_4 Forward -206 -193 6.60746 0.0881
NP_441550.1_8 Forward -347 -337 18.1707 0.00754
NP_441550.1_8 Reverse -334 -344 15.8108 0.0132
NP_441550.1_8 Reverse -193 -203 10.0093 0.0785
NP_441550.1_8 Forward -206 -196 4.7978 0.283
NP_441916.1_7 Forward -345 -335 18.9579 0.00144
NP_441916.1_7 Reverse -336 -346 16.893 0.00407
NP_441916.1_7 Reverse -195 -205 9.51814 0.0338
NP_441916.1_7 Forward -204 -194 7.15819 0.0745
NP_440465.1_10 Forward -315 -296 3.14605 0.251
NP_441041.1_4 Forward -345 -326 1.86774 0.0784
NP_441041.1_7 Forward -348 -336 20.245 0.00277
NP_441041.1_7 Reverse -333 -345 13.3454 0.0485
NP_440569.1_6 Reverse -113 -132 1.96607 0.279
NP_442004.1_6 Forward -312 -298 6.09611 0.181
NP_441725.1_4 Reverse -190 -204 4.91554 0.278
NP_441725.1_4 Reverse -331 -345 4.03056 0.278
NP_441725.1_5 Reverse -337 -347 11.7798 0.0247
NP_441725.1_5 Forward -344 -334 1.94665 0.115
NP_441725.1_5 Reverse -196 -206 1.455 0.135
NP_439966.1_7 Reverse -334 -344 14.3359 0.0203
NP_439966.1_7 Forward -206 -196 8.73102 0.13
NP_439966.1_7 Forward -347 -337 8.63269 0.132
NP_439966.1_7 Reverse -193 -203 5.09279 0.243
NP_439966.1_9 Forward -206 -197 0.983037 0.253
NP_440202.1_8 Forward -208 -189 11.168 0.282
NP_442941.1_3 Forward -344 -334 19.2529 0.00262
NP_442941.1_3 Reverse -337 -347 10.6981 0.0116
NP_442941.1_3 Forward -203 -193 6.96153 0.0903
NP_442941.1_3 Reverse -196 -206 1.65166 0.147
NP_440674.1_2 Reverse -315 -334 17.7974 0.112
NP_440289.1_2 Forward -348 -335 15.1623 0.0107
NP_440289.1_2 Reverse -333 -346 6.01747 0.0605
NP_442281.1_1 Forward -350 -336 19.2718 0.00302
NP_442281.1_1 Reverse -331 -345 16.9119 0.00698
NP_442281.1_1 Reverse -190 -204 15.4369 0.0123
NP_442281.1_1 Forward -209 -195 6.98048 0.111
NP_441334.1_7 Forward -347 -328 -21.0434 0.287
NP_442256.1_2 Forward -347 -329 10.8356 0.0965
NP_440437.1_1 Reverse -330 -349 2.16274 0.139
NP_440647.1_9 Forward -347 -329 21.7503 0.0285
NP_441860.1_6 Reverse -124 -143 18.1213 0.228
NP_440498.1_1 Reverse -327 -345 7.39397 0.0836
NP_442982.1_5 Reverse -326 -345 -2.95047 0.289
NP_440375.1_8 Forward -344 -325 8.35759 0.149
NP_441644.1_6 Forward -345 -335 19.0557 0.000803
NP_441644.1_6 Reverse -336 -346 15.7125 0.0048
NP_441644.1_6 Reverse -195 -205 7.45273 0.124
NP_441644.1_6 Forward -312 -302 3.32285 0.288
NP_441644.1_6 Reverse -297 -307 3.22451 0.293
NP_442215.1_2 Reverse -334 -350 -1.51476 0.186
NP_442177.1_5 Forward -197 -183 7.66941 0.293
NP_440253.1_2 Forward -42 -24 -1.84914 0.252
NP_440929.1_3 Forward -207 -188 9.3409 0.294
NP_440929.1_8 Forward -345 -336 19.2726 0.000701
NP_440929.1_8 Reverse -336 -345 19.2726 0.000701
NP_440929.1_8 Reverse -195 -204 7.17789 0.0713
NP_442933.1_10 Forward -345 -336 17.601 0.00325
NP_442933.1_10 Reverse -336 -345 17.601 0.00325
NP_442933.1_10 Reverse -195 -204 8.06287 0.0885
NP_442933.1_10 Forward -204 -195 7.96454 0.0937
NP_441751.2_8 Reverse -337 -351 1.86788 0.0935
NP_441751.2_8 Forward -344 -330 -2.26202 0.132
NP_442554.1_8 Forward -344 -334 17.2863 0.00543
NP_442554.1_8 Reverse -337 -347 15.123 0.00944
NP_442554.1_8 Forward -203 -193 5.28991 0.153
NP_442554.1_8 Reverse -196 -206 4.0116 0.2
NP_441762.1_7 Forward -346 -334 1.7106 0.0735
NP_441762.1_7 Reverse -194 -206 -5.07423 0.187
NP_441762.1_7 Reverse -335 -347 -6.74586 0.284
NP_442142.1_4 Forward -348 -335 12.5067 0.0442
NP_442142.1_4 Forward -207 -194 6.50855 0.163
NP_442142.1_4 Reverse -333 -346 6.21356 0.17
NP_442292.1_1 Forward -344 -335 17.5026 0.00435
NP_442292.1_1 Reverse -337 -346 9.53783 0.0183
NP_442292.1_1 Reverse -196 -205 -0.196935 0.239
NP_442292.1_5 Reverse -299 -318 0.392778 0.257
NP_442476.1_6 Reverse -337 -351 10.226 0.0732
NP_442381.1_8 Forward -348 -329 -4.52377 0.137
NP_441523.1_6 Reverse -101 -120 7.47261 0.194
NP_443009.1_5 Reverse -335 -346 17.0694 0.00659
NP_443009.1_5 Forward -346 -335 16.7744 0.00677
NP_443009.1_5 Reverse -194 -205 5.95804 0.18
NP_442408.2_1 Reverse -195 -214 4.12936 0.143
NP_441715.1_4 Forward -344 -334 16.7946 0.0106
NP_441715.1_4 Reverse -337 -347 9.81313 0.097
NP_441715.1_4 Reverse -196 -206 6.46988 0.143
NP_441715.1_4 Forward -203 -193 5.78156 0.18
NP_440183.1_9 Reverse -181 -200 -20.8467 0.292
NP_441198.1_8 Reverse -147 -157 12.2947 0.144
NP_440379.1_5 Forward -349 -330 -5.9004 0.227
NP_441468.1_1 Forward -344 -337 15.8704 0.0124
NP_441468.1_1 Reverse -337 -344 15.8704 0.0124
NP_441468.1_1 Forward -203 -196 6.13563 0.209
NP_441468.1_1 Reverse -196 -203 6.0373 0.223
NP_441618.1_3 Forward -204 -185 1.76941 0.228
NP_441020.2_6 Forward -347 -330 6.43035 0.262
NP_441020.2_6 Forward -73 -56 6.33202 0.267
NP_441015.1_10 Reverse -292 -311 -8.06369 0.272
NP_441015.1_10 Forward -323 -304 -9.73531 0.282
NP_441015.1_10 Forward -329 -310 -10.3253 0.284
NP_441673.1_1 Forward -345 -336 20.8459 0.000698
NP_441673.1_1 Reverse -336 -345 20.8459 0.000698
NP_441673.1_1 Forward -204 -195 1.27803 0.155
NP_441673.1_1 Reverse -195 -204 1.27803 0.155
NP_441673.1_1 Forward -312 -303 -8.06341 0.254
NP_441731.1_3 Forward -212 -193 3.44104 0.159
NP_441172.1_1 Reverse -56 -74 14.7688 0.0301
NP_441826.1_2 Forward -351 -337 4.22782 0.104
NP_441826.1_2 Forward -210 -196 0.786239 0.172
NP_441330.1_1 Reverse -190 -209 -5.31042 0.116
NP_441330.1_1 Reverse -331 -350 -12.4886 0.183
NP_442868.1_6 Forward -347 -337 18.5646 0.0104
NP_442868.1_6 Reverse -334 -344 10.4031 0.038
NP_442868.1_6 Reverse -301 -311 5.48657 0.147
NP_442719.1_2 Forward -395 -377 -10.6013 0.278
NP_441612.1_2 Forward -114 -104 6.51622 0.287
NP_442559.1_3 Reverse -63 -82 7.37428 0.291
NP_442361.1_3 Forward -210 -197 17.1289 0.0481
NP_442427.1_8 Forward -354 -335 8.94757 0.192
NP_441944.1_3 Forward -214 -195 15.8307 0.142
NP_442808.1_1 Reverse -335 -345 8.73102 0.0481
NP_442808.1_1 Forward -346 -336 8.73102 0.0481
NP_441101.1_1 Reverse -295 -313 8.57394 0.291
NP_440145.1_3 Reverse -326 -345 3.6377 0.101
NP_442542.1_2 Forward -347 -334 8.47575 0.154
NP_442542.1_2 Reverse -334 -347 7.6891 0.173
NP_442050.1_5 Reverse -334 -344 15.9091 0.0091
NP_442050.1_5 Forward -347 -337 13.6475 0.0295
NP_442050.1_5 Reverse -193 -203 12.8609 0.0496
NP_440038.1_4 Reverse -187 -206 -1.18052 0.296
NP_441493.2_10 Reverse -344 -363 4.52268 0.287
NP_440558.1_2 Reverse -176 -195 -4.72043 0.248
NP_441878.1_6 Forward -346 -336 20.2362 0.0046
NP_441878.1_6 Reverse -335 -345 10.5014 0.0176
NP_441878.1_6 Forward -313 -303 -7.0998 0.204
NP_441878.1_6 Reverse -296 -306 -7.29646 0.217
NP_441036.1_3 Reverse -80 -99 1.17943 0.177
NP_441036.1_8 Reverse -335 -345 15.713 0.00724
NP_441036.1_8 Forward -205 -195 12.5664 0.0744
NP_441036.1_8 Forward -346 -336 8.4365 0.174
NP_441036.1_8 Forward -350 -340 7.05986 0.21
NP_441036.1_8 Reverse -194 -204 6.07655 0.242
NP_441557.1_5 Forward -345 -336 19.9609 0.000699
NP_441557.1_5 Reverse -336 -345 19.9609 0.000699
NP_441557.1_5 Forward -204 -195 8.94785 0.0289
NP_441557.1_5 Reverse -195 -204 0.688044 0.128
NP_441445.1_1 Forward -315 -296 1.86774 0.247
NP_441590.1_4 Reverse -304 -323 9.04509 0.249
NP_442066.2_4 Forward -204 -185 8.45592 0.0828
NP_442066.2_9 Forward -349 -336 10.934 0.154
NP_440744.1_2 Forward -346 -327 17.243 0.172
NP_441308.1_8 Forward -206 -196 8.4365 0.254
NP_440101.1_3 Reverse -331 -350 5.99764 0.187
NP_440101.1_3 Forward -350 -331 3.14605 0.237
NP_442183.1_1 Reverse -195 -209 7.76774 0.131
NP_441407.1_5 Reverse -326 -345 3.44104 0.279
NP_442397.1_9 Reverse -336 -355 4.32602 0.254
NP_440440.1_4 Forward -47 -28 17.6007 0.237
NP_441549.1_9 Forward -349 -331 3.16574 0.0925
NP_441549.1_9 Reverse -299 -317 -9.51896 0.252
NP_442170.1_5 Forward -345 -326 4.81767 0.158
NP_442347.1_2 Reverse -196 -205 8.94785 0.0718
NP_442347.1_2 Forward -344 -335 3.34298 0.284
NP_442347.1_2 Reverse -337 -346 3.34298 0.284
NP_442645.1_2 Reverse -328 -347 -22.3217 0.29
NP_441037.1_4 Forward -347 -337 9.55921 0.21
NP_441037.1_4 Reverse -251 -261 7.9999 0.237
NP_441037.1_4 Reverse -334 -344 7.22024 0.237
NP_442594.1_8 Forward -330 -311 1.67108 0.298
NP_441633.1_3 Reverse -334 -347 5.72248 0.0481
NP_441633.1_3 Forward -347 -334 -3.81562 0.177
NP_441633.1_3 Forward -80 -67 -6.66722 0.265
NP_440136.1_2 Forward -344 -337 15.9687 0.0123
NP_440136.1_2 Reverse -337 -344 15.9687 0.0123
NP_440136.1_2 Forward -203 -196 6.23397 0.171
NP_440136.1_2 Reverse -196 -203 6.13563 0.193
NP_442590.1_10 Forward -337 -318 10.7175 0.178
NP_442590.1_10 Forward -352 -333 7.96426 0.216
NP_442590.1_10 Reverse -297 -316 5.11266 0.267
NP_442998.1_5 Reverse -81 -91 12.0747 0.176
NP_442998.1_5 Forward -55 -45 11.6814 0.179
NP_442998.1_5 Reverse -377 -387 10.1081 0.225
NP_442998.1_10 Forward -343 -336 15.5754 0.0102
NP_442998.1_10 Reverse -338 -345 15.5754 0.0102
NP_442998.1_10 Reverse -197 -204 15.5754 0.0102
NP_440899.1_2 Forward -356 -337 7.66846 0.22
NP_440899.1_8 Reverse -7 -26 -2.65548 0.221
NP_440299.1_1 Forward -208 -195 10.7368 0.0541
NP_440299.1_1 Forward -46 -33 2.67367 0.279
NP_441799.1_1 Forward -349 -335 15.5352 0.0178
NP_441799.1_1 Reverse -332 -346 7.76712 0.133
NP_441799.1_1 Reverse -191 -205 5.60385 0.201
NP_441007.1_10 Forward -350 -337 10.4424 0.0656
NP_441007.1_10 Reverse -331 -344 1.39592 0.203
NP_442333.2_5 Reverse -184 -203 14.2574 0.0397
NP_440256.1_1 Reverse -333 -352 14.2574 0.0087
NP_440256.1_1 Forward -348 -329 -0.0988766 0.0893
NP_440256.1_1 Forward -207 -188 -0.590531 0.095
NP_440256.1_1 Reverse -192 -211 -1.7705 0.107
NP_440256.1_1 Forward -337 -318 -8.85033 0.268
NP_441559.1_8 Reverse -331 -345 1.47456 0.155
NP_441559.1_8 Forward -47 -33 -5.70361 0.27
NP_441559.1_8 Reverse -39 -53 -6.49025 0.279
NP_441559.1_8 Forward -172 -158 -6.98191 0.281
NP_440915.1_6 Forward -349 -335 12.586 0.0208
NP_440915.1_6 Reverse -332 -346 8.84938 0.0499
NP_440915.1_6 Forward -208 -194 5.30946 0.091
NP_440915.1_6 Reverse -191 -205 -1.08205 0.22
NP_442158.1_4 Reverse -213 -223 12.1731 0.257
NP_442785.1_7 Reverse -334 -348 10.816 0.228
NP_441866.1_6 Reverse -301 -320 8.4551 0.258
NP_442866.1_1 Forward -209 -190 -8.16202 0.277
NP_442866.1_1 Forward -71 -52 -8.35868 0.279
NP_442866.1_6 Reverse -287 -306 5.99764 0.297
NP_440748.1_5 Reverse -53 -72 2.85105 0.214
NP_441464.1_8 Forward -306 -292 5.50613 0.253
NP_441464.1_8 Reverse -300 -314 5.30946 0.259
NP_440702.1_2 Reverse -205 -224 -6.78538 0.261
NP_440702.1_2 Reverse -28 -47 -8.06369 0.286
NP_440695.1_5 Forward -345 -326 -1.18052 0.284
NP_440695.1_6 Forward -168 -154 17.4893 0.126
NP_441939.1_3 Reverse -337 -356 19.3707 0.0118
NP_441939.1_3 Forward -344 -325 6.78429 0.222
NP_440677.1_6 Forward -213 -194 9.24257 0.27
NP_442386.1_9 Forward -346 -337 6.39082 0.219
NP_442386.1_9 Reverse -335 -344 6.39082 0.219
NP_442386.1_9 Forward -205 -196 5.9975 0.23
NP_441340.1_5 Forward -344 -337 15.6737 0.0124
NP_441340.1_5 Reverse -337 -344 15.6737 0.0124
NP_441340.1_5 Forward -203 -196 13.5105 0.0314
NP_441340.1_5 Reverse -196 -203 5.84064 0.208
NP_442484.1_2 Reverse -304 -323 5.40766 0.169
NP_442791.1_5 Reverse -26 -45 5.40766 0.193
NP_440168.1_9 Forward -347 -328 -4.42544 0.296
NP_442240.1_2 Forward -203 -184 -9.24366 0.137
NP_442240.1_2 Forward -344 -325 -20.2567 0.295
NP_440586.1_1 Reverse -216 -235 -6.29373 0.299
NP_440586.1_8 Forward -344 -337 13.2151 0.026
NP_440586.1_8 Reverse -337 -344 13.2151 0.026
NP_440586.1_8 Reverse -196 -203 9.47853 0.146
NP_440586.1_8 Forward -203 -196 5.74197 0.283
NP_442251.1_6 Forward -344 -337 15.2804 0.0124
NP_442251.1_6 Reverse -337 -344 15.2804 0.0124
NP_442251.1_6 Reverse -381 -388 6.43063 0.298
NP_441262.1_3 Reverse -336 -343 14.7888 0.0223
NP_441262.1_3 Forward -345 -338 14.7888 0.0223
NP_441262.1_3 Forward -204 -197 14.7888 0.0223
NP_440027.1_3 Reverse -56 -74 6.70489 0.223
NP_443051.1_1 Reverse -335 -344 19.5676 0.00335
NP_443051.1_1 Forward -346 -337 18.0926 0.00402
NP_443051.1_1 Forward -205 -196 7.47288 0.0571
NP_443051.1_1 Reverse -194 -203 0.393051 0.169
NP_439937.1_8 Reverse -67 -86 -3.54046 0.27
NP_439937.1_9 Reverse -61 -78 -16.973 0.291
NP_439937.1_9 Reverse -178 -195 -17.1697 0.294
NP_439937.1_9 Reverse -232 -249 -17.268 0.296
NP_440408.1_7 Forward -204 -185 9.24257 0.264
NP_440439.1_1 Reverse -333 -346 20.0788 0.0105
NP_440439.1_1 Forward -207 -194 13.6873 0.0186
NP_440439.1_1 Reverse -192 -205 6.1158 0.0818
NP_440439.1_1 Forward -348 -335 1.78924 0.143
NP_440372.1_2 Forward -344 -337 16.3621 0.0124
NP_440372.1_2 Reverse -337 -344 16.3621 0.0124
NP_440372.1_2 Forward -203 -196 13.8055 0.0214
NP_440372.1_2 Reverse -196 -203 6.52896 0.188
NP_440770.1_3 Reverse -221 -235 16.1259 0.214
NP_441789.1_7 Reverse -327 -346 3.9319 0.193
NP_441572.1_7 Forward -351 -332 4.42435 0.098
NP_441572.1_7 Reverse -189 -208 1.47442 0.149
NP_440267.1_2 Reverse -331 -345 20.5501 0.00946
NP_440267.1_2 Forward -350 -336 9.34041 0.156
NP_442384.1_10 Reverse -336 -349 12.2123 0.0296
NP_442384.1_10 Reverse -195 -208 12.114 0.0304
NP_442384.1_10 Forward -345 -332 9.95071 0.047
NP_442384.1_10 Reverse -297 -310 0.60927 0.286
NP_442790.1_4 Forward -213 -194 -2.95047 0.12
NP_442262.1_10 Forward -344 -337 14.1988 0.0123
NP_442262.1_10 Reverse -337 -344 14.1988 0.0123
NP_442262.1_10 Reverse -196 -203 13.2155 0.0213
NP_441689.1_5 Reverse -334 -344 8.3377 0.132
NP_441689.1_5 Reverse -193 -203 8.3377 0.132
NP_441689.1_5 Forward -206 -196 5.97777 0.197
NP_440163.1_10 Forward -207 -197 16.303 0.0762
NP_440282.1_10 Forward -355 -336 -6.78538 0.25
NP_440531.1_6 Forward -353 -334 5.99764 0.112
NP_440531.1_6 Reverse -245 -264 3.04771 0.148
NP_440531.1_6 Reverse -187 -206 0.687771 0.19
NP_442123.1_3 Reverse -336 -355 12.5858 0.2
NP_441060.1_7 Forward -87 -68 12.4875 0.223
NP_441965.1_7 Reverse -57 -76 11.3067 0.292
NP_441965.1_10 Forward -348 -332 5.07341 0.219
NP_442693.1_6 Reverse -330 -349 9.63589 0.278
NP_442693.1_6 Forward -210 -191 1.27776 0.278
NP_440297.1_9 Reverse -337 -347 9.61647 0.0917
NP_440297.1_9 Forward -344 -334 -0.216628 0.282
NP_440297.1_9 Reverse -196 -206 -0.511621 0.289
NP_442280.1_10 Forward -85 -67 11.4933 0.205
NP_440298.1_2 Forward -210 -191 4.42435 0.282
NP_441896.1_3 Forward -354 -335 3.53937 0.167
NP_441896.1_5 Forward -60 -53 12.2322 0.273
NP_440999.1_9 Forward -349 -335 5.60446 0.11
NP_440999.1_9 Reverse -321 -335 0.589577 0.18
NP_440999.1_9 Forward -46 -32 -0.885388 0.22
NP_440999.1_9 Reverse -332 -346 -1.5737 0.242
NP_440888.1_2 Forward -345 -331 13.2736 0.0307
NP_440888.1_2 Reverse -195 -209 11.1104 0.0757
NP_440888.1_2 Reverse -303 -317 11.012 0.0783
NP_440888.1_2 Reverse -336 -350 7.66879 0.186
NP_440888.1_2 Forward -306 -292 5.50552 0.276
NP_440600.1_4 Reverse -187 -205 -1.06249 0.162
NP_440060.1_2 Reverse -217 -236 18.3865 0.169
NP_441345.1_4 Forward -198 -179 13.2741 0.265
NP_442948.1_2 Reverse -68 -87 5.11266 0.256
NP_442033.1_10 Reverse -183 -202 -9.73531 0.221
NP_442033.1_10 Forward -347 -328 -14.0619 0.296
NP_441543.1_2 Forward -344 -335 15.9293 0.00518
NP_441543.1_2 Reverse -337 -346 9.34117 0.0818
NP_441543.1_2 Reverse -196 -205 8.65285 0.0968
NP_442845.1_2 Reverse -297 -311 5.60446 0.228
NP_442845.1_2 Forward -318 -304 4.22782 0.264
NP_441551.1_5 Forward -349 -333 6.84268 0.256
NP_441319.1_8 Forward -210 -192 7.88563 0.239
NP_441469.1_8 Forward -346 -337 13.3727 0.073
NP_441469.1_8 Reverse -335 -344 6.5879 0.227
NP_441469.1_8 Forward -205 -196 6.39124 0.227
NP_442315.1_1 Forward -326 -308 7.19731 0.251
NP_443064.1_6 Reverse -336 -346 13.8273 0.0796
NP_443064.1_6 Forward -345 -335 10.8217 0.13
NP_442337.1_6 Forward -319 -300 14.3251 0.245
NP_442337.1_8 Forward -34 -15 -2.36049 0.3
NP_442578.1_7 Forward -344 -337 14.5921 0.026
NP_442578.1_7 Reverse -337 -344 14.5921 0.026
NP_442578.1_7 Forward -203 -196 6.0373 0.18
NP_440710.1_1 Reverse -328 -346 1.19912 0.143
NP_440220.1_4 Reverse -38 -57 11.5033 0.151
NP_441462.1_2 Forward -345 -335 20.2362 0.000805
NP_441462.1_2 Reverse -336 -346 20.1379 0.000967
NP_441462.1_2 Forward -204 -194 17.4829 0.00406
NP_441462.1_2 Reverse -303 -313 -0.904945 0.265
NP_441621.1_7 Forward -347 -333 2.65453 0.123
NP_443062.1_1 Forward -345 -327 19.7593 0.0208
NP_443062.1_1 Forward -204 -186 5.5232 0.227
NP_443062.1_6 Forward -353 -334 5.40766 0.204
NP_441601.1_4 Forward -211 -192 6.68596 0.162
NP_440519.1_8 Forward -258 -242 4.28677 0.228
NP_442204.1_1 Reverse -332 -343 11.3667 0.0565
NP_442204.1_1 Forward -208 -197 9.69511 0.0736
NP_442204.1_1 Reverse -191 -202 1.92696 0.266
NP_442204.1_1 Forward -316 -305 -0.137991 0.286
NP_442487.1_2 Reverse -314 -333 1.17865 0.284
NP_440516.1_8 Forward -345 -336 16.9127 0.00442
NP_440516.1_8 Reverse -336 -345 16.9127 0.00442
NP_440516.1_8 Forward -204 -195 9.4395 0.0183
NP_440516.1_8 Reverse -195 -204 5.11294 0.118
NP_442428.1_5 Forward -344 -337 15.8704 0.0124
NP_442428.1_5 Reverse -337 -344 15.8704 0.0124
NP_442428.1_5 Forward -203 -196 6.13563 0.209
NP_442428.1_5 Reverse -196 -203 6.0373 0.212
NP_441443.1_7 Forward -343 -324 -2.36049 0.268
NP_441790.1_3 Forward -344 -325 2.94938 0.153
NP_441867.1_6 Reverse -43 -62 13.3725 0.0511
NP_440673.1_3 Forward -343 -336 12.4288 0.0426
NP_440673.1_3 Reverse -338 -345 12.4288 0.0426
NP_440673.1_3 Reverse -197 -204 12.4288 0.0426
NP_441052.1_2 Forward -345 -335 10.4031 0.0285
NP_441052.1_2 Reverse -336 -346 10.4031 0.0285
NP_441052.1_2 Reverse -297 -307 5.09324 0.132
NP_441052.1_2 Forward -306 -296 4.3066 0.161
NP_441052.1_2 Reverse -105 -115 -0.314959 0.273
NP_442219.1_9 Forward -344 -335 8.25953 0.0681
NP_442219.1_9 Reverse -337 -346 8.25953 0.0681
NP_440592.1_5 Reverse -54 -73 21.4347 0.0517
NP_440436.1_4 Reverse -337 -346 15.9289 0.00508
NP_440436.1_4 Forward -344 -335 9.24241 0.0871
NP_440436.1_4 Reverse -196 -205 8.55409 0.0997
NP_441884.1_8 Forward -205 -186 9.43923 0.0541
NP_441884.1_8 Forward -346 -327 -10.1286 0.268
NP_441884.1_9 Forward -348 -329 -23.6983 0.284
NP_440314.1_9 Forward -305 -286 -8.55534 0.249
NP_440648.1_1 Forward -345 -326 23.9922 0.015
NP_441719.1_4 Forward -344 -337 16.3621 0.0124
NP_441719.1_4 Reverse -337 -344 16.3621 0.0124
NP_441719.1_4 Forward -203 -196 6.82395 0.0855
NP_441719.1_4 Reverse -196 -203 6.52896 0.188
NP_441733.1_10 Reverse -333 -346 4.05085 0.276
NP_441004.1_1 Forward -324 -305 -14.0619 0.263
NP_442813.1_4 Forward -86 -67 -8.26035 0.299
NP_442366.1_1 Reverse -85 -98 15.2606 0.272
NP_442366.1_3 Reverse -194 -212 6.11567 0.0819
NP_442366.1_3 Forward -346 -328 -2.0458 0.219
NP_442366.1_5 Reverse -250 -260 10.1076 0.289
NP_440129.1_10 Forward -211 -197 16.1259 0.0373
NP_441115.1_4 Reverse -335 -353 9.06482 0.227
NP_442206.1_10 Reverse -195 -210 2.33984 0.202
NP_442206.1_10 Forward -204 -189 1.06154 0.238
NP_442854.1_6 Forward -204 -185 6.68596 0.234
NP_440328.1_4 Forward -351 -332 17.8957 0.0248
NP_440328.1_4 Reverse -330 -349 9.83255 0.092
NP_443054.1_2 Reverse -334 -348 8.35772 0.122
NP_442430.1_10 Reverse -326 -345 11.7 0.245
NP_441851.1_10 Forward -346 -336 17.4829 0.0027
NP_441851.1_10 Reverse -335 -345 8.53483 0.114
NP_441851.1_10 Forward -205 -195 7.55152 0.137
NP_442622.1_1 Forward -43 -24 -13.0786 0.282
NP_442622.1_8 Reverse -336 -354 -18.5654 0.23
NP_441542.1_4 Reverse -374 -388 4.42448 0.264
NP_442011.1_1 Forward -205 -186 7.37428 0.186
NP_441668.1_4 Forward -128 -109 4.81767 0.173
NP_441668.1_4 Reverse -30 -49 -0.787193 0.262
NP_442515.1_1 Forward -307 -293 10.9143 0.0445
NP_442515.1_1 Reverse -335 -349 5.21113 0.107
NP_442515.1_1 Forward -346 -332 2.94952 0.128
NP_442515.1_1 Reverse -299 -313 1.86788 0.147
NP_442515.1_1 Forward -310 -296 0.196253 0.2
NP_442515.1_1 Forward -43 -29 -2.65535 0.277
NP_441396.1_5 Forward -199 -190 7.27622 0.29
NP_440165.1_5 Forward -205 -186 -5.60541 0.224
NP_442709.1_3 Forward -352 -333 9.93088 0.121
NP_440940.1_7 Forward -214 -196 4.73828 0.242
NP_441349.1_10 Forward -355 -336 -9.34199 0.289
NP_440874.1_3 Reverse -327 -345 12.9988 0.114
NP_441409.1_6 Forward -351 -332 -5.70374 0.11
NP_440432.1_9 Forward -344 -329 14.3362 0.0148
NP_440432.1_9 Reverse -337 -352 13.6479 0.0193
NP_442843.1_1 Forward -261 -242 -1.47551 0.197
NP_439960.1_10 Reverse -188 -206 -3.52077 0.275
NP_440396.1_1 Forward -321 -302 6.09597 0.156
NP_440431.1_3 Forward -231 -212 -11.8003 0.291
NP_440431.1_3 Reverse -32 -51 -11.9969 0.295
NP_440431.1_4 Reverse -85 -104 -9.1199 0.275
NP_442450.1_5 Forward -347 -337 10.0098 0.115
NP_440588.1_3 Forward -76 -57 8.65258 0.296
NP_440195.1_4 Reverse -57 -76 4.32602 0.297
NP_440943.1_4 Reverse -109 -121 17.3452 0.0959
NP_441570.1_1 Forward -345 -327 -1.45582 0.0568
NP_441570.1_1 Reverse -336 -354 -6.66736 0.0813
NP_441570.1_1 Forward -204 -186 -8.53565 0.115
NP_441078.1_4 Forward -345 -336 19.6659 0.0007
NP_441078.1_4 Reverse -336 -345 19.6659 0.0007
NP_441078.1_4 Reverse -195 -204 0.0980582 0.205
NP_441078.1_4 Forward -204 -195 0.0980582 0.205
NP_441078.1_4 Reverse -303 -312 -1.77023 0.266
NP_441078.1_4 Forward -312 -303 -1.77023 0.266
NP_441078.1_4 Reverse -297 -306 -1.86856 0.272
NP_442729.1_5 Reverse -200 -210 14.0414 0.22
NP_442729.1_5 Forward -331 -321 8.33817 0.248
NP_441663.1_8 Reverse -330 -349 14.5524 0.0508
NP_441663.1_8 Reverse -189 -208 7.17762 0.107
NP_442348.1_2 Reverse -43 -52 7.76787 0.28
NP_440707.1_7 Forward -260 -241 7.47261 0.22
NP_442443.1_1 Reverse -37 -56 -5.60541 0.282
NP_442443.1_4 Reverse -383 -393 13.0576 0.264
NP_440526.1_3 Reverse -337 -348 10.9729 0.0646
NP_441432.1_8 Reverse -335 -344 16.8143 0.00595
NP_441432.1_8 Forward -346 -337 8.35786 0.0755
NP_441432.1_8 Forward -205 -196 5.50626 0.151
NP_442320.1_8 Forward -210 -196 -5.11362 0.206
NP_442344.1_7 Forward -344 -325 0.0977854 0.102
NP_441732.1_2 Forward -316 -300 4.0901 0.0141
NP_441732.1_2 Forward -118 -102 -6.13632 0.0495
NP_441732.1_2 Reverse -332 -348 -16.3627 0.165
NP_441732.1_2 Forward -46 -30 -16.4611 0.167
NP_442815.1_2 Forward -245 -227 7.59063 0.204
NP_440685.1_6 Forward -348 -329 19.0748 0.0871
NP_440760.1_1 Reverse -336 -355 -3.14714 0.034
NP_440760.1_1 Forward -345 -326 -18.7818 0.217
NP_441131.1_5 Reverse -168 -187 5.30933 0.251
NP_441945.1_10 Reverse -284 -303 7.57094 0.284
NP_442353.1_4 Reverse -319 -338 -0.29631 0.289
NP_440913.1_1 Reverse -334 -352 21.357 0.0482
NP_440913.1_1 Forward -347 -329 5.82068 0.234
NP_442727.1_1 Reverse -287 -301 11.111 0.297
NP_440713.1_4 Reverse -185 -204 7.47261 0.18
NP_440713.1_4 Forward -322 -303 3.73603 0.239
NP_442489.1_7 Forward -345 -336 20.1576 0.000695
NP_442489.1_7 Reverse -336 -345 20.1576 0.000695
NP_442489.1_7 Reverse -195 -204 0.786375 0.152
NP_442489.1_7 Forward -204 -195 0.589713 0.17
NP_442489.1_7 Forward -312 -303 -1.27858 0.185
NP_442489.1_7 Reverse -297 -306 -1.37691 0.195
NP_440757.1_4 Forward -315 -296 19.174 0.0185
NP_440757.1_4 Reverse -294 -313 0.982764 0.295
NP_440559.1_1 Reverse -337 -346 17.306 0.00658
NP_440559.1_1 Forward -344 -335 8.65285 0.0586
NP_440559.1_1 Forward -203 -194 5.99792 0.135
NP_441659.2_8 Forward -345 -335 20.9245 0.000805
NP_441659.2_8 Reverse -336 -346 19.3512 0.000966
NP_441659.2_8 Reverse -195 -205 6.56821 0.0714
NP_441659.2_8 Reverse -303 -313 6.07655 0.0862
NP_441659.2_8 Forward -306 -296 3.42162 0.161
NP_441659.2_8 Forward -204 -194 1.74999 0.227
NP_442913.1_10 Reverse -327 -346 9.93088 0.0425
NP_442913.1_10 Forward -354 -335 5.60432 0.0693
NP_441040.1_2 Forward -320 -301 -14.5535 0.286
NP_439956.1_8 Forward -210 -191 9.53756 0.289
NP_442008.1_2 Forward -348 -329 3.14605 0.262
NP_442776.1_1 Reverse -325 -344 12.7825 0.127
NP_442346.1_5 Forward -346 -336 17.9746 0.00128
NP_442346.1_5 Reverse -335 -345 16.303 0.00248
NP_442346.1_5 Forward -307 -297 8.33817 0.14
NP_442346.1_5 Reverse -194 -204 4.3066 0.291
NP_440545.1_3 Reverse -332 -349 4.75873 0.0674
NP_440545.1_3 Reverse -299 -316 1.51381 0.118
NP_440545.1_3 Reverse -191 -208 -5.27103 0.245
NP_440545.1_3 Forward -58 -41 -6.746 0.287
NP_441856.1_3 Forward -348 -329 17.109 0.0286
NP_440831.1_3 Reverse -186 -205 4.73683 0.298
NP_441629.1_3 Reverse -188 -207 2.6536 0.218
NP_441629.1_3 Forward -236 -217 -3.44288 0.277
NP_441710.1_9 Forward -352 -333 17.4032 0.0992
NP_440459.1_2 Reverse -334 -351 10.1669 0.207
NP_441653.1_2 Forward -356 -337 6.13873 0.235
NP_440010.1_10 Forward -321 -302 4.71934 0.244
NP_442551.1_4 Forward -246 -231 6.07642 0.211
NP_440847.1_5 Forward -322 -303 13.6675 0.281
NP_442603.1_7 Reverse -336 -350 8.16044 0.183
NP_442603.1_7 Forward -204 -190 7.86545 0.193
NP_441585.1_5 Reverse -23 -42 4.81688 0.227
NP_441888.1_7 Forward -209 -195 4.81781 0.225
NP_441948.1_4 Forward -352 -334 5.32902 0.079
NP_441948.1_4 Reverse -329 -347 -5.29072 0.26
NP_441047.1_2 Reverse -67 -86 1.17943 0.239
NP_441833.1_4 Forward -344 -337 15.9687 0.0124
NP_441833.1_4 Reverse -337 -344 15.9687 0.0124
NP_441833.1_4 Reverse -196 -203 6.52896 0.0924
NP_441833.1_4 Forward -203 -196 6.23397 0.163
NP_441895.1_10 Reverse -77 -96 -18.6834 0.282
NP_441112.1_6 Reverse -185 -204 -4.6221 0.297
NP_442162.1_9 Forward -344 -337 16.2637 0.0124
NP_442162.1_9 Reverse -337 -344 16.2637 0.0124
NP_442162.1_9 Forward -203 -196 12.9205 0.0282
NP_442162.1_9 Reverse -196 -203 12.9205 0.0282
NP_440671.1_4 Forward -210 -196 13.0776 0.0926
NP_440671.1_4 Reverse -189 -203 6.29277 0.252
NP_440224.1_1 Reverse -184 -203 5.99764 0.132
NP_442045.1_5 Reverse -188 -207 -2.0655 0.292
NP_441915.1_2 Reverse -168 -187 14.5524 0.292
NP_442140.1_3 Reverse -337 -347 11.5831 0.0743
NP_442140.1_3 Reverse -196 -206 6.27322 0.176
NP_442140.1_3 Forward -344 -334 4.69992 0.238
NP_441671.1_1 Reverse -340 -359 -0.787193 0.273
NP_440875.1_9 Forward -343 -333 16.5483 0.0145
NP_440875.1_9 Reverse -146 -156 10.7081 0.201
NP_440875.1_9 Reverse -197 -207 9.05339 0.233
NP_440875.1_9 Reverse -338 -348 7.59334 0.255
NP_441813.1_5 Forward -347 -337 18.3679 0.00743
NP_441813.1_5 Reverse -334 -344 18.1713 0.00743
NP_441813.1_5 Reverse -193 -203 14.238 0.0167
NP_441813.1_5 Forward -206 -196 7.45319 0.0746
NP_440594.1_8 Forward -388 -375 7.78685 0.267
NP_440590.1_4 Reverse -337 -350 2.96921 0.0783
NP_440590.1_4 Forward -344 -331 -5.38892 0.277
NP_440590.1_4 Forward -203 -190 -5.78224 0.289
NP_440567.1_1 Reverse -196 -210 2.85119 0.16
NP_440567.1_1 Forward -344 -330 0.294584 0.25
NP_442497.1_10 Reverse -337 -346 19.8626 0.00532
NP_442497.1_10 Forward -344 -335 17.601 0.00813
NP_442497.1_10 Forward -203 -194 5.99792 0.095
NP_442497.1_10 Reverse -196 -205 0.589713 0.153
NP_440821.1_4 Forward -347 -337 10.9931 0.0146
NP_440821.1_4 Forward -206 -196 9.32148 0.03
NP_440821.1_4 Reverse -334 -344 2.24165 0.131
NP_441239.1_9 Reverse -334 -346 16.5586 0.0166
NP_441239.1_9 Reverse -193 -205 12.7237 0.0433
NP_441239.1_9 Forward -347 -335 12.6253 0.0446
NP_442691.1_2 Reverse -6 -25 8.65258 0.161
NP_441892.1_1 Reverse -186 -203 2.98877 0.133
NP_441892.1_1 Forward -354 -337 -4.18939 0.256
NP_440604.1_6 Forward -345 -326 -1.86883 0.209
NP_442044.1_1 Forward -119 -100 -4.6221 0.18
NP_442044.1_1 Forward -317 -298 -13.2752 0.276
NP_442193.1_1 Reverse -208 -226 12.1139 0.223
NP_442193.1_1 Reverse -116 -134 9.85225 0.233
NP_441508.1_4 Forward -131 -117 13.9534 0.287
NP_442643.1_1 Forward -210 -191 -12.5869 0.268
NP_442643.1_3 Forward -209 -190 15.8307 0.023
NP_442772.1_4 Forward -53 -34 -3.73712 0.244
NP_440833.1_6 Forward -128 -114 7.66879 0.278
NP_442138.1_10 Forward -204 -185 -5.21209 0.268
NP_440546.1_4 Forward -204 -194 16.1543 0.0459
NP_440546.1_4 Forward -345 -335 13.5365 0.0459
NP_440546.1_4 Reverse -336 -346 12.8578 0.0572
NP_440546.1_4 Reverse -195 -205 10.046 0.109
NP_441230.1_5 Reverse -190 -209 5.211 0.182
NP_440462.1_6 Reverse -334 -344 18.7612 0.00454
NP_440462.1_6 Reverse -193 -203 15.123 0.0159
NP_440462.1_6 Forward -347 -337 9.7148 0.0429
NP_440462.1_6 Forward -206 -196 5.87989 0.135
NP_442611.1_1 Forward -345 -326 8.75091 0.127
NP_442611.1_1 Reverse -195 -214 -2.75381 0.295
NP_440868.1_4 Reverse -332 -344 14.7886 0.0169
NP_440868.1_4 Forward -208 -196 6.1355 0.0878
NP_440868.1_4 Forward -349 -337 3.38223 0.136
NP_442479.1_9 Reverse -271 -290 -12.3902 0.281
NP_442479.1_9 Reverse -369 -388 -14.0619 0.294
NP_441474.1_1 Reverse -326 -345 0.883656 0.253
NP_442402.1_4 Reverse -97 -116 5.11187 0.144
NP_439942.1_7 Reverse -31 -50 -5.70374 0.279
NP_441843.2_9 Forward -343 -325 12.5345 0.205
NP_442039.1_4 Forward -344 -337 15.1821 0.0124
NP_442039.1_4 Reverse -337 -344 15.1821 0.0124
NP_442039.1_4 Forward -203 -196 11.6422 0.0747
NP_442039.1_7 Forward -250 -240 11.9764 0.257
NP_442679.1_1 Reverse -66 -85 -1.67217 0.24
NP_442829.1_2 Reverse -380 -396 14.229 0.287
NP_441926.1_3 Forward -345 -329 6.05672 0.17
NP_440825.1_4 Reverse -35 -54 5.01433 0.266
NP_442837.1_3 Forward -344 -337 15.7721 0.0124
NP_442837.1_3 Reverse -337 -344 15.7721 0.0124
NP_442837.1_3 Forward -203 -196 6.0373 0.25
NP_442837.1_3 Reverse -196 -203 6.0373 0.25
NP_440160.1_9 Forward -204 -185 23.4022 0.0402
NP_442053.1_1 Forward -345 -336 18.3876 0.0007
NP_442053.1_1 Reverse -336 -345 18.3876 0.0007
NP_442053.1_1 Reverse -195 -204 7.17789 0.104
NP_440505.1_3 Reverse -334 -344 17.188 0.00332
NP_440505.1_3 Forward -206 -196 12.2714 0.0543
NP_440505.1_3 Forward -347 -337 9.61647 0.122
NP_440505.1_3 Reverse -167 -177 9.02648 0.128
NP_441203.1_1 Reverse -196 -215 -10.9153 0.137
NP_441203.1_1 Forward -203 -184 -16.8151 0.265
NP_440914.1_1 Forward -345 -335 16.3248 0.00196
NP_440914.1_1 Reverse -336 -346 8.51751 0.186
NP_441011.1_8 Forward -344 -335 16.6177 0.00602
NP_441011.1_8 Forward -203 -194 14.356 0.0249
NP_441011.1_8 Reverse -337 -346 14.356 0.0249
NP_441011.1_8 Reverse -196 -205 7.07956 0.179
NP_442101.1_10 Reverse -328 -347 10.6192 0.0381
NP_442533.1_1 Forward -327 -308 -5.11376 0.155
NP_442533.1_1 Forward -324 -305 -14.9469 0.248
NP_442533.1_6 Forward -345 -336 17.2076 0.00137
NP_442533.1_6 Reverse -336 -345 17.2076 0.00137
NP_442533.1_6 Reverse -303 -312 7.47288 0.0898
NP_442533.1_6 Forward -306 -297 5.60459 0.137
NP_442533.1_6 Forward -204 -195 5.40793 0.14
NP_442533.1_6 Reverse -195 -204 4.52295 0.179
NP_442533.1_6 Forward -312 -303 3.83464 0.202
NP_442533.1_6 Reverse -297 -306 3.7363 0.204
NP_442232.1_3 Reverse -217 -236 -5.11376 0.165
NP_442322.1_4 Reverse -187 -204 -1.33848 0.226
NP_443016.1_1 Reverse -330 -349 -6.98204 0.265
NP_441482.1_7 Forward -351 -337 -0.885388 0.0612
NP_441482.1_7 Forward -210 -196 -1.5737 0.0755
NP_441482.1_7 Reverse -330 -344 -2.85201 0.1
NP_441482.1_7 Reverse -189 -203 -4.32697 0.147
NP_439944.1_9 Forward -344 -334 9.12481 0.1
NP_439944.1_9 Reverse -337 -347 8.82982 0.101
NP_441028.1_6 Forward -87 -77 7.94438 0.217
NP_441028.1_6 Forward -86 -76 5.68278 0.243
NP_440116.1_8 Reverse -337 -356 -2.0655 0.125
NP_440115.1_6 Reverse -333 -343 14.0414 0.0615
NP_440115.1_6 Forward -348 -338 7.15819 0.158
NP_440007.1_9 Forward -349 -335 8.45605 0.178
NP_440007.1_9 Forward -208 -194 2.2612 0.281
NP_441602.1_3 Reverse -298 -317 6.19431 0.136
NP_441972.1_5 Forward -323 -304 -3.04881 0.196
NP_441972.1_5 Reverse -337 -356 -4.72043 0.211
NP_441106.1_1 Reverse -335 -344 18.486 0.0028
NP_441106.1_1 Forward -346 -337 9.73449 0.0311
NP_441106.1_1 Forward -205 -196 8.45619 0.0548
NP_441106.1_1 Reverse -194 -203 7.96454 0.0647
NP_441106.1_2 Reverse -186 -204 13.8838 0.226
NP_440429.1_2 Reverse -180 -199 9.14423 0.272
NP_439903.1_6 Reverse -192 -211 5.40686 0.183
NP_439903.1_6 Reverse -333 -352 4.32522 0.197
NP_442306.1_3 Reverse -77 -96 21.6323 0.0498
NP_441286.1_1 Reverse -335 -347 6.03717 0.0258
NP_441286.1_1 Forward -346 -334 -3.50094 0.145
NP_440670.1_8 Forward -345 -336 18.3876 0.000699
NP_440670.1_8 Reverse -336 -345 18.3876 0.000699
NP_440670.1_8 Forward -204 -195 8.65285 0.0627
NP_440670.1_8 Reverse -195 -204 6.29291 0.124
NP_440886.1_7 Forward -346 -336 8.04271 0.0805
NP_440886.1_7 Reverse -335 -345 8.04271 0.0805
NP_440886.1_7 Forward -307 -297 6.0761 0.147
NP_440886.1_7 Reverse -302 -312 4.01116 0.255
NP_442614.1_2 Reverse -336 -350 16.0275 0.0745
NP_442614.1_2 Forward -246 -232 13.5693 0.124
NP_442614.1_2 Forward -312 -298 9.2427 0.242
NP_442382.1_9 Forward -118 -99 11.7983 0.266
NP_442072.1_9 Forward -346 -328 -11.0923 0.0789
NP_442072.1_9 Reverse -335 -353 -12.2722 0.0831
NP_442213.1_6 Reverse -35 -54 6.68596 0.254
NP_441753.1_3 Reverse -297 -316 19.8623 0.101
NP_441808.1_2 Forward -342 -323 11.5042 0.226
NP_441808.1_8 Forward -330 -311 12.5858 0.213
NP_440907.2_8 Reverse -337 -347 9.91099 0.103
NP_440907.2_8 Forward -344 -334 9.616 0.103
NP_440907.2_8 Reverse -196 -206 6.0761 0.179
NP_442264.1_2 Reverse -293 -310 4.95539 0.288
NP_441463.1_3 Reverse -326 -345 -9.93197 0.287
NP_441463.1_6 Forward -314 -300 10.1846 0.242
NP_441626.1_2 Forward -344 -337 15.7721 0.0124
NP_441626.1_2 Reverse -337 -344 15.7721 0.0124
NP_441626.1_2 Forward -203 -196 12.2322 0.0511
NP_441626.1_2 Reverse -196 -203 5.93897 0.231
NP_441988.1_5 Forward -223 -204 10.3242 0.274
NP_442365.1_7 Reverse -191 -210 -4.81876 0.25
NP_442615.1_1 Forward -354 -336 -5.48739 0.215
NP_442467.1_4 Forward -345 -326 18.0924 0.0848
NP_441962.1_4 Forward -311 -292 -0.4922 0.117
NP_440387.1_1 Reverse -195 -211 3.99177 0.0487
NP_440387.1_1 Reverse -297 -313 2.12349 0.0871
NP_440387.1_1 Forward -345 -329 -1.71142 0.143
NP_441431.1_2 Reverse -333 -347 7.66879 0.237
NP_441431.1_2 Forward -348 -334 6.68548 0.263
NP_441431.1_2 Reverse -192 -206 5.50552 0.298
NP_440814.1_4 Forward -354 -335 -10.0303 0.221
NP_440114.1_10 Reverse -336 -350 17.4042 0.0104
NP_440114.1_10 Forward -345 -331 10.3243 0.148
NP_442090.1_2 Forward -392 -373 7.20922 0.281
NP_442323.1_7 Reverse -190 -209 9.24175 0.159
NP_442323.1_7 Reverse -331 -350 3.44025 0.242
NP_441510.2_7 Forward -210 -196 15.6336 0.28
NP_440766.1_4 Forward -208 -194 11.996 0.0581
NP_439988.1_3 Forward -203 -189 5.30946 0.287
NP_442743.1_4 Reverse -337 -356 -1.08219 0.187
NP_441133.1_1 Forward -345 -326 12.3892 0.269
NP_439910.1_2 Reverse -136 -153 -14.5141 0.183
NP_439910.1_2 Forward -270 -253 -22.0856 0.207
NP_442867.1_8 Forward -88 -69 5.99764 0.273
NP_440457.1_1 Forward -208 -196 10.5604 0.092
NP_440457.1_1 Forward -349 -337 9.08543 0.0967
NP_440457.1_1 Forward -316 -304 1.61227 0.232
NP_440457.1_1 Reverse -332 -344 0.727295 0.25
NP_440798.1_6 Forward -344 -331 10.5407 0.074
NP_440801.1_10 Forward -208 -189 6.58763 0.288
NP_440142.1_7 Forward -203 -184 7.27595 0.256
NP_441984.1_3 Reverse -332 -350 6.01734 0.276
NP_441332.1_6 Reverse -308 -318 11.3563 0.261
NP_441436.1_8 Forward -346 -327 10.1275 0.262
NP_440473.1_1 Reverse -192 -211 20.3196 0.0276
NP_442509.1_9 Reverse -336 -346 17.3841 0.00128
NP_442509.1_9 Forward -345 -335 8.04271 0.192
NP_441253.1_1 Reverse -327 -346 11.9958 0.202
NP_440554.1_4 Forward -344 -334 17.9746 0.0131
NP_440554.1_4 Reverse -196 -206 11.6814 0.0377
NP_440554.1_4 Forward -203 -193 10.3048 0.0552
NP_440554.1_4 Reverse -337 -347 8.82982 0.0646
NP_441885.1_5 Forward -345 -335 11.3864 0.00668
NP_441885.1_5 Reverse -336 -346 11.3864 0.00668
NP_441885.1_5 Forward -204 -194 7.84651 0.0419
NP_441428.1_8 Reverse -295 -314 8.65258 0.206
NP_442341.1_7 Forward -115 -101 6.98109 0.113
NP_442341.1_7 Reverse -102 -116 3.04785 0.237
NP_442341.1_9 Reverse -334 -348 12.2903 0.108
NP_441756.1_5 Forward -349 -330 1.96607 0.213
NP_441756.1_5 Forward -208 -189 -4.6221 0.295
NP_441173.1_9 Reverse -48 -56 13.2937 0.17
NP_442395.2_4 Reverse -68 -87 5.70185 0.155
NP_440191.1_4 Forward -86 -76 14.2146 0.266
NP_440423.1_6 Forward -353 -334 -14.2585 0.224
NP_443000.1_7 Reverse -334 -344 20.3345 0.00223
NP_443000.1_7 Forward -347 -337 11.6814 0.0344
NP_443000.1_7 Reverse -193 -203 9.81313 0.0431
NP_440076.1_5 Reverse -188 -207 13.0766 0.252
NP_441561.1_4 Reverse -35 -54 7.96426 0.209
NP_441842.1_10 Forward -211 -197 7.37441 0.258
NP_442122.1_9 Reverse -43 -62 20.4523 0.1
NP_440275.1_3 Forward -347 -337 16.9913 0.0133
NP_440275.1_3 Reverse -334 -344 16.1063 0.0155
NP_440275.1_3 Forward -206 -196 5.87989 0.13
NP_442451.1_2 Forward -353 -334 -8.06369 0.241
NP_442451.1_2 Forward -242 -223 -8.65367 0.252
NP_439962.1_4 Reverse -187 -206 -2.85214 0.241
NP_440149.1_8 Reverse -336 -355 -0.787193 0.154
NP_441875.1_7 Reverse -115 -125 15.713 0.227
NP_440216.1_1 Forward -345 -331 24.9757 0.000528
NP_440216.1_1 Reverse -336 -350 18.0925 0.000924
NP_440216.1_1 Forward -204 -190 -2.45868 0.0513
NP_440172.1_1 Forward -345 -335 17.5813 0.00421
NP_440172.1_1 Reverse -336 -346 16.303 0.00854
NP_440172.1_1 Forward -204 -194 10.1081 0.0551
NP_442371.1_1 Reverse -376 -386 12.8609 0.227
NP_442015.1_3 Reverse -185 -204 11.5033 0.288
NP_442015.1_3 Forward -308 -289 9.7334 0.296
NP_442015.1_10 Reverse -191 -204 3.95252 0.178
NP_442015.1_10 Reverse -332 -345 3.75586 0.178
NP_442015.1_10 Forward -349 -336 3.65753 0.178
NP_442015.1_10 Forward -208 -195 -0.177378 0.255
NP_441226.1_7 Forward -344 -337 14.4934 0.0123
NP_441226.1_7 Reverse -337 -344 14.4934 0.0123
NP_441226.1_7 Forward -203 -196 12.7234 0.0312
NP_441226.1_7 Reverse -196 -203 11.5435 0.0757
NP_442446.1_3 Reverse -291 -310 12.0942 0.233
NP_441111.1_7 Forward -344 -336 18.7023 0.00294
NP_441111.1_7 Reverse -337 -345 18.7023 0.00294
NP_441111.1_7 Reverse -196 -204 8.86921 0.0589
NP_442379.1_10 Reverse -329 -346 9.38028 0.0936
NP_441766.1_2 Forward -345 -336 17.5026 0.00297
NP_441766.1_2 Reverse -336 -345 17.5026 0.00297
NP_441766.1_2 Forward -204 -195 8.1612 0.0645
NP_441766.1_2 Reverse -195 -204 5.89959 0.103
NP_442417.1_5 Reverse -195 -209 19.8624 0.0165
NP_442417.1_5 Reverse -303 -317 4.52282 0.292
NP_442417.1_5 Forward -345 -331 4.52282 0.292
NP_440416.1_1 Forward -345 -326 -1.67217 0.116
NP_440416.1_9 Forward -211 -192 1.96607 0.0415
NP_440416.1_9 Reverse -329 -348 -4.6221 0.0783
NP_443052.1_8 Reverse -326 -345 -4.6221 0.119
NP_443052.1_8 Forward -319 -300 -13.0786 0.273
NP_442116.1_6 Reverse -358 -375 5.39969 0.299
NP_440591.1_9 Reverse -168 -186 12.0155 0.0935
NP_442154.1_1 Reverse -286 -304 -17.4838 0.257
NP_442154.1_1 Reverse -25 -43 -17.7788 0.267
NP_440261.1_5 Reverse -337 -350 16.5389 0.0105
NP_440261.1_5 Forward -344 -331 6.60746 0.0318
NP_440261.1_5 Reverse -235 -248 -6.56889 0.201
NP_440988.1_10 Reverse -295 -309 16.5164 0.112
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCCTTGTTTTTGCAATCTTTCCAGAATAATTTCAAAGCGATTCAGCACACTACGGGCGATCGCCTGGTGGTCGAAGGTGTTGACGAAGGGGGTGGCCACCACCACATAACCAGCTTTACCTAATTCCGTTAGTAACCAACGATAGGCCACATTGGGGGCCGTACCGACAAAAGCTCCCCCGAGAAAATGCACCACGGCGATCGGTTGGGGCGGCACTAGAACCCAACTGCCAGAAATTTCACGCCATTCCATCGAAGTTTATTTCCTCTACAAAAAACTTGCCCAGTGGATAACCACCGTTATTTTAACGATCTTTCCCCCTTTGGTCGGCGCTGTAACTGGCTTGGCAAAATCCCCGGCAACAGCTACCTTGGTTAGGATTGACCGGTAGATTGTGCT

CDS

GTGAGGAAATTTGTCATGGAATTTACGACCAAAACAGGGGGTTCCCTGCCGACAAACTTACGGGTTCTCCTCCCCTGGTTACAACTAATTGGTAAATCTAGTTTTTTCGGTTTAATTATTTCCCTGGCTTGGACTTTATCCGCCCAGGCGATGGAATTACGGGTTGCCATCAGTAAGGGTGTTAGTAATGTCGGAGTGGGCAGTTCCACCCCAGCCTTGGTGAAAAATGCCGGGGGAGCCACCATTGGCCGCTTAGATTCCCTTGTCCCCGCCAACGCCACTGCCTCCGGTCGCAACATTAACCTGGCTGGTATGCAGGCTTCCCAAATCACCATTGAACCTAGTGGAGACGGCCGCATTTGGATCGGCGATCGTTGGTATCGGGGCAAGGTGCGTCTAATCCGCCAAGGCAATGGGGTCAGCGCGGTTAATCTAGTGGATATTGAAGAGTATTTATACAGTGTGGTAGGTTCCGAAGCCATTCCCTCCTGGCCCCTGGAAGCCCTAAAAGCCCAAGCTGTAGCCGCCCGCACCTACGCCATCTATCAAACTAGCAAGGACAGTAACCGTTACTACGACCTGGACACCACCACGGCCACCCAGGTTTATAAGGGGATGAATAACGAATATGTCAGCACGGTGGAAGCAGTAGAAGCCACGGCGGGCCAGGTAATGACCTACAACGGCAAGGTGATTTTGGCTGCGTTCCATGCCGCCTCTGGGGGCCATACGGAAAATGTTGAAGACGTATGGATGTCGCCCCTGCCCTATCTACGGGGAGTGGTGGATTATGACCAAAGTTCGCCGGTGTTTAGCTGGAACCAAACCTTCAGTAACCGTGATTTGAGCCGACACATTGGGGGCATTGGCACTGTTACCGGTTTAACCCCTCTCAAAGTTACTCCCAGGGGTCGCATTGCTTCCATTCAAGTCAATGGCACCGGGGGGCGCAAAACTTTAACTGGCAATGCCATTCGTCAGGCATTAAAACTCCGGAGCACTCTGTTCACTGTGTCGAGAAATGGCGATAATTTCACCATTACAGGCCGTGGTTCTGGCCATGGCATTGGCCTAAGTCAGTGGGGAGCCTACGGTCTAGCCCAAAAAGGTACCCCCTACCAACAAATTTTGTCCCATTATTACCAGTCCGCCAGCCTCACCCAGTTAAATCGTTAG

Protein

MRKFVMEFTTKTGGSLPTNLRVLLPWLQLIGKSSFFGLIISLAWTLSAQAMELRVAISKGVSNVGVGSSTPALVKNAGGATIGRLDSLVPANATASGRNINLAGMQASQITIEPSGDGRIWIGDRWYRGKVRLIRQGNGVSAVNLVDIEEYLYSVVGSEAIPSWPLEALKAQAVAARTYAIYQTSKDSNRYYDLDTTTATQVYKGMNNEYVSTVEAVEATAGQVMTYNGKVILAAFHAASGGHTENVEDVWMSPLPYLRGVVDYDQSSPVFSWNQTFSNRDLSRHIGGIGTVTGLTPLKVTPRGRIASIQVNGTGGRKTLTGNAIRQALKLRSTLFTVSRNGDNFTITGRGSGHGIGLSQWGAYGLAQKGTPYQQILSHYYQSASLTQLNR