Your browser is old and dusty. Try Google Chrome!

Details for sll1280

ORF sll1280
Accession NP_440889.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -214 -207 14.6904 0.0123
NP_440795.1_7 Reverse -207 -214 14.6904 0.0123
NP_441418.1_6 Reverse -253 -272 -0.885524 0.0111
NP_441418.1_6 Forward -215 -196 -20.8467 0.129
NP_440815.1_2 Forward -148 -134 11.7003 0.262
NP_442291.1_5 Reverse -205 -221 -0.531451 0.185
NP_440897.1_6 Reverse -206 -225 9.53674 0.0705
NP_441453.1_4 Reverse -206 -214 16.539 0.00633
NP_441453.1_4 Forward -215 -207 16.539 0.00633
NP_441623.1_1 Reverse -187 -205 8.57394 0.108
NP_441623.1_1 Reverse -258 -276 -2.53746 0.241
NP_442151.1_6 Reverse -206 -220 11.111 0.108
NP_440226.1_1 Forward -215 -196 12.9791 0.0397
NP_440259.1_4 Forward -131 -117 12.2029 0.255
NP_442655.1_1 Reverse -201 -220 17.5024 0.0229
NP_442173.1_1 Forward -214 -206 15.4574 0.00633
NP_442173.1_1 Reverse -207 -215 15.4574 0.00633
NP_442752.1_4 Forward -215 -208 13.8055 0.0199
NP_442752.1_4 Reverse -206 -213 13.8055 0.0199
NP_443027.1_4 Forward -217 -207 13.2547 0.0521
NP_443027.1_4 Reverse -204 -214 11.8781 0.0872
NP_441812.1_3 Reverse -142 -156 8.55439 0.251
NP_442975.1_10 Reverse -202 -216 4.91554 0.234
NP_442975.1_10 Forward -219 -205 3.34225 0.259
NP_440784.1_7 Forward -214 -207 15.9687 0.0123
NP_440784.1_7 Reverse -207 -214 15.9687 0.0123
NP_440061.1_9 Forward -217 -203 11.307 0.114
NP_440061.1_9 Reverse -204 -218 10.2254 0.126
NP_440110.1_4 Forward -226 -207 8.06259 0.134
NP_440110.1_8 Reverse -251 -270 -1.47551 0.241
NP_440878.1_9 Reverse -196 -215 -0.590531 0.218
NP_442062.1_8 Forward -215 -205 19.4496 0.000558
NP_442062.1_8 Reverse -206 -216 10.3048 0.0493
NP_440304.1_4 Forward -217 -207 10.8948 0.051
NP_440304.1_4 Reverse -204 -214 1.84832 0.299
NP_442242.1_4 Forward -214 -207 14.3954 0.0124
NP_442242.1_4 Reverse -207 -214 14.3954 0.0124
NP_441200.1_4 Reverse -213 -232 9.3409 0.237
NP_441594.1_6 Reverse -37 -56 3.14605 0.236
NP_441594.1_6 Forward -280 -261 2.85105 0.242
NP_442276.1_2 Forward -74 -55 2.26107 0.299
NP_442110.1_7 Reverse -206 -220 3.8345 0.21
NP_442110.1_7 Forward -245 -231 0.88457 0.245
NP_440014.1_6 Reverse -197 -216 8.55425 0.254
NP_440014.1_7 Reverse -256 -270 18.0918 0.119
NP_440856.1_4 Reverse -199 -218 1.17943 0.16
NP_440856.1_7 Forward -274 -255 -2.26216 0.191
NP_441083.1_5 Forward -215 -205 11.3864 0.0159
NP_441083.1_5 Reverse -206 -216 11.2881 0.0159
NP_441738.1_2 Forward -213 -206 15.28 0.0102
NP_441738.1_2 Reverse -208 -215 15.28 0.0102
NP_441558.1_5 Reverse -204 -223 4.52268 0.28
NP_440209.1_1 Reverse -206 -214 18.1123 0.00295
NP_440209.1_1 Forward -215 -207 18.1123 0.00295
NP_442889.1_8 Reverse -237 -251 3.63724 0.273
NP_441713.1_1 Reverse -200 -219 -14.0619 0.257
NP_441770.1_4 Reverse -260 -279 -5.21209 0.204
NP_442706.1_5 Reverse -170 -189 13.9204 0.245
NP_442111.1_4 Reverse -205 -219 12.4876 0.043
NP_442111.1_4 Forward -216 -202 9.73436 0.0587
NP_441163.1_1 Forward -210 -193 9.5762 0.225
NP_440906.1_5 Forward -214 -207 15.8704 0.0124
NP_440906.1_5 Reverse -207 -214 15.8704 0.0124
NP_440747.1_10 Reverse -203 -215 17.0502 0.000794
NP_440747.1_10 Forward -218 -206 7.31547 0.00577
NP_441130.1_10 Reverse -204 -218 8.45605 0.135
NP_442973.1_5 Forward -224 -205 12.4875 0.206
NP_442634.1_4 Forward -217 -203 7.86607 0.0479
NP_442634.1_4 Reverse -204 -218 -1.5737 0.149
NP_442634.1_4 Reverse -260 -274 -5.50694 0.258
NP_441265.1_3 Reverse -200 -214 0.294584 0.25
NP_441014.1_10 Reverse -252 -271 5.11187 0.194
NP_442848.1_5 Forward -43 -25 -3.52077 0.293
NP_443018.1_3 Forward -214 -207 14.8871 0.0123
NP_443018.1_3 Reverse -207 -214 14.8871 0.0123
NP_441316.1_7 Reverse -24 -39 -2.77337 0.273
NP_441634.1_8 Forward -334 -320 -1.96703 0.295
NP_441634.1_8 Forward -217 -203 -2.85201 0.295
NP_441634.1_9 Forward -233 -214 8.75009 0.294
NP_440376.1_1 Forward -215 -206 19.4693 0.000692
NP_440376.1_1 Reverse -206 -215 19.4693 0.000692
NP_442687.1_7 Reverse -205 -215 15.8113 0.0125
NP_442687.1_7 Forward -216 -206 9.02648 0.0994
NP_440642.1_7 Forward -277 -258 14.3558 0.287
NP_441013.1_2 Reverse -201 -219 -2.14413 0.282
NP_441422.1_7 Reverse -204 -221 -3.79607 0.235
NP_440533.1_6 Reverse -63 -82 7.27595 0.297
NP_441950.1_5 Reverse -228 -247 16.3861 0.222
NP_442658.1_1 Reverse -204 -214 17.0891 0.00615
NP_442658.1_1 Forward -217 -207 14.2375 0.0237
NP_442658.1_1 Forward -42 -32 6.56775 0.224
NP_440141.1_8 Forward -211 -192 6.88262 0.252
NP_441855.2_4 Forward -99 -80 13.2829 0.172
NP_442782.1_2 Forward -215 -201 8.16106 0.198
NP_441414.1_9 Reverse -206 -225 -1.27885 0.0996
NP_441414.1_9 Forward -29 -10 -4.6221 0.158
NP_440800.1_1 Forward -377 -358 14.2566 0.24
NP_441958.1_5 Forward -216 -206 21.2195 0.000805
NP_441958.1_5 Reverse -205 -215 12.2714 0.00183
NP_440203.1_5 Forward -38 -28 10.0093 0.242
NP_439905.1_1 Reverse -207 -220 8.37742 0.234
NP_440984.1_7 Reverse -201 -215 15.9292 0.0487
NP_440984.1_7 Forward -220 -206 11.996 0.122
NP_439990.1_5 Forward -220 -207 10.344 0.128
NP_442690.1_1 Forward -128 -109 -3.24547 0.142
NP_442911.1_2 Reverse -196 -215 -2.45882 0.0982
NP_440153.1_5 Reverse -207 -221 13.8643 0.0551
NP_440153.1_5 Forward -214 -200 3.73617 0.205
NP_440153.1_8 Reverse -53 -66 4.34585 0.202
NP_440369.1_5 Reverse -66 -85 7.86593 0.297
NP_442064.1_4 Forward -238 -219 8.4551 0.232
NP_443055.1_6 Forward -285 -267 0.903388 0.238
NP_443055.1_6 Reverse -245 -263 -0.964891 0.271
NP_440993.1_2 Forward -220 -204 5.27008 0.237
NP_441099.1_5 Forward -225 -206 -9.14533 0.214
NP_441099.1_5 Forward -39 -20 -10.1286 0.243
NP_442002.1_9 Reverse -205 -212 10.7572 0.185
NP_442567.1_4 Forward -281 -262 9.14423 0.29
NP_442438.1_10 Reverse -201 -215 4.52282 0.146
NP_441000.1_6 Forward -216 -202 6.09611 0.0933
NP_441000.1_6 Reverse -205 -219 -4.03198 0.225
NP_440147.1_4 Reverse -204 -217 17.0305 0.00838
NP_440147.1_4 Forward -217 -204 16.6372 0.00999
NP_441295.1_4 Forward -220 -201 -1.57384 0.29
NP_441550.1_8 Forward -217 -207 15.8108 0.0132
NP_441550.1_8 Reverse -204 -214 8.82935 0.112
NP_441916.1_7 Reverse -206 -216 18.9579 0.00144
NP_441916.1_7 Forward -215 -205 18.4663 0.00144
NP_441041.1_7 Reverse -203 -215 14.6087 0.0342
NP_441041.1_7 Forward -218 -206 7.22324 0.171
NP_441725.1_4 Forward -220 -206 12.487 0.0693
NP_441725.1_5 Reverse -194 -204 3.51995 0.115
NP_441725.1_5 Forward -214 -204 2.04498 0.115
NP_441725.1_5 Reverse -207 -217 1.94665 0.115
NP_439966.1_7 Reverse -204 -214 17.9741 0.00631
NP_439966.1_7 Forward -217 -207 14.3359 0.0203
NP_439966.1_9 Reverse -204 -213 0.884706 0.253
NP_442941.1_3 Reverse -207 -217 19.2529 0.00262
NP_442941.1_3 Forward -214 -204 10.7964 0.0116
NP_440289.1_2 Reverse -203 -216 4.34585 0.0673
NP_440289.1_2 Forward -218 -205 -3.52063 0.267
NP_440983.1_5 Forward -34 -15 -6.39206 0.276
NP_440260.1_8 Reverse -258 -276 -2.43913 0.243
NP_442281.1_1 Reverse -201 -215 19.7634 0.00247
NP_442281.1_1 Forward -220 -206 7.76712 0.0927
NP_442256.1_2 Reverse -204 -222 -7.94566 0.216
NP_440647.1_9 Reverse -204 -222 7.59063 0.219
NP_440723.1_4 Forward -265 -246 -10.522 0.284
NP_442982.1_5 Forward -281 -262 -2.85214 0.289
NP_441644.1_6 Reverse -206 -216 19.0557 0.000803
NP_441644.1_6 Forward -215 -205 10.1076 0.0628
NP_440867.1_10 Reverse -52 -71 1.67108 0.293
NP_442215.1_2 Forward -78 -62 -6.03799 0.263
NP_442029.1_6 Forward -220 -201 5.211 0.255
NP_440253.1_2 Forward -215 -197 -2.14413 0.261
NP_440929.1_8 Forward -215 -206 19.2726 0.000701
NP_440929.1_8 Reverse -206 -215 19.2726 0.000701
NP_440566.1_2 Forward -290 -271 10.2259 0.172
NP_442933.1_10 Forward -215 -206 17.601 0.00325
NP_442933.1_10 Reverse -206 -215 17.601 0.00325
NP_441751.2_8 Reverse -207 -221 -1.8687 0.132
NP_442926.1_1 Reverse -250 -269 -4.72043 0.278
NP_442554.1_8 Reverse -207 -217 17.2863 0.00543
NP_442554.1_8 Forward -214 -204 14.1397 0.0144
NP_441762.1_7 Forward -216 -204 3.08724 0.0676
NP_441762.1_7 Reverse -205 -217 2.30059 0.0676
NP_442313.1_3 Forward -119 -100 8.75091 0.224
NP_442142.1_4 Reverse -203 -216 15.7516 0.0264
NP_442142.1_4 Forward -218 -205 6.21356 0.17
NP_442142.1_4 Forward -265 -252 4.73861 0.212
NP_442142.1_4 Forward -274 -261 4.34528 0.223
NP_442292.1_1 Reverse -207 -216 17.5026 0.00435
NP_442292.1_1 Forward -214 -205 9.63616 0.0183
NP_442476.1_6 Forward -214 -200 12.7826 0.0457
NP_443009.1_5 Forward -216 -205 19.626 0.00102
NP_443009.1_5 Reverse -205 -216 7.82632 0.118
NP_442301.1_2 Forward -281 -262 10.9134 0.179
NP_441715.1_4 Forward -214 -204 18.8596 0.00741
NP_441715.1_4 Reverse -207 -217 16.7946 0.0106
NP_440183.1_9 Forward -269 -250 -20.7484 0.292
NP_441198.1_5 Reverse -101 -114 12.7034 0.216
NP_440379.1_5 Forward -271 -252 -9.63698 0.264
NP_441468.1_1 Forward -214 -207 15.8704 0.0124
NP_441468.1_1 Reverse -207 -214 15.8704 0.0124
NP_441673.1_1 Forward -215 -206 20.8459 0.000698
NP_441673.1_1 Reverse -206 -215 20.8459 0.000698
NP_441876.1_9 Reverse -272 -282 10.206 0.299
NP_441826.1_2 Reverse -187 -201 0.196253 0.194
NP_441826.1_2 Forward -221 -207 -0.787057 0.224
NP_441826.1_2 Forward -246 -232 -4.03198 0.291
NP_441826.1_2 Reverse -200 -214 -4.32697 0.295
NP_441330.1_1 Reverse -201 -220 -3.14714 0.0791
NP_441330.1_1 Forward -220 -201 -3.54046 0.0811
NP_442063.1_9 Forward -122 -103 3.6377 0.267
NP_442868.1_6 Forward -217 -207 10.4031 0.038
NP_442868.1_6 Reverse -204 -214 10.3048 0.038
NP_442719.1_2 Forward -49 -31 -2.43985 0.186
NP_442719.1_2 Forward -125 -107 -10.0113 0.268
NP_441612.1_2 Forward -277 -267 10.8728 0.21
NP_442227.1_2 Forward -247 -228 3.6377 0.216
NP_442427.1_5 Reverse -59 -78 1.67108 0.286
NP_442808.1_1 Reverse -205 -215 18.4657 0.00201
NP_442808.1_1 Forward -216 -206 8.73102 0.0481
NP_441101.1_5 Reverse -267 -285 14.6591 0.284
NP_442630.1_1 Reverse -247 -266 11.2092 0.202
NP_442820.1_2 Forward -103 -84 17.2359 0.183
NP_442542.1_2 Reverse -204 -217 6.90245 0.201
NP_442050.1_1 Reverse -66 -85 8.16093 0.253
NP_442050.1_5 Forward -217 -207 15.9091 0.0091
NP_442050.1_5 Reverse -204 -214 6.96107 0.27
NP_440334.1_2 Forward -145 -132 15.3589 0.215
NP_440558.1_2 Forward -280 -261 -6.49039 0.275
NP_440558.1_2 Reverse -28 -47 -7.27704 0.291
NP_441878.1_6 Forward -216 -206 10.5014 0.0176
NP_441878.1_6 Reverse -205 -215 10.4031 0.0176
NP_441878.1_6 Forward -63 -53 -0.118297 0.167
NP_441036.1_8 Reverse -205 -215 17.7779 0.000554
NP_441036.1_8 Forward -216 -206 15.713 0.00724
NP_441557.1_5 Forward -215 -206 19.9609 0.000699
NP_441557.1_5 Reverse -206 -215 19.9609 0.000699
NP_442066.2_4 Reverse -206 -225 2.94938 0.125
NP_442066.2_9 Forward -219 -206 12.3107 0.154
NP_442419.1_2 Forward -220 -201 -2.0655 0.246
NP_441739.1_2 Forward -126 -110 2.02449 0.288
NP_440101.1_3 Reverse -201 -220 3.73603 0.224
NP_442192.1_7 Forward -205 -187 16.7354 0.194
NP_442170.1_5 Reverse -206 -225 -2.0655 0.254
NP_442347.1_2 Forward -214 -205 11.1111 0.056
NP_442347.1_2 Forward -248 -239 3.83464 0.284
NP_442347.1_2 Reverse -207 -216 3.34298 0.284
NP_442645.1_2 Forward -223 -204 -14.6519 0.177
NP_442888.1_6 Reverse -42 -61 2.94938 0.244
NP_441037.1_4 Forward -217 -207 7.22024 0.237
NP_441037.1_4 Reverse -204 -214 6.92787 0.237
NP_441633.1_3 Reverse -204 -217 5.62415 0.0481
NP_441633.1_3 Forward -217 -204 3.65753 0.0699
NP_440136.1_2 Forward -214 -207 15.9687 0.0123
NP_440136.1_2 Reverse -207 -214 15.9687 0.0123
NP_442590.1_10 Forward -75 -56 8.06259 0.215
NP_442998.1_10 Forward -213 -206 15.5754 0.0102
NP_442998.1_10 Reverse -208 -215 15.5754 0.0102
NP_440899.1_8 Forward -135 -116 -1.67217 0.212
NP_440299.1_1 Forward -219 -206 11.5234 0.0484
NP_440299.1_1 Reverse -202 -215 8.47516 0.0926
NP_441799.1_1 Reverse -202 -216 12.8803 0.0385
NP_441799.1_1 Forward -219 -205 8.45543 0.114
NP_441007.1_10 Forward -220 -207 1.00259 0.209
NP_442334.1_2 Forward -65 -48 -6.746 0.264
NP_442201.1_10 Forward -226 -207 -6.49039 0.184
NP_440256.1_1 Forward -218 -199 8.75091 0.0223
NP_440256.1_1 Reverse -203 -222 3.53937 0.0518
NP_440256.1_1 Forward -111 -92 -10.0303 0.293
NP_441957.1_10 Reverse -218 -237 13.2741 0.263
NP_441559.1_8 Reverse -201 -215 2.75286 0.143
NP_441559.1_8 Forward -220 -206 2.06454 0.148
NP_440915.1_6 Reverse -202 -216 11.996 0.023
NP_440915.1_6 Forward -219 -205 10.3243 0.0322
NP_442785.1_7 Forward -217 -203 10.521 0.228
NP_441464.1_8 Forward -276 -262 5.01447 0.26
NP_441939.1_3 Reverse -207 -226 11.4058 0.112
NP_441199.1_6 Reverse -202 -221 0.884433 0.23
NP_442386.1_9 Reverse -205 -214 15.7322 0.0144
NP_442386.1_9 Forward -216 -207 6.39082 0.219
NP_442386.1_10 Forward -196 -183 10.4424 0.217
NP_441340.1_5 Forward -214 -207 15.6737 0.0124
NP_441340.1_5 Reverse -207 -214 15.6737 0.0124
NP_441340.1_9 Reverse -115 -125 7.00193 0.297
NP_442186.1_9 Reverse -177 -196 5.30933 0.247
NP_442327.1_3 Reverse -96 -115 5.0129 0.281
NP_442484.1_2 Reverse -195 -214 4.32602 0.187
NP_440327.1_6 Forward -81 -62 3.04771 0.285
NP_442240.1_1 Reverse -257 -276 4.42355 0.273
NP_442240.1_2 Reverse -207 -226 -10.522 0.137
NP_440161.1_3 Forward -217 -198 9.83255 0.237
NP_440586.1_8 Forward -214 -207 13.2151 0.026
NP_440586.1_8 Reverse -207 -214 13.2151 0.026
NP_442251.1_6 Forward -214 -207 15.2804 0.0124
NP_442251.1_6 Reverse -207 -214 15.2804 0.0124
NP_440192.1_4 Reverse -29 -48 11.0469 0.224
NP_442959.1_5 Forward -178 -159 4.81767 0.299
NP_441262.1_3 Reverse -206 -213 14.7888 0.0223
NP_441262.1_3 Forward -215 -208 14.7888 0.0223
NP_440027.1_3 Reverse -53 -71 6.01657 0.23
NP_440027.1_8 Reverse -203 -222 17.6982 0.127
NP_443051.1_1 Forward -216 -207 19.5676 0.00335
NP_443051.1_1 Reverse -205 -214 10.4228 0.00754
NP_439937.1_9 Reverse -192 -209 -13.6298 0.287
NP_439937.1_9 Forward -216 -199 -16.2847 0.287
NP_440926.1_9 Forward -233 -214 14.1591 0.167
NP_440439.1_1 Reverse -203 -216 17.1289 0.0108
NP_440439.1_1 Forward -218 -205 10.8357 0.0339
NP_440372.1_2 Forward -214 -207 16.3621 0.0124
NP_440372.1_2 Reverse -207 -214 16.3621 0.0124
NP_440316.1_10 Reverse -58 -68 5.5849 0.291
NP_439977.1_5 Reverse -200 -219 -1.96717 0.266
NP_440139.1_1 Forward -274 -255 2.9486 0.219
NP_441572.1_7 Forward -221 -202 6.88262 0.0785
NP_441572.1_7 Reverse -200 -219 -0.688862 0.182
NP_440267.1_2 Reverse -201 -215 11.2087 0.125
NP_442384.1_10 Reverse -206 -219 19.1938 0.00338
NP_442384.1_10 Forward -215 -202 10.2457 0.0465
NP_442384.1_10 Forward -75 -62 2.37923 0.228
NP_442114.1_4 Forward -215 -204 9.20345 0.17
NP_442790.1_4 Reverse -197 -216 -7.27704 0.152
NP_442790.1_4 Forward -224 -205 -12.3902 0.246
NP_442262.1_10 Forward -214 -207 14.1988 0.0123
NP_442262.1_10 Reverse -207 -214 14.1988 0.0123
NP_441689.1_5 Forward -217 -207 8.3377 0.132
NP_440344.1_10 Forward -269 -252 -3.79607 0.0876
NP_440282.1_2 Reverse -47 -66 5.50599 0.295
NP_441965.1_10 Forward -218 -202 9.59664 0.117
NP_441640.1_9 Forward -188 -169 10.2259 0.287
NP_442693.1_6 Forward -277 -258 3.04771 0.278
NP_440297.1_9 Forward -214 -204 -0.118297 0.282
NP_440297.1_9 Reverse -207 -217 -0.216628 0.282
NP_440350.1_5 Forward -175 -156 -3.44213 0.26
NP_442280.1_10 Reverse -133 -151 7.20763 0.268
NP_441592.1_4 Reverse -206 -225 0.982764 0.225
NP_440700.1_10 Forward -119 -100 18.9633 0.216
NP_440999.1_9 Reverse -202 -216 7.86607 0.082
NP_440888.1_2 Reverse -206 -220 18.5835 0.00223
NP_440888.1_2 Forward -215 -201 14.2569 0.0193
NP_440491.1_1 Reverse -203 -222 9.06107 0.219
NP_440491.1_1 Forward -277 -258 8.86616 0.226
NP_440052.1_5 Forward -226 -207 -4.52377 0.259
NP_439969.1_3 Forward -220 -201 -1.18052 0.271
NP_442277.1_4 Forward -224 -205 2.55527 0.243
NP_442277.1_4 Reverse -197 -216 1.08032 0.286
NP_441543.1_2 Forward -214 -205 18.486 0.00236
NP_441543.1_2 Reverse -207 -216 15.9293 0.00518
NP_442845.1_2 Forward -221 -207 6.98109 0.199
NP_441551.1_5 Reverse -202 -218 5.85938 0.293
NP_442710.1_1 Forward -273 -254 5.89931 0.297
NP_441469.1_8 Reverse -205 -214 16.126 0.00797
NP_441469.1_8 Forward -203 -194 8.1612 0.227
NP_441469.1_8 Forward -216 -207 6.5879 0.227
NP_443064.1_6 Reverse -206 -216 10.8217 0.13
NP_442578.1_7 Forward -214 -207 14.5921 0.026
NP_442578.1_7 Reverse -207 -214 14.5921 0.026
NP_440710.1_1 Forward -223 -205 -8.14232 0.257
NP_442286.1_1 Reverse -267 -286 7.57094 0.285
NP_441462.1_2 Reverse -206 -216 20.2362 0.000805
NP_441462.1_2 Forward -215 -205 11.5831 0.00406
NP_441621.1_7 Forward -217 -203 -3.24533 0.188
NP_441621.1_7 Reverse -204 -218 -5.50694 0.254
NP_443062.1_1 Forward -215 -197 7.57085 0.172
NP_443062.1_1 Reverse -206 -224 4.84065 0.247
NP_440889.1_2 Forward -35 -16 23.0089 0.0137
NP_440889.1_4 Forward -266 -247 18.9773 0.0332
NP_440889.1_6 Forward -333 -314 17.109 0.177
NP_440277.1_4 Forward -284 -265 12.3892 0.275
NP_441410.1_3 Reverse -197 -216 9.73422 0.191
NP_442204.1_1 Forward -219 -208 11.6617 0.0565
NP_442204.1_1 Reverse -202 -213 1.82863 0.266
NP_442204.1_5 Reverse -16 -35 -0.4922 0.289
NP_440516.1_2 Reverse -200 -218 -2.43913 0.299
NP_440516.1_8 Forward -215 -206 16.9127 0.00442
NP_440516.1_8 Reverse -206 -215 16.9127 0.00442
NP_440516.1_8 Forward -196 -187 -0.393597 0.255
NP_442428.1_5 Forward -214 -207 15.8704 0.0124
NP_442428.1_5 Reverse -207 -214 15.8704 0.0124
NP_442120.1_10 Reverse -40 -59 -16.3235 0.3
NP_440673.1_2 Reverse -273 -292 10.4871 0.207
NP_440673.1_3 Forward -213 -206 12.4288 0.0426
NP_440673.1_3 Reverse -208 -215 12.4288 0.0426
NP_441052.1_2 Forward -215 -205 10.5014 0.0285
NP_441052.1_2 Reverse -206 -216 10.4031 0.0285
NP_441052.1_2 Forward -262 -252 4.60159 0.154
NP_441052.1_2 Forward -292 -282 4.50326 0.157
NP_442219.1_9 Forward -214 -205 8.35786 0.0681
NP_442219.1_9 Reverse -207 -216 8.25953 0.0681
NP_440436.1_4 Forward -214 -205 18.1905 0.00233
NP_440436.1_4 Reverse -207 -216 9.24241 0.0871
NP_440314.1_9 Reverse -207 -226 -2.0655 0.146
NP_440648.1_1 Reverse -206 -225 5.80098 0.21
NP_441086.1_3 Forward -190 -171 19.0152 0.0485
NP_441719.1_4 Forward -214 -207 16.3621 0.0124
NP_441719.1_4 Reverse -207 -214 16.3621 0.0124
NP_441733.1_10 Forward -218 -205 5.52582 0.213
NP_441004.1_1 Forward -208 -189 -8.26035 0.2
NP_441004.1_1 Forward -221 -202 -8.55534 0.2
NP_441004.1_1 Forward -81 -62 -16.8151 0.287
NP_441004.1_2 Forward -51 -32 -4.52377 0.291
NP_442366.1_3 Reverse -205 -223 6.50899 0.0776
NP_442366.1_3 Forward -216 -198 -2.93078 0.235
NP_442366.1_5 Reverse -250 -260 10.4026 0.271
NP_440296.1_10 Reverse -203 -222 -8.26035 0.248
NP_441115.1_2 Forward -118 -99 7.76679 0.252
NP_441115.1_4 Reverse -205 -223 14.5713 0.0532
NP_441115.1_4 Forward -216 -198 7.98318 0.266
NP_442694.1_4 Forward -189 -180 13.5694 0.225
NP_440328.1_4 Forward -221 -202 7.86593 0.117
NP_442740.1_4 Reverse -153 -167 18.6825 0.169
NP_443054.1_2 Forward -217 -203 1.17956 0.251
NP_440864.1_9 Forward -80 -61 4.22769 0.119
NP_441851.1_10 Reverse -205 -215 16.008 0.00552
NP_441851.1_10 Forward -216 -206 8.53483 0.114
NP_442622.1_8 Forward -249 -231 -18.9587 0.293
NP_441273.1_1 Forward -47 -28 15.8307 0.171
NP_442515.1_1 Reverse -205 -219 -4.13031 0.298
NP_442689.1_8 Forward -124 -107 -5.95935 0.279
NP_441349.1_10 Reverse -196 -215 0.786102 0.0864
NP_441349.1_10 Forward -225 -206 -9.93197 0.3
NP_441409.1_6 Reverse -20 -39 -7.37537 0.149
NP_442314.1_5 Reverse -259 -278 8.45592 0.288
NP_440432.1_9 Reverse -207 -222 4.1098 0.0764
NP_440432.1_9 Forward -214 -199 -3.65835 0.187
NP_439960.1_10 Forward -222 -204 -4.79907 0.297
NP_440588.1_2 Forward -224 -205 8.84924 0.0446
NP_440588.1_2 Reverse -197 -216 -1.67217 0.156
NP_440588.1_2 Forward -249 -230 -5.50708 0.252
NP_441003.1_9 Forward -85 -66 4.62101 0.277
NP_441078.1_4 Forward -215 -206 19.6659 0.0007
NP_441078.1_4 Reverse -206 -215 19.6659 0.0007
NP_441663.1_8 Forward -221 -202 -0.885524 0.233
NP_442443.1_1 Reverse -260 -279 4.916 0.157
NP_442443.1_1 Forward -210 -191 -2.95047 0.264
NP_441432.1_8 Forward -216 -207 16.8143 0.00595
NP_441432.1_8 Reverse -205 -214 8.25953 0.0755
NP_442320.1_8 Reverse -200 -214 6.19444 0.029
NP_442320.1_8 Forward -221 -207 -3.54032 0.124
NP_442320.1_8 Forward -202 -188 -5.70361 0.245
NP_441732.1_2 Forward -219 -203 -15.2811 0.145
NP_440760.1_1 Reverse -206 -225 -4.32711 0.0417
NP_442510.1_2 Forward -207 -188 15.5357 0.2
NP_442400.1_10 Forward -155 -142 7.51014 0.284
NP_442489.1_7 Forward -215 -206 20.1576 0.000695
NP_442489.1_7 Reverse -206 -215 20.1576 0.000695
NP_440559.1_1 Forward -214 -205 8.75118 0.0586
NP_440559.1_1 Reverse -207 -216 8.65285 0.0586
NP_441659.2_8 Reverse -206 -216 20.9245 0.000805
NP_441659.2_8 Forward -215 -205 11.9764 0.0147
NP_442913.1_9 Forward -221 -202 7.07928 0.289
NP_441040.1_2 Forward -77 -58 -11.9969 0.255
NP_442346.1_5 Forward -216 -206 16.303 0.00248
NP_442346.1_5 Reverse -205 -215 9.02648 0.118
NP_442346.1_5 Forward -63 -53 4.60159 0.281
NP_440352.1_5 Reverse -208 -227 11.6824 0.254
NP_440545.1_3 Reverse -202 -219 -2.51776 0.187
NP_440545.1_3 Forward -219 -202 -3.30441 0.203
NP_441856.1_3 Forward -218 -199 -0.983855 0.228
NP_441923.1_9 Reverse -63 -82 18.0924 0.0971
NP_440459.1_2 Reverse -204 -221 8.7903 0.249
NP_442551.1_4 Forward -279 -264 -2.97003 0.278
NP_441168.1_10 Reverse -29 -48 15.6341 0.0486
NP_442603.1_7 Reverse -206 -220 11.5037 0.115
NP_441888.1_7 Reverse -201 -215 3.8345 0.225
NP_441888.1_7 Forward -220 -206 3.14618 0.225
NP_440449.1_6 Forward -223 -205 7.96405 0.206
NP_441948.1_4 Reverse -199 -217 2.67408 0.121
NP_441833.1_4 Forward -214 -207 15.9687 0.0124
NP_441833.1_4 Reverse -207 -214 15.9687 0.0124
NP_440890.1_8 Reverse -299 -318 28.4171 0.000017
NP_440890.1_10 Reverse -374 -393 22.1239 0.0401
NP_442436.1_3 Forward -169 -150 13.3716 0.234
NP_442162.1_9 Forward -214 -207 16.2637 0.0124
NP_442162.1_9 Reverse -207 -214 16.2637 0.0124
NP_443015.1_5 Reverse -259 -278 12.9791 0.258
NP_440671.1_4 Reverse -200 -214 7.57108 0.214
NP_440671.1_4 Forward -202 -188 6.09611 0.261
NP_442199.1_5 Reverse -198 -217 -1.96717 0.184
NP_442140.1_3 Forward -214 -204 14.238 0.0486
NP_442140.1_3 Reverse -207 -217 4.69992 0.238
NP_441609.1_1 Forward -125 -106 9.83255 0.117
NP_441609.1_1 Reverse -109 -128 -2.55715 0.29
NP_441671.1_10 Forward -207 -188 2.55606 0.249
NP_440875.1_9 Forward -213 -203 17.327 0.0126
NP_440875.1_9 Reverse -208 -218 7.69067 0.255
NP_441813.1_5 Reverse -204 -214 19.4496 0.00647
NP_441813.1_5 Forward -217 -207 18.1713 0.00743
NP_440590.1_4 Reverse -207 -220 11.1307 0.0221
NP_440590.1_4 Forward -214 -201 3.65753 0.0702
NP_440567.1_1 Reverse -207 -221 4.62115 0.116
NP_440567.1_1 Forward -214 -200 3.14618 0.151
NP_442497.1_10 Reverse -207 -216 17.601 0.00813
NP_442497.1_10 Forward -214 -205 10.4228 0.0087
NP_440821.1_4 Reverse -204 -214 10.2065 0.0163
NP_440821.1_4 Forward -217 -207 2.24165 0.131
NP_441239.1_9 Forward -217 -205 15.5753 0.0186
NP_441239.1_9 Reverse -204 -216 14.1986 0.0288
NP_440665.1_1 Reverse -253 -272 -16.2252 0.282
NP_440219.1_4 Reverse -79 -92 15.3436 0.255
NP_441541.1_1 Reverse -163 -181 -4.9636 0.291
NP_440833.1_6 Reverse -244 -258 9.14375 0.265
NP_441526.1_6 Reverse -23 -42 4.03102 0.271
NP_440354.1_7 Forward -221 -203 5.91901 0.296
NP_440546.1_4 Reverse -206 -216 13.5365 0.0459
NP_440546.1_4 Forward -215 -205 11.8882 0.0679
NP_440462.1_6 Forward -217 -207 18.7612 0.00454
NP_440462.1_6 Reverse -204 -214 17.2863 0.00752
NP_440868.1_4 Reverse -202 -214 17.3452 0.0124
NP_440868.1_4 Forward -219 -207 0.923956 0.196
NP_442479.1_9 Reverse -168 -187 -7.76869 0.266
NP_440812.1_2 Forward -231 -212 9.3409 0.249
NP_442402.1_4 Forward -132 -113 -6.88445 0.267
NP_442402.1_10 Forward -124 -114 14.2375 0.182
NP_441848.1_4 Reverse -109 -125 8.60108 0.288
NP_441084.1_6 Forward -64 -50 9.34412 0.287
NP_440653.1_10 Forward -291 -272 7.96426 0.201
NP_442039.1_4 Forward -214 -207 15.1821 0.0124
NP_442039.1_4 Reverse -207 -214 15.1821 0.0124
NP_442039.1_4 Forward -195 -188 8.69224 0.172
NP_442039.1_4 Forward -107 -100 7.02061 0.269
NP_441926.1_3 Reverse -206 -222 14.5132 0.0449
NP_440825.1_7 Forward -184 -174 12.5193 0.155
NP_442837.1_3 Forward -214 -207 15.7721 0.0124
NP_442837.1_3 Reverse -207 -214 15.7721 0.0124
NP_440160.1_2 Forward -277 -258 0.786102 0.217
NP_440160.1_3 Forward -271 -252 8.16011 0.284
NP_442053.1_1 Forward -215 -206 18.3876 0.0007
NP_442053.1_1 Reverse -206 -215 18.3876 0.0007
NP_442053.1_1 Reverse -187 -196 3.63797 0.298
NP_440505.1_3 Forward -217 -207 17.188 0.00332
NP_440505.1_3 Reverse -204 -214 15.9097 0.00857
NP_441102.1_2 Forward -146 -127 5.01433 0.298
NP_441203.1_1 Reverse -207 -226 -14.8485 0.205
NP_441203.1_1 Forward -214 -195 -19.5684 0.297
NP_442532.1_4 Reverse -108 -126 10.9706 0.25
NP_442532.1_4 Reverse -119 -137 7.67406 0.296
NP_440914.1_1 Reverse -206 -216 16.3248 0.00196
NP_440914.1_1 Forward -215 -205 8.6151 0.186
NP_440914.1_1 Forward -40 -30 8.51751 0.186
NP_440914.1_1 Reverse -180 -190 7.93196 0.214
NP_441011.1_8 Forward -214 -205 16.9127 0.00602
NP_441011.1_8 Reverse -207 -216 16.6177 0.00602
NP_442533.1_6 Forward -215 -206 17.2076 0.00137
NP_442533.1_6 Reverse -206 -215 17.2076 0.00137
NP_442322.1_4 Forward -95 -78 -8.61494 0.286
NP_441482.1_7 Forward -221 -207 5.1128 0.0417
NP_441482.1_7 Reverse -93 -107 -8.8502 0.193
NP_441482.1_7 Reverse -200 -214 -10.4235 0.209
NP_441482.1_7 Reverse -53 -67 -11.5051 0.268
NP_441108.1_2 Reverse -171 -190 7.66927 0.245
NP_439944.1_9 Reverse -207 -217 9.12481 0.1
NP_441028.1_6 Reverse -272 -282 3.71617 0.281
NP_442202.1_6 Reverse -170 -189 -0.0988766 0.265
NP_440116.1_5 Reverse -203 -220 3.38209 0.233
NP_440115.1_6 Reverse -203 -213 7.64985 0.146
NP_440115.1_6 Forward -218 -208 4.79825 0.282
NP_440007.1_4 Reverse -195 -214 8.94757 0.28
NP_439965.1_1 Reverse -197 -216 -0.590531 0.157
NP_441106.1_1 Forward -216 -207 18.486 0.0028
NP_441106.1_1 Reverse -205 -214 18.191 0.0028
NP_442306.1_10 Forward -220 -201 -19.3717 0.197
NP_441286.1_1 Forward -216 -204 -3.40261 0.145
NP_441286.1_1 Reverse -205 -217 -3.59927 0.145
NP_441286.1_1 Forward -197 -185 -5.86088 0.229
NP_442674.1_2 Forward -121 -102 9.53756 0.216
NP_440670.1_8 Forward -215 -206 18.3876 0.000699
NP_440670.1_8 Reverse -206 -215 18.3876 0.000699
NP_440886.1_7 Reverse -205 -215 17.7774 0.0011
NP_440886.1_7 Forward -216 -206 8.04271 0.0805
NP_441001.1_10 Reverse -258 -277 5.211 0.292
NP_440767.1_2 Forward -294 -275 -2.95047 0.269
NP_442072.1_9 Reverse -205 -223 -3.42244 0.0355
NP_441403.1_4 Forward -248 -230 7.00065 0.282
NP_440907.2_8 Reverse -207 -217 9.616 0.103
NP_440907.2_8 Forward -214 -204 7.94438 0.117
NP_441021.1_1 Reverse -207 -226 -7.96535 0.192
NP_440841.1_4 Forward -217 -198 -6.68705 0.215
NP_442459.1_7 Forward -254 -235 7.57094 0.197
NP_441463.1_3 Reverse -196 -215 -8.06369 0.264
NP_441463.1_3 Reverse -242 -261 -9.73531 0.284
NP_442842.1_4 Forward -201 -182 4.32602 0.249
NP_441626.1_2 Forward -214 -207 15.7721 0.0124
NP_441626.1_2 Reverse -207 -214 15.7721 0.0124
NP_442794.1_1 Forward -219 -207 7.70879 0.132
NP_442794.1_5 Reverse -203 -217 14.8476 0.275
NP_442615.1_1 Reverse -197 -215 5.72234 0.0374
NP_442615.1_1 Forward -224 -206 -2.83245 0.151
NP_441962.1_9 Forward -81 -62 7.27595 0.258
NP_440387.1_1 Reverse -206 -222 9.59664 0.0266
NP_440387.1_1 Reverse -262 -278 -6.43131 0.285
NP_441431.1_2 Reverse -203 -217 10.9137 0.15
NP_441431.1_3 Forward -268 -249 2.85105 0.281
NP_441488.1_8 Reverse -278 -292 8.84875 0.172
NP_441488.1_8 Forward -220 -206 6.88214 0.289
NP_441993.1_1 Forward -221 -202 11.8873 0.106
NP_441993.1_1 Forward -202 -183 3.01872 0.244
NP_440114.1_10 Reverse -206 -220 7.17775 0.243
NP_440114.1_10 Forward -215 -201 6.98109 0.25
NP_442698.1_10 Forward -290 -271 0.294447 0.297
NP_440293.1_9 Forward -81 -67 9.89475 0.285
NP_439988.1_3 Forward -244 -230 8.25939 0.263
NP_440422.1_10 Forward -188 -169 14.7609 0.147
NP_439910.1_2 Reverse -198 -215 -22.0856 0.207
NP_440457.1_1 Forward -219 -207 6.43049 0.121
NP_440457.1_1 Reverse -202 -214 0.628964 0.25
NP_440798.1_6 Forward -214 -201 12.409 0.0468
NP_441981.1_9 Forward -187 -173 15.7325 0.293
NP_442561.1_9 Reverse -207 -226 16.9115 0.252
NP_441984.1_3 Reverse -175 -193 5.72234 0.278
NP_442509.1_9 Forward -215 -205 16.2041 0.00739
NP_442509.1_9 Reverse -206 -216 8.04271 0.192
NP_443037.1_2 Reverse -103 -122 18.823 0.0293
NP_440524.1_3 Reverse -22 -41 9.93088 0.275
NP_440734.1_9 Forward -277 -258 10.3242 0.281
NP_440554.1_4 Reverse -207 -217 17.9746 0.0131
NP_440554.1_4 Forward -214 -204 16.4996 0.0189
NP_442862.1_3 Reverse -110 -127 5.74204 0.268
NP_441885.1_5 Forward -215 -205 11.4848 0.00668
NP_441885.1_5 Reverse -206 -216 11.3864 0.00668
NP_440478.1_4 Forward -219 -200 10.3242 0.285
NP_440478.1_10 Reverse -204 -218 13.6676 0.127
NP_442341.1_7 Reverse -205 -219 2.94952 0.239
NP_442341.1_9 Forward -217 -203 5.30886 0.274
NP_441756.1_5 Reverse -202 -221 4.22769 0.199
NP_441756.1_5 Reverse -259 -278 -4.52377 0.295
NP_441173.1_9 Forward -122 -114 14.3753 0.161
NP_441173.1_9 Reverse -173 -181 11.0321 0.228
NP_441173.1_9 Forward -121 -113 10.2454 0.261
NP_442395.2_4 Forward -216 -197 5.89851 0.152
NP_442395.2_4 Reverse -205 -224 2.35861 0.223
NP_440750.1_5 Reverse -119 -133 4.91614 0.294
NP_443000.1_7 Forward -217 -207 20.3345 0.00223
NP_443000.1_7 Reverse -204 -214 11.5831 0.0344
NP_440275.1_3 Forward -217 -207 16.1063 0.0155
NP_440275.1_3 Reverse -204 -214 15.418 0.0178
NP_440091.1_1 Reverse -202 -214 1.41561 0.197
NP_440679.1_10 Reverse -261 -280 -18.9784 0.279
NP_441359.1_5 Reverse -203 -222 4.32602 0.225
NP_442451.1_2 Forward -210 -191 -11.3086 0.291
NP_439962.1_4 Forward -223 -204 -4.13045 0.267
NP_440175.1_7 Reverse -258 -276 8.77756 0.288
NP_440149.1_10 Reverse -206 -225 -6.58872 0.255
NP_441105.1_3 Forward -226 -207 4.71934 0.0765
NP_441105.1_3 Reverse -195 -214 -4.52377 0.201
NP_440216.1_1 Forward -215 -201 25.2707 0.000528
NP_440216.1_1 Reverse -206 -220 16.8142 0.00213
NP_440172.1_1 Reverse -206 -216 17.5813 0.00421
NP_440172.1_1 Forward -215 -205 8.73149 0.0586
NP_440172.1_3 Forward -108 -89 10.1275 0.287
NP_440249.1_2 Reverse -244 -254 15.7125 0.268
NP_440249.1_2 Reverse -105 -115 15.3192 0.268
NP_442015.1_10 Reverse -202 -215 11.7207 0.0372
NP_442015.1_10 Forward -219 -206 4.8375 0.159
NP_442015.1_10 Reverse -62 -75 1.10092 0.213
NP_441226.1_7 Forward -214 -207 14.4934 0.0123
NP_441226.1_7 Reverse -207 -214 14.4934 0.0123
NP_441111.1_7 Forward -214 -206 18.7023 0.00294
NP_441111.1_7 Reverse -207 -215 18.7023 0.00294
NP_441766.1_2 Forward -215 -206 17.5026 0.00297
NP_441766.1_2 Reverse -206 -215 17.5026 0.00297
NP_441766.1_2 Reverse -99 -108 1.57302 0.282
NP_442417.1_5 Reverse -206 -220 15.4376 0.0547
NP_442417.1_5 Forward -215 -201 6.98109 0.197
NP_442417.1_5 Reverse -253 -267 4.71948 0.291
NP_440416.1_9 Reverse -199 -218 -5.01543 0.0791
NP_440416.1_9 Forward -222 -203 -8.55534 0.117
NP_443052.1_8 Forward -287 -268 -11.2103 0.224
NP_442116.1_6 Reverse -109 -126 6.06813 0.287
NP_442226.1_1 Reverse -114 -133 18.9773 0.187
NP_440261.1_5 Forward -214 -201 6.70579 0.0318
NP_440261.1_5 Reverse -207 -220 -2.63565 0.0924
NP_440261.1_7 Reverse -211 -230 3.34271 0.148
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGACCATGTAAGTTTTAAGTCCTAATCCCTTAGTCTCCGTTTAGTGAATATGCGTGCCTCCTGTTACTTACCGTACAAGCCAGGATACAGACTCTCAATTATACAGTACGCGTTGGACAAAGGGGGCAAGACCACCACCGGGATGGACAATTTTGAGCGCCGTCTTCGGGCCGACTTTAGCCTCAGGCGATCGCCGGGTGAAATGGCGCTTGGGCTTTGTTTGCAAAATTCTTAGTTTGTCTCCTAAATTTCAAGACAAAGGGAGAGTTTTCTCTAACTTTTCCCAAAATTTAGAGATTGGGTGAGTTGCTCAAACCCGCCCTTTGATGTTGCCCGGGGGCCCTGGTTAATAGTTGCTGCCACAATGCCCTCCCGCTCAGAAAACAATAGAATTTGAACA

CDS

GTGAAGTTAGGCCGAATTTTAAAAATGTCAGAATTCATGAGCAACTCCATTCCCCTGGTGGGATTAAAGGCAGACCATTTCCGCCATCCTTTGGACCAAATGGCCACCACCAACTTGAAGCAAATTCCCGGCCTAGACCTGATGGTGCGGGGACTGTTGGGCTCCGTGGCAGAACAGTTTTTTGCCCTCAATAATTTGGCGGCCAGTGTCCGGGTGGGAGAAAAACAATTACCCCATCTTCATCAACTGCTTTTGGATGCTTGCAAAATTCTCGACCTGGAAGCGCCGGAACTCTACATTCAACAAAATCCCCAACCCAATGCCTACACTTTTGCCATGCGAGGTAAAAAGCCTTTCATGGTGATGCACACTTCCCTGGTGGATATGTTGACTCCGGCGGAAATTCAAGCGGTGATGGCCCATGAGTTGGGACACCTCAAATGTGAACATGGGGTGTATTTAACCCTGGCTAACATTATGGTCTTAGCAGCGGGGCTAATTCCCAACTGGGGAGCAGTGTTGACCCAATCCCTCCAGTCCCAGATGTTGGAGTGGGTGCGCTGTGCTGAATTTAGCTGTGACCGGGCAGCCCTGTTGGCGGTGCAAGACCCGAAAGTGGTGATGTCGGTGCTGATGAAGTTGGCCGGTGGTTCTCCCCAATTGGCTCCTTTACTAAACTTGGATGCTTTCATTGACCAAGCCCGGGAATACGATCGCCTGGGGGAAGATGAAATGGGGGCAATGCTGAGGAATATGCAGACCCAAAACCTGACCCATCCGGTGCCGGTACTCCGGGCCAGGGAAATTGATCGTTGGAGTGATTCCCAAACCTATCAAAACTTGCTCAAGGGCCGCAAAAATGCGTATAATCTGAACACCGAAGAAAACAAGGGCGGCTGGCGGAATTGGTAG

Protein

MKLGRILKMSEFMSNSIPLVGLKADHFRHPLDQMATTNLKQIPGLDLMVRGLLGSVAEQFFALNNLAASVRVGEKQLPHLHQLLLDACKILDLEAPELYIQQNPQPNAYTFAMRGKKPFMVMHTSLVDMLTPAEIQAVMAHELGHLKCEHGVYLTLANIMVLAAGLIPNWGAVLTQSLQSQMLEWVRCAEFSCDRAALLAVQDPKVVMSVLMKLAGGSPQLAPLLNLDAFIDQAREYDRLGEDEMGAMLRNMQTQNLTHPVPVLRAREIDRWSDSQTYQNLLKGRKNAYNLNTEENKGGWRNW