Your browser is old and dusty. Try Google Chrome!

Details for sll1274

ORF sll1274
Accession NP_440896.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -119 -105 17.5025 0.0786
NP_440795.1_7 Forward -118 -111 14.6904 0.0123
NP_440795.1_7 Reverse -111 -118 14.6904 0.0123
NP_441418.1_6 Forward -119 -100 -28.6149 0.206
NP_442291.1_5 Reverse -109 -125 -3.97304 0.261
NP_440295.1_9 Forward -53 -34 -3.14714 0.216
NP_440897.1_6 Forward -119 -100 20.5498 0.0208
NP_441453.1_4 Reverse -110 -118 16.539 0.00633
NP_441453.1_4 Forward -119 -111 16.539 0.00633
NP_442151.1_6 Reverse -110 -124 9.43936 0.148
NP_441818.1_9 Reverse -262 -281 -9.047 0.287
NP_440120.1_4 Forward -110 -96 13.5693 0.29
NP_442655.1_1 Reverse -105 -124 7.27595 0.115
NP_442173.1_1 Forward -118 -110 15.4574 0.00633
NP_442173.1_1 Reverse -111 -119 15.4574 0.00633
NP_442752.1_4 Forward -119 -112 13.8055 0.0199
NP_442752.1_4 Reverse -110 -117 13.8055 0.0199
NP_443027.1_4 Reverse -108 -118 11.8781 0.0872
NP_443027.1_4 Reverse -50 -60 9.02648 0.18
NP_443027.1_4 Forward -121 -111 7.25653 0.24
NP_442975.1_10 Forward -123 -109 10.9137 0.0516
NP_442975.1_10 Reverse -106 -120 5.21053 0.228
NP_441675.1_4 Forward -104 -85 4.62101 0.254
NP_440784.1_7 Forward -118 -111 15.9687 0.0123
NP_440784.1_7 Reverse -111 -118 15.9687 0.0123
NP_441934.1_7 Reverse -237 -256 15.2408 0.296
NP_440061.1_9 Forward -121 -107 10.422 0.124
NP_440878.1_9 Reverse -100 -119 -3.24547 0.29
NP_442062.1_8 Forward -119 -109 19.4496 0.000558
NP_442062.1_8 Reverse -110 -120 10.3048 0.0493
NP_440761.1_4 Forward -124 -105 -13.5702 0.257
NP_440304.1_4 Forward -121 -111 10.8948 0.051
NP_440304.1_4 Reverse -108 -118 1.84832 0.299
NP_442242.1_4 Forward -118 -111 14.3954 0.0124
NP_442242.1_4 Reverse -111 -118 14.3954 0.0124
NP_440044.1_8 Reverse -111 -130 20.7473 0.0139
NP_442602.1_3 Reverse -18 -37 -3.83545 0.289
NP_441619.1_8 Forward -125 -111 13.2736 0.115
NP_441208.1_9 Forward -122 -108 12.1926 0.141
NP_442110.1_7 Forward -119 -105 3.34284 0.21
NP_442110.1_7 Reverse -110 -124 2.75286 0.222
NP_441925.1_2 Forward -237 -218 0.196116 0.295
NP_441925.1_4 Reverse -28 -47 -11.801 0.253
NP_440769.1_8 Reverse -285 -304 7.96426 0.248
NP_440856.1_4 Reverse -103 -122 -1.57384 0.202
NP_441083.1_5 Forward -119 -109 11.3864 0.0159
NP_441083.1_5 Reverse -110 -120 11.2881 0.0159
NP_441738.1_2 Forward -117 -110 15.28 0.0102
NP_441738.1_2 Reverse -112 -119 15.28 0.0102
NP_441738.1_2 Forward -327 -320 8.29857 0.176
NP_441738.1_2 Forward -59 -52 6.03696 0.295
NP_441738.1_4 Forward -129 -110 4.916 0.209
NP_440209.1_1 Reverse -110 -118 18.1123 0.00295
NP_440209.1_1 Forward -119 -111 18.1123 0.00295
NP_442889.1_8 Reverse -107 -121 5.30886 0.231
NP_441713.1_1 Reverse -104 -123 -6.49039 0.12
NP_440178.1_7 Reverse -109 -128 -22.5183 0.267
NP_442111.1_4 Forward -120 -106 19.1741 0.00447
NP_442111.1_4 Reverse -109 -123 2.2612 0.283
NP_441831.1_5 Forward -95 -76 18.6823 0.0572
NP_440851.1_3 Reverse -286 -305 2.3594 0.248
NP_440906.1_5 Forward -118 -111 15.8704 0.0124
NP_440906.1_5 Reverse -111 -118 15.8704 0.0124
NP_440747.1_10 Reverse -107 -119 17.0502 0.000794
NP_440747.1_10 Forward -122 -110 5.54551 0.0128
NP_441130.1_10 Reverse -108 -122 7.86607 0.146
NP_442973.1_5 Forward -128 -109 15.0441 0.122
NP_442973.1_5 Reverse -101 -120 10.7175 0.27
NP_441486.1_1 Forward -122 -108 4.42448 0.0446
NP_441486.1_1 Reverse -107 -121 -2.95034 0.175
NP_440944.1_2 Forward -144 -125 4.81767 0.199
NP_442634.1_4 Forward -121 -107 -1.5737 0.149
NP_442634.1_4 Reverse -108 -122 -1.67204 0.149
NP_441265.1_3 Reverse -104 -118 1.57289 0.2
NP_440403.1_4 Forward -128 -109 -6.39206 0.231
NP_442848.1_1 Forward -125 -111 7.07942 0.0791
NP_442848.1_9 Reverse -12 -31 4.81767 0.202
NP_442848.1_9 Forward -125 -106 3.6377 0.218
NP_442848.1_9 Reverse -258 -277 2.94938 0.245
NP_443018.1_3 Forward -118 -111 14.8871 0.0123
NP_443018.1_3 Reverse -111 -118 14.8871 0.0123
NP_441316.1_7 Forward -140 -125 -3.75668 0.291
NP_441634.1_8 Reverse -108 -122 -4.52363 0.295
NP_440376.1_1 Forward -119 -110 19.4693 0.000692
NP_440376.1_1 Reverse -110 -119 19.4693 0.000692
NP_440376.1_1 Forward -273 -264 4.81794 0.149
NP_441588.1_4 Reverse -112 -122 16.2046 0.0369
NP_442687.1_7 Reverse -109 -119 15.8113 0.0125
NP_442687.1_7 Forward -120 -110 9.02648 0.0994
NP_442687.1_7 Reverse -263 -273 5.28991 0.211
NP_440642.1_10 Reverse -59 -73 5.60385 0.241
NP_441013.1_2 Forward -350 -332 0.609134 0.254
NP_441013.1_2 Reverse -105 -123 -1.16082 0.282
NP_441422.1_7 Reverse -108 -125 -2.22277 0.21
NP_441422.1_7 Forward -22 -5 -2.22277 0.21
NP_441950.1_7 Reverse -252 -271 -1.86883 0.201
NP_441950.1_8 Forward -40 -26 7.07942 0.209
NP_442658.1_1 Reverse -108 -118 17.0891 0.00615
NP_442658.1_1 Forward -121 -111 13.0576 0.04
NP_442198.1_7 Reverse -368 -387 8.4551 0.292
NP_442782.1_2 Forward -119 -105 7.47274 0.202
NP_440656.1_8 Forward -130 -111 -7.76869 0.264
NP_441414.1_9 Forward -119 -100 -5.31042 0.174
NP_441487.1_9 Forward -274 -255 -2.75381 0.293
NP_442937.1_5 Reverse -378 -397 5.99764 0.293
NP_441958.1_5 Forward -120 -110 21.2195 0.000805
NP_441958.1_5 Reverse -109 -119 12.2714 0.00183
NP_441127.1_1 Reverse -18 -32 9.5377 0.272
NP_440950.1_8 Forward -79 -60 8.95116 0.3
NP_440203.1_5 Forward -326 -316 9.71433 0.245
NP_440203.1_5 Forward -327 -317 8.63269 0.29
NP_440984.1_7 Reverse -105 -119 9.93102 0.126
NP_441162.1_3 Forward -355 -336 7.96426 0.275
NP_439990.1_5 Forward -124 -111 6.90245 0.22
NP_442911.1_2 Reverse -100 -119 -3.24547 0.11
NP_440153.1_5 Forward -118 -104 4.03116 0.199
NP_440153.1_5 Reverse -111 -125 2.06454 0.239
NP_442064.1_4 Reverse -100 -119 5.40686 0.269
NP_443055.1_6 Forward -290 -272 0.903388 0.238
NP_440993.1_2 Forward -124 -108 2.61514 0.263
NP_440993.1_3 Reverse -100 -119 -0.886293 0.273
NP_440471.1_6 Forward -20 -1 17.3057 0.195
NP_442002.1_9 Reverse -109 -116 10.7572 0.185
NP_441294.1_7 Forward -123 -109 8.57871 0.294
NP_441646.1_1 Forward -37 -18 2.0644 0.221
NP_442438.1_10 Reverse -105 -119 11.111 0.0463
NP_442431.1_10 Reverse -259 -277 0.805796 0.266
NP_441000.1_6 Forward -120 -106 -2.36035 0.216
NP_441000.1_6 Reverse -109 -123 -4.91696 0.254
NP_440147.1_4 Forward -121 -108 19.2922 0.00305
NP_440147.1_4 Reverse -108 -121 9.45906 0.0401
NP_441550.1_8 Forward -121 -111 15.3192 0.0132
NP_441550.1_8 Reverse -108 -118 8.82935 0.112
NP_441916.1_7 Reverse -110 -120 18.9579 0.00144
NP_441916.1_7 Forward -119 -109 18.4663 0.00144
NP_441916.1_7 Forward -273 -263 3.22496 0.223
NP_440465.1_10 Reverse -255 -274 4.12936 0.236
NP_441041.1_7 Forward -122 -110 17.7184 0.00706
NP_441041.1_7 Reverse -107 -119 14.6087 0.0342
NP_441041.1_7 Forward -332 -320 8.58373 0.133
NP_442642.1_9 Forward -126 -109 7.11867 0.192
NP_440174.1_2 Reverse -375 -394 12.7825 0.257
NP_441725.1_4 Reverse -105 -119 4.42388 0.278
NP_441725.1_4 Forward -124 -110 3.73557 0.278
NP_441725.1_5 Forward -118 -108 2.04498 0.115
NP_441725.1_5 Reverse -111 -121 1.94665 0.115
NP_441725.1_5 Reverse -130 -140 -0.806614 0.271
NP_439966.1_7 Reverse -108 -118 17.9741 0.00631
NP_439966.1_7 Forward -121 -111 6.27276 0.185
NP_439966.1_9 Reverse -108 -117 0.884706 0.253
NP_440202.1_8 Forward -281 -262 10.5844 0.297
NP_442941.1_3 Reverse -111 -121 11.0914 0.0116
NP_442941.1_3 Forward -118 -108 10.7964 0.0116
NP_440289.1_2 Reverse -107 -120 4.34585 0.0673
NP_440289.1_2 Forward -122 -109 -2.04567 0.251
NP_440289.1_2 Forward -276 -263 -4.79893 0.294
NP_442281.1_1 Reverse -105 -119 19.3701 0.00282
NP_442281.1_1 Forward -124 -110 18.1901 0.00483
NP_441079.1_7 Reverse -230 -249 1.17865 0.18
NP_441079.1_7 Forward -249 -230 -3.54122 0.238
NP_442256.1_2 Reverse -108 -126 -9.0273 0.247
NP_442012.1_1 Forward -125 -106 0.491109 0.237
NP_442012.1_1 Reverse -104 -123 -1.08219 0.274
NP_441087.1_6 Reverse -89 -107 1.39504 0.258
NP_441556.1_10 Reverse -105 -119 12.0712 0.2
NP_442982.1_5 Reverse -310 -329 -1.37718 0.266
NP_441644.1_6 Reverse -110 -120 19.0557 0.000803
NP_441644.1_6 Forward -119 -109 10.1076 0.0628
NP_442215.1_2 Forward -121 -105 0.746852 0.148
NP_442215.1_2 Reverse -108 -124 0.255197 0.154
NP_442215.1_2 Reverse -346 -362 -7.41462 0.294
NP_440253.1_2 Reverse -110 -128 -0.964162 0.227
NP_440253.1_2 Forward -119 -101 -1.84914 0.252
NP_440929.1_8 Forward -119 -110 19.2726 0.000701
NP_440929.1_8 Reverse -110 -119 19.2726 0.000701
NP_442933.1_10 Forward -119 -110 17.601 0.00325
NP_442933.1_10 Reverse -110 -119 17.601 0.00325
NP_441751.2_8 Reverse -111 -125 -3.147 0.134
NP_442554.1_8 Reverse -111 -121 16.4013 0.0065
NP_442554.1_8 Forward -118 -108 14.1397 0.0144
NP_441762.1_7 Reverse -109 -121 9.47875 0.0142
NP_441762.1_7 Forward -120 -108 3.08724 0.0676
NP_442142.1_4 Reverse -107 -120 15.7516 0.0264
NP_442142.1_4 Forward -122 -109 12.9 0.0406
NP_442292.1_1 Reverse -111 -120 17.5026 0.00435
NP_442292.1_1 Forward -118 -109 9.63616 0.0183
NP_442476.1_5 Reverse -178 -197 12.0942 0.256
NP_442476.1_6 Forward -118 -104 12.8809 0.0454
NP_441523.1_6 Forward -123 -104 2.26107 0.297
NP_443009.1_5 Forward -120 -109 19.626 0.00102
NP_443009.1_5 Reverse -109 -120 7.82632 0.118
NP_441715.1_4 Forward -118 -108 18.8596 0.00741
NP_441715.1_4 Reverse -111 -121 7.35486 0.108
NP_441198.1_5 Reverse -112 -125 12.4084 0.228
NP_441198.1_8 Forward -121 -111 12.783 0.116
NP_440379.1_5 Reverse -264 -283 2.3594 0.15
NP_440379.1_5 Reverse -345 -364 -0.0988766 0.182
NP_441468.1_1 Forward -118 -111 15.8704 0.0124
NP_441468.1_1 Reverse -111 -118 15.8704 0.0124
NP_441020.2_6 Reverse -108 -125 6.92201 0.249
NP_441020.2_6 Forward -121 -104 5.74204 0.291
NP_441015.1_10 Forward -124 -105 -2.55715 0.178
NP_441673.1_1 Forward -119 -110 20.8459 0.000698
NP_441673.1_1 Reverse -110 -119 20.8459 0.000698
NP_441673.1_1 Forward -273 -264 -7.86675 0.187
NP_441673.1_1 Reverse -264 -273 -7.96508 0.206
NP_441876.1_9 Forward -231 -221 11.2876 0.278
NP_441876.1_9 Reverse -332 -342 10.9926 0.28
NP_441826.1_2 Reverse -104 -118 5.01447 0.0978
NP_441826.1_2 Forward -125 -111 2.85119 0.119
NP_441330.1_1 Reverse -105 -124 -12.4886 0.183
NP_441764.1_8 Reverse -226 -236 11.5978 0.284
NP_442868.1_6 Reverse -108 -118 10.3048 0.038
NP_442868.1_6 Forward -121 -111 0.963343 0.205
NP_440785.1_2 Forward -138 -119 7.07928 0.223
NP_441612.1_2 Forward -108 -98 8.83972 0.21
NP_442361.1_3 Forward -125 -112 12.704 0.179
NP_442808.1_1 Reverse -109 -119 18.4657 0.00201
NP_442808.1_1 Forward -120 -110 8.73102 0.0481
NP_440145.1_3 Forward -129 -110 6.29264 0.0532
NP_442050.1_5 Forward -121 -111 9.22267 0.193
NP_442050.1_5 Reverse -108 -118 6.96107 0.27
NP_442342.1_9 Reverse -108 -124 9.20332 0.17
NP_440385.1_9 Forward -316 -297 17.5024 0.285
NP_442789.1_4 Reverse -16 -35 -3.83545 0.254
NP_440274.1_2 Reverse -138 -152 12.3887 0.236
NP_441878.1_4 Reverse -346 -365 5.70265 0.271
NP_441878.1_6 Forward -120 -110 10.5014 0.0176
NP_441878.1_6 Reverse -109 -119 10.4031 0.0176
NP_441878.1_6 Reverse -263 -273 0.865012 0.132
NP_441878.1_6 Forward -274 -264 -7.00147 0.201
NP_441878.1_6 Forward -139 -129 -7.78811 0.266
NP_441036.1_8 Reverse -109 -119 17.7779 0.000554
NP_441036.1_8 Forward -120 -110 15.713 0.00724
NP_442503.1_9 Forward -358 -339 10.2259 0.199
NP_441557.1_5 Forward -119 -110 19.9609 0.000699
NP_441557.1_5 Reverse -110 -119 19.9609 0.000699
NP_442066.2_4 Forward -119 -100 0.0977854 0.172
NP_440101.1_3 Reverse -105 -124 0.982764 0.287
NP_441458.1_10 Forward -128 -109 4.42435 0.23
NP_442183.1_1 Reverse -110 -124 11.5043 0.0702
NP_442347.1_2 Forward -118 -109 11.1111 0.056
NP_442347.1_2 Reverse -111 -120 3.34298 0.284
NP_442645.1_2 Reverse -256 -275 -3.44213 0.0487
NP_442645.1_2 Forward -127 -108 -22.125 0.29
NP_440547.1_1 Reverse -189 -208 7.86512 0.28
NP_442888.1_8 Reverse -49 -68 12.8808 0.179
NP_441037.1_4 Forward -121 -111 15.0168 0.028
NP_441037.1_4 Reverse -108 -118 6.92787 0.237
NP_441633.1_3 Reverse -108 -121 5.62415 0.0481
NP_441633.1_3 Forward -121 -108 1.39592 0.109
NP_440136.1_2 Forward -118 -111 15.9687 0.0123
NP_440136.1_2 Reverse -111 -118 15.9687 0.0123
NP_442998.1_10 Forward -117 -110 15.5754 0.0102
NP_442998.1_10 Reverse -112 -119 15.5754 0.0102
NP_440299.1_1 Reverse -106 -119 18.1116 0.00453
NP_440299.1_1 Forward -123 -110 4.93527 0.193
NP_441799.1_1 Forward -123 -109 10.717 0.0683
NP_441799.1_1 Reverse -106 -120 6.29216 0.176
NP_441007.1_10 Forward -124 -111 2.2809 0.193
NP_442201.1_10 Reverse -263 -282 -13.8652 0.278
NP_442201.1_10 Forward -130 -111 -14.0619 0.28
NP_440256.1_1 Forward -122 -103 16.3224 0.0061
NP_440256.1_1 Reverse -107 -126 8.45592 0.0235
NP_441229.1_10 Forward -129 -110 -5.21209 0.293
NP_440709.1_1 Forward -309 -290 4.22689 0.205
NP_441559.1_8 Reverse -105 -119 12.1926 0.0574
NP_441559.1_8 Forward -124 -110 -7.57189 0.295
NP_440915.1_6 Reverse -106 -120 21.5341 0.00393
NP_440915.1_6 Forward -123 -109 4.42448 0.0953
NP_442866.1_1 Reverse -105 -124 -7.4737 0.266
NP_441464.1_8 Forward -270 -256 9.14437 0.192
NP_441939.1_3 Reverse -53 -72 6.68596 0.227
NP_441494.1_6 Forward -41 -28 10.7374 0.225
NP_442993.1_1 Forward -37 -21 -13.6095 0.293
NP_442386.1_9 Reverse -109 -118 15.7322 0.0144
NP_442386.1_9 Forward -120 -111 6.39082 0.219
NP_441340.1_5 Forward -118 -111 15.6737 0.0124
NP_441340.1_5 Reverse -111 -118 15.6737 0.0124
NP_441340.1_9 Reverse -227 -237 16.0642 0.194
NP_442791.1_5 Forward -127 -108 -11.7019 0.29
NP_442240.1_2 Forward -118 -99 -11.3086 0.137
NP_442240.1_2 Reverse -111 -130 -19.9617 0.295
NP_440161.1_3 Reverse -108 -127 8.25926 0.273
NP_442950.1_6 Reverse -257 -276 12.2908 0.103
NP_440586.1_8 Forward -118 -111 13.2151 0.026
NP_440586.1_8 Reverse -111 -118 13.2151 0.026
NP_442251.1_6 Forward -118 -111 15.2804 0.0124
NP_442251.1_6 Reverse -111 -118 15.2804 0.0124
NP_441262.1_3 Reverse -110 -117 14.7888 0.0223
NP_441262.1_3 Forward -119 -112 14.7888 0.0223
NP_443051.1_1 Forward -120 -111 19.5676 0.00335
NP_443051.1_1 Reverse -109 -118 10.4228 0.00754
NP_439937.1_9 Forward -120 -103 -8.41828 0.176
NP_441740.2_5 Reverse -83 -102 17.8957 0.147
NP_440439.1_1 Reverse -107 -120 17.1289 0.0108
NP_440439.1_1 Forward -122 -109 2.08423 0.138
NP_439943.1_1 Reverse -54 -73 -8.85033 0.28
NP_440372.1_2 Forward -118 -111 16.3621 0.0124
NP_440372.1_2 Reverse -111 -118 16.3621 0.0124
NP_441181.1_6 Reverse -241 -259 8.57394 0.219
NP_440819.1_5 Forward -108 -100 7.68924 0.266
NP_441803.1_2 Reverse -105 -124 1.17943 0.238
NP_439977.1_5 Reverse -104 -123 5.211 0.15
NP_439977.1_5 Forward -215 -196 -1.27885 0.245
NP_440589.1_3 Reverse -68 -87 2.26107 0.281
NP_441572.1_7 Reverse -104 -123 6.68596 0.0785
NP_442887.1_5 Reverse -128 -147 -5.9004 0.264
NP_442384.1_10 Forward -119 -106 19.1938 0.00338
NP_442384.1_10 Reverse -110 -123 8.08242 0.0692
NP_442384.1_10 Forward -99 -86 5.82081 0.118
NP_442114.1_4 Forward -119 -108 9.20345 0.17
NP_441018.1_7 Forward -123 -104 8.55425 0.242
NP_442790.1_4 Reverse -101 -120 -6.78538 0.146
NP_442262.1_10 Forward -118 -111 14.1988 0.0123
NP_442262.1_10 Reverse -111 -118 14.1988 0.0123
NP_441689.1_5 Forward -121 -111 8.3377 0.132
NP_442244.1_6 Reverse -237 -256 -1.27885 0.291
NP_440344.1_10 Forward -126 -109 8.29864 0.0111
NP_440344.1_10 Reverse -103 -120 -4.68105 0.0992
NP_440531.1_6 Forward -281 -262 4.916 0.119
NP_440531.1_6 Forward -127 -108 -2.36049 0.249
NP_442910.1_1 Forward -126 -107 -6.68705 0.254
NP_442750.1_3 Reverse -237 -256 -11.7019 0.26
NP_440297.1_9 Reverse -130 -140 0.0783647 0.282
NP_440297.1_9 Forward -118 -108 -0.118297 0.282
NP_440297.1_9 Reverse -111 -121 -0.216628 0.282
NP_440350.1_5 Reverse -58 -77 5.80098 0.155
NP_440350.1_5 Forward -177 -158 1.57275 0.158
NP_442280.1_10 Reverse -368 -386 7.98684 0.268
NP_440894.1_10 Reverse -105 -124 11.6025 0.142
NP_440999.1_9 Reverse -106 -120 17.4042 0.0167
NP_440999.1_9 Forward -31 -17 1.47456 0.164
NP_440999.1_9 Forward -277 -263 -3.24533 0.289
NP_440888.1_2 Forward -119 -105 16.9119 0.00511
NP_440888.1_2 Reverse -110 -124 8.45543 0.16
NP_440600.1_4 Forward -127 -109 4.6407 0.112
NP_440052.1_5 Reverse -99 -118 3.73603 0.14
NP_442948.1_2 Forward -120 -101 13.2741 0.113
NP_442277.1_4 Reverse -101 -120 10.4217 0.0949
NP_442033.1_10 Reverse -108 -127 -6.88371 0.186
NP_440575.1_1 Reverse -91 -110 -3.44288 0.294
NP_441543.1_2 Forward -118 -109 18.486 0.00236
NP_441543.1_2 Reverse -111 -120 15.9293 0.00518
NP_441918.1_7 Forward -21 -2 -2.65548 0.297
NP_441469.1_8 Reverse -109 -118 16.126 0.00797
NP_441469.1_8 Forward -120 -111 6.5879 0.227
NP_442315.1_2 Reverse -387 -399 11.642 0.291
NP_443064.1_6 Reverse -110 -120 10.8217 0.13
NP_440257.1_1 Forward -349 -332 17.1484 0.194
NP_442578.1_7 Forward -118 -111 14.5921 0.026
NP_442578.1_7 Reverse -111 -118 14.5921 0.026
NP_441462.1_2 Reverse -110 -120 20.2362 0.000805
NP_441462.1_2 Forward -119 -109 11.5831 0.00406
NP_441462.1_2 Forward -273 -263 -0.511621 0.236
NP_441621.1_7 Forward -121 -107 -3.24533 0.188
NP_441621.1_7 Reverse -108 -122 -5.60527 0.256
NP_443062.1_1 Reverse -110 -128 9.71601 0.129
NP_443062.1_1 Forward -119 -101 7.18082 0.182
NP_443062.1_6 Forward -127 -108 4.22769 0.221
NP_441601.1_4 Forward -284 -265 -4.91709 0.293
NP_442204.1_1 Reverse -106 -117 11.5634 0.0565
NP_442204.1_1 Forward -123 -112 8.90846 0.0852
NP_442204.1_5 Reverse -100 -119 3.34271 0.192
NP_442204.1_5 Forward -129 -110 1.37609 0.238
NP_441560.1_3 Forward -394 -376 8.47561 0.28
NP_441560.1_10 Forward -127 -108 7.7676 0.273
NP_440544.1_5 Forward -298 -291 13.8024 0.28
NP_440544.1_5 Forward -233 -226 13.8024 0.28
NP_442487.1_10 Forward -146 -127 17.7974 0.203
NP_440516.1_2 Reverse -104 -122 4.34571 0.138
NP_440516.1_2 Forward -125 -107 0.117479 0.236
NP_440516.1_6 Reverse -136 -150 11.307 0.209
NP_440516.1_8 Forward -119 -110 16.9127 0.00442
NP_440516.1_8 Reverse -110 -119 16.9127 0.00442
NP_442428.1_5 Forward -118 -111 15.8704 0.0124
NP_442428.1_5 Reverse -111 -118 15.8704 0.0124
NP_440603.1_9 Forward -400 -381 0.687771 0.284
NP_440673.1_2 Reverse -254 -273 11.4627 0.176
NP_440673.1_2 Forward -129 -110 8.04834 0.284
NP_440673.1_3 Forward -117 -110 12.4288 0.0426
NP_440673.1_3 Reverse -112 -119 12.4288 0.0426
NP_440865.1_9 Forward -148 -129 -4.03212 0.201
NP_440865.1_9 Forward -125 -106 -7.86702 0.251
NP_441052.1_2 Forward -119 -109 10.5014 0.0285
NP_441052.1_2 Reverse -110 -120 10.4031 0.0285
NP_442219.1_9 Forward -118 -109 8.35786 0.0681
NP_442219.1_9 Reverse -111 -120 8.25953 0.0681
NP_440436.1_4 Forward -118 -109 18.1905 0.00233
NP_440436.1_4 Reverse -111 -120 9.24241 0.0871
NP_441884.1_8 Reverse -109 -128 -1.37718 0.138
NP_442577.1_7 Forward -68 -49 10.6184 0.199
NP_442577.1_7 Forward -335 -316 9.24175 0.199
NP_441719.1_4 Forward -118 -111 16.3621 0.0124
NP_441719.1_4 Reverse -111 -118 16.3621 0.0124
NP_441733.1_10 Forward -122 -109 8.27909 0.14
NP_441004.1_1 Forward -151 -132 -7.96535 0.2
NP_442366.1_3 Reverse -109 -127 8.08229 0.0693
NP_442366.1_3 Forward -120 -102 0.117479 0.178
NP_442366.1_5 Forward -122 -112 14.8275 0.0375
NP_442695.1_3 Forward -73 -59 16.4202 0.213
NP_440129.1_10 Reverse -103 -117 4.22782 0.185
NP_441115.1_4 Forward -120 -102 17.4229 0.0179
NP_441115.1_4 Reverse -109 -127 13.4897 0.077
NP_442694.1_9 Forward -298 -279 10.8159 0.24
NP_442206.1_10 Forward -119 -104 1.15987 0.236
NP_442206.1_10 Reverse -110 -125 1.15987 0.236
NP_440328.1_4 Reverse -104 -123 0.58944 0.246
NP_443054.1_2 Reverse -108 -122 9.2427 0.102
NP_440508.1_2 Reverse -232 -251 15.4156 0.234
NP_441851.1_10 Reverse -109 -119 16.008 0.00552
NP_441851.1_10 Forward -120 -110 8.53483 0.114
NP_441982.1_6 Forward -396 -387 11.7214 0.288
NP_440165.1_5 Reverse -109 -128 1.37609 0.128
NP_441046.1_2 Reverse -381 -400 -0.39387 0.28
NP_442689.1_3 Forward -147 -128 13.4708 0.198
NP_441349.1_10 Forward -129 -110 16.2241 0.0114
NP_441349.1_10 Reverse -100 -119 1.27776 0.084
NP_440432.1_9 Reverse -111 -126 -3.26502 0.179
NP_442450.1_5 Forward -121 -111 7.64985 0.13
NP_442450.1_5 Forward -140 -130 5.87989 0.218
NP_440588.1_2 Reverse -101 -120 13.9625 0.0175
NP_440588.1_2 Forward -128 -109 -2.45882 0.165
NP_439950.1_1 Reverse -180 -189 13.2744 0.277
NP_442243.1_1 Reverse -104 -122 5.32826 0.186
NP_442243.1_1 Reverse -217 -235 -1.45654 0.279
NP_441570.1_1 Reverse -110 -128 1.10079 0.0331
NP_441078.1_4 Forward -119 -110 19.6659 0.0007
NP_441078.1_4 Reverse -110 -119 19.6659 0.0007
NP_441078.1_4 Forward -273 -264 -1.57357 0.266
NP_442348.1_2 Reverse -320 -329 14.5527 0.147
NP_442348.1_2 Forward -240 -231 11.9961 0.225
NP_440707.1_7 Reverse -4 -23 4.12936 0.284
NP_442443.1_1 Reverse -266 -285 -6.49039 0.294
NP_440526.1_3 Reverse -111 -122 1.92649 0.267
NP_441432.1_8 Forward -120 -111 16.8143 0.00595
NP_441432.1_8 Reverse -109 -118 8.25953 0.0755
NP_442320.1_8 Reverse -104 -118 6.48943 0.0272
NP_442320.1_8 Forward -125 -111 -3.83532 0.134
NP_441732.1_2 Forward -123 -107 -6.62797 0.0495
NP_441732.1_2 Reverse -106 -122 -16.1661 0.165
NP_440313.1_1 Forward -359 -340 15.1424 0.242
NP_440760.1_1 Forward -273 -254 -20.1584 0.221
NP_442353.1_4 Forward -279 -260 -0.984623 0.296
NP_442489.1_7 Forward -119 -110 20.1576 0.000695
NP_442489.1_7 Reverse -110 -119 20.1576 0.000695
NP_442489.1_7 Forward -273 -264 -1.08191 0.179
NP_441452.1_1 Forward -369 -350 12.3892 0.292
NP_440559.1_1 Forward -118 -109 8.75118 0.0586
NP_440559.1_1 Reverse -111 -120 8.65285 0.0586
NP_441659.2_8 Reverse -110 -120 20.9245 0.000805
NP_441659.2_8 Forward -119 -109 11.9764 0.0147
NP_442749.1_5 Forward -248 -231 11.4051 0.183
NP_442849.1_1 Forward -109 -95 10.816 0.203
NP_442008.1_2 Forward -122 -103 5.40766 0.226
NP_442346.1_5 Forward -120 -110 16.303 0.00248
NP_442346.1_5 Reverse -109 -119 9.02648 0.118
NP_440352.1_5 Forward -117 -98 15.8678 0.113
NP_440545.1_3 Forward -123 -106 12.6252 0.0199
NP_442934.1_8 Forward -159 -140 15.6341 0.173
NP_440459.1_2 Forward -121 -104 12.7235 0.137
NP_441943.1_8 Forward -326 -307 -5.31042 0.258
NP_442603.1_7 Forward -119 -105 10.6187 0.125
NP_441888.1_7 Reverse -105 -119 13.5693 0.0743
NP_441888.1_7 Forward -124 -110 2.2612 0.225
NP_440449.1_6 Reverse -102 -120 5.92152 0.266
NP_441948.1_4 Forward -126 -108 -0.669169 0.139
NP_441833.1_4 Forward -118 -111 15.9687 0.0124
NP_441833.1_4 Reverse -111 -118 15.9687 0.0124
NP_441329.1_6 Reverse -291 -310 -2.43547 0.294
NP_441112.1_5 Reverse -181 -200 8.84924 0.221
NP_442162.1_9 Forward -118 -111 16.2637 0.0124
NP_442162.1_9 Reverse -111 -118 16.2637 0.0124
NP_440671.1_4 Reverse -104 -118 10.226 0.163
NP_440671.1_4 Forward -125 -111 6.88276 0.233
NP_442045.1_5 Reverse -101 -120 -0.0988766 0.266
NP_442199.1_5 Reverse -102 -121 -2.65548 0.191
NP_442199.1_7 Forward -261 -242 3.14526 0.249
NP_442140.1_3 Forward -118 -108 14.238 0.0486
NP_442140.1_3 Reverse -111 -121 6.66654 0.159
NP_441692.1_2 Forward -345 -326 0.196116 0.299
NP_440875.1_9 Forward -117 -107 17.327 0.0126
NP_440875.1_9 Reverse -112 -122 7.69067 0.255
NP_441813.1_3 Forward -76 -57 14.1404 0.248
NP_441813.1_5 Reverse -108 -118 19.4496 0.00647
NP_441813.1_5 Forward -121 -111 8.63316 0.0367
NP_440590.1_4 Forward -118 -105 13.4906 0.013
NP_440590.1_4 Reverse -111 -124 3.75586 0.0686
NP_440567.1_1 Forward -118 -104 9.63603 0.0422
NP_440567.1_1 Reverse -111 -125 3.53951 0.141
NP_442497.1_10 Reverse -111 -120 17.601 0.00813
NP_442497.1_10 Forward -118 -109 10.4228 0.0087
NP_440821.1_4 Reverse -108 -118 10.2065 0.0163
NP_440821.1_4 Forward -121 -111 2.24165 0.131
NP_441239.1_9 Reverse -108 -120 14.1986 0.0288
NP_441239.1_9 Forward -121 -109 13.707 0.0355
NP_441239.1_9 Reverse -127 -139 8.00379 0.145
NP_441009.1_4 Forward -119 -100 12.1925 0.243
NP_442568.1_6 Forward -84 -65 16.0265 0.0914
NP_442568.1_8 Forward -391 -377 11.2093 0.257
NP_441892.1_1 Forward -128 -111 9.87194 0.0703
NP_440604.1_6 Reverse -110 -129 -4.6221 0.253
NP_441017.1_8 Reverse -317 -332 11.8779 0.188
NP_443012.1_5 Reverse -256 -275 18.6823 0.0559
NP_440412.1_1 Reverse -262 -281 11.4058 0.182
NP_442052.1_8 Reverse -262 -272 12.5664 0.265
NP_440546.1_4 Reverse -110 -120 13.5365 0.0459
NP_440546.1_4 Forward -119 -109 11.8882 0.0679
NP_440546.1_4 Reverse -52 -62 7.04032 0.264
NP_442041.1_5 Forward -67 -48 0.884433 0.257
NP_440462.1_6 Reverse -108 -118 17.2863 0.00752
NP_440462.1_6 Forward -121 -111 10.5014 0.0396
NP_442611.1_1 Forward -119 -100 5.11266 0.181
NP_440868.1_4 Reverse -106 -118 10.5604 0.0364
NP_440868.1_4 Forward -123 -111 -0.846001 0.282
NP_442402.1_2 Reverse -96 -110 14.9452 0.263
NP_442402.1_4 Reverse -91 -110 4.81688 0.144
NP_441848.1_7 Forward -241 -222 -3.73788 0.284
NP_442039.1_4 Forward -118 -111 15.1821 0.0124
NP_442039.1_4 Reverse -111 -118 15.1821 0.0124
NP_442039.1_7 Forward -355 -345 7.25653 0.277
NP_442837.1_3 Forward -118 -111 15.7721 0.0124
NP_442837.1_3 Reverse -111 -118 15.7721 0.0124
NP_442053.1_1 Forward -119 -110 18.3876 0.0007
NP_442053.1_1 Reverse -110 -119 18.3876 0.0007
NP_442053.1_1 Forward -138 -129 4.71961 0.228
NP_440505.1_3 Reverse -108 -118 15.9097 0.00857
NP_440505.1_3 Forward -121 -111 8.04317 0.147
NP_440505.1_7 Forward -361 -342 3.53937 0.213
NP_441203.1_1 Forward -118 -99 -18.8801 0.297
NP_441408.2_7 Reverse -19 -38 -1.27885 0.251
NP_440914.1_1 Reverse -110 -120 16.3248 0.00196
NP_440914.1_1 Forward -119 -109 8.6151 0.186
NP_441011.1_8 Forward -118 -109 16.9127 0.00602
NP_441011.1_8 Reverse -111 -120 16.6177 0.00602
NP_442533.1_1 Forward -151 -132 -16.1268 0.263
NP_442533.1_6 Forward -119 -110 17.2076 0.00137
NP_442533.1_6 Reverse -110 -119 17.2076 0.00137
NP_442533.1_6 Reverse -264 -273 5.50626 0.14
NP_442533.1_6 Forward -273 -264 4.22796 0.186
NP_440263.1_5 Reverse -324 -338 7.57108 0.294
NP_442232.1_3 Forward -127 -108 -13.8652 0.283
NP_442322.1_4 Reverse -129 -146 -10.1882 0.298
NP_442229.1_1 Forward -121 -107 7.3738 0.196
NP_441482.1_7 Forward -125 -111 6.78443 0.026
NP_441482.1_7 Reverse -104 -118 -0.688726 0.0612
NP_439944.1_9 Reverse -111 -121 9.12481 0.1
NP_441028.1_6 Reverse -101 -111 15.2208 0.152
NP_441028.1_6 Reverse -100 -110 5.38779 0.255
NP_440116.1_5 Reverse -107 -124 3.97208 0.222
NP_440116.1_8 Reverse -111 -130 -0.197208 0.105
NP_441527.1_4 Reverse -158 -177 -9.1199 0.255
NP_441527.1_4 Forward -391 -372 -9.50187 0.259
NP_441527.1_4 Forward -392 -373 -12.9396 0.296
NP_440115.1_6 Reverse -107 -117 7.64985 0.146
NP_440007.1_9 Reverse -106 -120 2.5562 0.277
NP_442728.1_2 Reverse -3 -22 14.0608 0.248
NP_439965.1_1 Reverse -101 -120 -6.98204 0.218
NP_442492.1_2 Reverse -110 -129 1.0811 0.239
NP_441602.1_3 Reverse -105 -124 -5.40875 0.285
NP_441106.1_1 Forward -120 -111 18.486 0.0028
NP_441106.1_1 Reverse -109 -118 18.191 0.0028
NP_441106.1_1 Forward -274 -265 2.85133 0.255
NP_439903.1_6 Reverse -107 -126 8.25844 0.14
NP_442306.1_10 Forward -278 -259 -21.6334 0.282
NP_441286.1_1 Forward -120 -108 -3.40261 0.145
NP_441286.1_1 Reverse -109 -121 -3.59927 0.145
NP_440670.1_8 Forward -119 -110 18.3876 0.000699
NP_440670.1_8 Reverse -110 -119 18.3876 0.000699
NP_441930.1_3 Reverse -228 -247 3.82988 0.278
NP_441930.1_3 Forward -252 -233 3.15712 0.288
NP_440886.1_7 Reverse -109 -119 17.7774 0.0011
NP_440886.1_7 Forward -120 -110 8.04271 0.0805
NP_440828.1_1 Forward -281 -262 2.26028 0.231
NP_440404.1_9 Forward -108 -89 8.83258 0.241
NP_442072.1_9 Reverse -109 -127 -14.5338 0.15
NP_442072.1_9 Forward -120 -102 -22.597 0.246
NP_442773.2_4 Reverse -258 -272 14.2576 0.263
NP_440907.2_8 Reverse -111 -121 15.9091 0.0161
NP_440907.2_8 Forward -118 -108 7.94438 0.117
NP_442842.1_9 Forward -300 -281 10.8159 0.21
NP_441626.1_2 Forward -118 -111 15.7721 0.0124
NP_441626.1_2 Reverse -111 -118 15.7721 0.0124
NP_442794.1_1 Reverse -106 -118 10.4621 0.0721
NP_442794.1_1 Forward -123 -111 2.98891 0.286
NP_442615.1_1 Reverse -101 -119 5.62401 0.0376
NP_442615.1_1 Forward -128 -110 -1.45582 0.128
NP_441962.1_4 Forward -214 -195 -5.31042 0.167
NP_441962.1_4 Reverse -259 -278 -13.3736 0.272
NP_440387.1_1 Reverse -110 -126 6.9417 0.0282
NP_441431.1_2 Reverse -107 -121 20.2551 0.00685
NP_441431.1_2 Forward -276 -262 6.29216 0.275
NP_441836.1_1 Reverse -381 -400 13.1551 0.232
NP_441836.1_1 Reverse -99 -118 12.9603 0.232
NP_441836.1_2 Reverse -261 -280 -3.63879 0.242
NP_441993.1_1 Forward -125 -106 1.26449 0.282
NP_440114.1_10 Reverse -110 -124 10.0294 0.155
NP_442698.1_10 Forward -117 -98 2.75272 0.284
NP_442698.1_10 Forward -399 -380 1.67108 0.297
NP_442323.1_7 Reverse -105 -124 1.86696 0.276
NP_440766.1_4 Forward -123 -109 8.06273 0.0871
NP_440766.1_4 Reverse -7 -21 0.88457 0.263
NP_442743.1_4 Forward -118 -99 0.687771 0.174
NP_440457.1_1 Reverse -106 -118 7.61046 0.101
NP_440798.1_6 Forward -118 -105 3.95252 0.147
NP_440942.1_3 Forward -55 -36 2.16274 0.298
NP_440142.1_7 Forward -144 -125 7.7676 0.247
NP_442509.1_9 Forward -119 -109 16.2041 0.00739
NP_442509.1_9 Reverse -110 -120 8.04271 0.192
NP_440554.1_4 Forward -118 -108 16.4996 0.0189
NP_440554.1_4 Reverse -111 -121 8.82982 0.0646
NP_441885.1_5 Forward -119 -109 11.4848 0.00668
NP_441885.1_5 Reverse -110 -120 11.3864 0.00668
NP_442341.1_7 Reverse -109 -123 10.521 0.0625
NP_442341.1_7 Forward -120 -106 2.45787 0.256
NP_442341.1_9 Reverse -108 -122 15.6336 0.0435
NP_441756.1_5 Reverse -106 -125 -4.91709 0.297
NP_441173.1_9 Forward -398 -390 13.2937 0.17
NP_442395.2_4 Forward -120 -101 8.84842 0.121
NP_440191.1_4 Forward -15 -5 13.5359 0.282
NP_440750.1_6 Reverse -221 -240 7.30471 0.296
NP_443000.1_7 Reverse -108 -118 11.5831 0.0344
NP_443000.1_7 Forward -121 -111 10.6981 0.0345
NP_443059.1_10 Forward -260 -241 -1.27961 0.299
NP_441842.1_10 Forward -126 -112 9.14437 0.199
NP_440275.1_3 Reverse -108 -118 15.418 0.0178
NP_440275.1_3 Forward -121 -111 9.02648 0.0563
NP_441397.1_8 Forward -109 -96 13.0487 0.245
NP_441902.1_3 Reverse -222 -232 15.4111 0.201
NP_441359.1_5 Forward -283 -264 0.786102 0.29
NP_440880.1_6 Reverse -375 -394 18.1898 0.131
NP_441105.1_3 Forward -130 -111 5.99764 0.0638
NP_441105.1_3 Reverse -99 -118 -1.08219 0.145
NP_442373.1_2 Reverse -15 -34 -8.65367 0.249
NP_440216.1_1 Forward -119 -105 17.4042 0.00188
NP_440216.1_1 Reverse -110 -124 -1.77037 0.0383
NP_440216.1_9 Forward -68 -59 12.8811 0.213
NP_440172.1_1 Reverse -110 -120 17.5813 0.00421
NP_440172.1_1 Forward -119 -109 8.73149 0.0586
NP_442371.1_1 Reverse -289 -299 14.5325 0.191
NP_442015.1_10 Reverse -106 -119 21.4554 0.00329
NP_442015.1_10 Forward -123 -110 3.65753 0.178
NP_441226.1_7 Forward -118 -111 14.4934 0.0123
NP_441226.1_7 Reverse -111 -118 14.4934 0.0123
NP_441111.1_7 Forward -118 -110 18.7023 0.00294
NP_441111.1_7 Reverse -111 -119 18.7023 0.00294
NP_441766.1_2 Forward -119 -110 17.5026 0.00297
NP_441766.1_2 Reverse -110 -119 17.5026 0.00297
NP_442417.1_5 Forward -119 -105 16.8142 0.0349
NP_442417.1_5 Reverse -110 -124 8.94771 0.142
NP_440416.1_9 Reverse -103 -122 -5.50708 0.0803
NP_440416.1_9 Forward -126 -107 -7.08038 0.0964
NP_440591.1_9 Reverse -254 -272 5.32902 0.25
NP_440591.1_9 Forward -145 -127 3.55906 0.298
NP_440896.1_5 Forward -377 -358 17.404 0.125
NP_440261.1_5 Forward -118 -105 6.80412 0.0316
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTTTTGCCAAAAACGCCAAAGAAAGGGATACATCCTCTCCTGTTCATTGGCCGCAAAGATGGGATTAACGGAAAATCCCCTCGGGTCCATATAGTTAACAATTTTCTTCAGCAATGTACCCTTACCGGCGGCGGCCCAACCTTCCAAAACAATAATCACCGGAATTTTTTCTTCCCAACAGGACTGTTGTAGACTCCGCAACTGTTGCATTAAATCTTCCAACTGTTCCTTGTAACTCTGTTTGTCCAGATTAAGGGAAAGGTCGAGGGCGTCTAACATAGGCGATCGCCGGGGGAAAAAAATGATGGTCAGCCTCAGTTTAAGCCAGAAACCCAGGAAAAGATCCCTTGGTTATAATGTGGGGGCCTCTGCTTTAACCGCCCATTTCAACGGTTTTCC

CDS

ATGCAAAATCTCGGTTTACAGTATCCCCTTTTCGGCCCAGAAATCCAGTGCCCCCACTGTCGGCAAACTATTCCGGCCTTGACCCTGACGGACACTTACCTTTGTAATCGCCATGGAGCCTTTGAAGTTAACCCCGACACAGAGGATTTAGTCCATTTGCAATCGGGTCGCCACTGGCGGCTATGGCAGGGGGAATGGTACCGGCAACACACCCACCCCGACGGTATCCGCTTTGAAATTCACGAAGCCTTGGACCGGCTCTACACGGAAGGTTACCGGGCCACCAAGGTCATCATCGCCCACCGTTACTACGATCTAGTCAGCGTTTATCTGCAACGGCAAGGTAGCTGGCGCAATCCCGAAGATAAGGATAGTCCTCTGCCTCGTCTTTACGGTTTACCAGTGGAATTCAGTGCCCCAGGTACAGCGGACGATTGTTGGCAGGTAATTAACTTTGATCTGGAAAAGGAAAAGGGTATTCCCAAGCGCTATCCCTATTTCCGTTTATTTGATTAG

Protein

MQNLGLQYPLFGPEIQCPHCRQTIPALTLTDTYLCNRHGAFEVNPDTEDLVHLQSGRHWRLWQGEWYRQHTHPDGIRFEIHEALDRLYTEGYRATKVIIAHRYYDLVSVYLQRQGSWRNPEDKDSPLPRLYGLPVEFSAPGTADDCWQVINFDLEKEKGIPKRYPYFRLFD