Your browser is old and dusty. Try Google Chrome!

Details for sll1262

ORF sll1262
Accession NP_441465.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_5 Forward -287 -268 21.6323 0.0733
NP_440795.1_7 Forward -347 -340 14.6904 0.0123
NP_440795.1_7 Reverse -340 -347 14.6904 0.0123
NP_441418.1_6 Forward -348 -329 -8.94866 0.0273
NP_441418.1_6 Reverse -228 -247 -29.9915 0.249
NP_442291.1_5 Reverse -338 -354 6.54838 0.0694
NP_441453.1_1 Reverse -332 -350 5.62325 0.246
NP_441453.1_4 Reverse -339 -347 16.539 0.00633
NP_441453.1_4 Forward -348 -340 16.539 0.00633
NP_441818.1_1 Reverse -340 -351 9.20294 0.25
NP_441818.1_9 Forward -248 -229 -10.6203 0.296
NP_440226.1_1 Forward -348 -329 11.9958 0.0484
NP_440226.1_1 Reverse -339 -358 8.94757 0.0802
NP_442173.1_1 Forward -347 -339 15.4574 0.00633
NP_442173.1_1 Reverse -340 -348 15.4574 0.00633
NP_442752.1_4 Forward -348 -341 13.8055 0.0199
NP_442752.1_4 Reverse -339 -346 13.8055 0.0199
NP_443027.1_4 Forward -350 -340 13.2547 0.0521
NP_443027.1_4 Forward -287 -277 7.35486 0.24
NP_443027.1_4 Reverse -337 -347 5.87989 0.294
NP_441812.1_3 Reverse -338 -352 8.55439 0.251
NP_442975.1_10 Reverse -335 -349 19.0751 0.00482
NP_442975.1_10 Forward -352 -338 4.03056 0.249
NP_440784.1_7 Forward -347 -340 15.9687 0.0123
NP_440784.1_7 Reverse -340 -347 15.9687 0.0123
NP_442909.1_7 Forward -18 -4 6.68548 0.242
NP_441337.1_2 Forward -125 -106 17.5024 0.144
NP_440061.1_9 Forward -157 -143 9.04542 0.154
NP_440061.1_9 Forward -164 -150 7.76712 0.194
NP_440110.1_8 Forward -347 -328 2.3594 0.211
NP_440110.1_8 Forward -248 -229 2.0644 0.211
NP_441054.1_2 Reverse -363 -382 10.5209 0.284
NP_441476.1_5 Forward -257 -238 -0.000545616 0.195
NP_440631.1_5 Forward -269 -250 17.2074 0.231
NP_442062.1_8 Forward -348 -338 19.4496 0.000558
NP_442062.1_8 Reverse -339 -349 10.3048 0.0493
NP_442062.1_8 Forward -285 -275 5.09324 0.184
NP_441900.1_2 Forward -169 -151 -0.0799167 0.266
NP_441859.1_3 Reverse -338 -357 2.75194 0.257
NP_441802.1_1 Forward -259 -240 10.3242 0.197
NP_440304.1_4 Forward -350 -340 10.8948 0.051
NP_440304.1_4 Reverse -337 -347 1.84832 0.299
NP_442242.1_4 Forward -347 -340 14.3954 0.0124
NP_442242.1_4 Reverse -340 -347 14.3954 0.0124
NP_440044.1_8 Reverse -340 -359 10.6192 0.0551
NP_440044.1_8 Reverse -238 -257 -3.44213 0.284
NP_442762.1_10 Reverse -141 -160 -2.16383 0.205
NP_441200.1_4 Forward -261 -242 5.60432 0.294
NP_441594.1_6 Reverse -150 -169 7.96426 0.166
NP_441594.1_6 Forward -249 -230 0.884433 0.279
NP_442475.1_8 Reverse -363 -382 21.5339 0.0576
NP_440856.1_1 Reverse -149 -168 -3.73712 0.231
NP_440856.1_4 Forward -355 -336 14.4541 0.0346
NP_440856.1_7 Forward -22 -3 -9.53865 0.294
NP_441083.1_5 Forward -348 -338 11.3864 0.0159
NP_441083.1_5 Reverse -339 -349 11.2881 0.0159
NP_442827.1_8 Reverse -331 -350 -1.8696 0.26
NP_441434.1_7 Forward -346 -332 1.86788 0.29
NP_441738.1_2 Forward -346 -339 15.28 0.0102
NP_441738.1_2 Reverse -341 -348 15.28 0.0102
NP_441558.1_5 Forward -350 -331 5.50599 0.247
NP_440209.1_1 Reverse -339 -347 18.1123 0.00295
NP_440209.1_1 Forward -348 -340 18.1123 0.00295
NP_442889.1_8 Forward -351 -337 10.9137 0.077
NP_440447.1_5 Reverse -140 -150 13.943 0.277
NP_441770.1_4 Forward -93 -74 -3.93378 0.204
NP_440178.1_7 Reverse -236 -255 -12.4886 0.121
NP_440178.1_7 Reverse -338 -357 -21.6334 0.232
NP_441792.1_1 Reverse -274 -293 6.19431 0.234
NP_441327.1_5 Reverse -81 -90 12.6844 0.298
NP_440644.1_3 Forward -257 -238 10.1275 0.17
NP_442111.1_4 Forward -349 -335 6.48943 0.123
NP_441624.1_7 Reverse -141 -155 9.14437 0.223
NP_440906.1_5 Forward -347 -340 15.8704 0.0124
NP_440906.1_5 Reverse -340 -347 15.8704 0.0124
NP_440747.1_10 Forward -351 -339 7.4138 0.00422
NP_440747.1_10 Reverse -336 -348 5.34885 0.0141
NP_441130.1_7 Forward -167 -153 15.4369 0.287
NP_441130.1_10 Reverse -337 -351 10.0294 0.117
NP_441486.1_1 Forward -351 -337 4.91614 0.0399
NP_441486.1_1 Reverse -336 -350 -3.44199 0.178
NP_442634.1_4 Forward -350 -336 -1.8687 0.149
NP_440403.1_10 Forward -246 -227 13.1758 0.137
NP_441014.1_10 Forward -349 -330 -1.08295 0.257
NP_441014.1_10 Forward -247 -228 -3.24622 0.297
NP_442848.1_4 Forward -128 -114 5.99778 0.286
NP_442848.1_5 Reverse -117 -135 -0.669169 0.276
NP_442848.1_5 Forward -156 -138 -3.52077 0.293
NP_441012.1_4 Forward -321 -308 9.06573 0.272
NP_443018.1_3 Forward -347 -340 14.8871 0.0123
NP_443018.1_3 Reverse -340 -347 14.8871 0.0123
NP_441316.1_7 Forward -292 -277 -3.65835 0.286
NP_441634.1_8 Forward -248 -234 3.24451 0.154
NP_441634.1_8 Forward -101 -87 -2.36035 0.295
NP_441634.1_8 Forward -350 -336 -2.85201 0.295
NP_441634.1_8 Reverse -232 -246 -3.73699 0.295
NP_440376.1_1 Forward -348 -339 19.4693 0.000692
NP_440376.1_1 Reverse -339 -348 19.4693 0.000692
NP_440376.1_1 Reverse -237 -246 4.81794 0.149
NP_441588.1_4 Forward -346 -336 14.238 0.0773
NP_441588.1_4 Reverse -341 -351 6.76487 0.185
NP_442687.1_7 Reverse -338 -348 15.8113 0.0125
NP_442687.1_7 Forward -349 -339 9.02648 0.0994
NP_442687.1_7 Forward -157 -147 3.91327 0.278
NP_442485.1_3 Reverse -238 -257 -4.91709 0.286
NP_442485.1_3 Forward -248 -229 -5.60541 0.293
NP_441422.1_7 Forward -170 -153 -6.54933 0.252
NP_440667.1_2 Reverse -237 -256 -4.13045 0.247
NP_441950.1_7 Forward -57 -38 -9.14533 0.293
NP_441950.1_8 Reverse -239 -253 6.3911 0.243
NP_442658.1_1 Reverse -337 -347 15.9091 0.00966
NP_442658.1_1 Forward -350 -340 14.2375 0.0237
NP_441971.1_7 Reverse -279 -298 18.3873 0.212
NP_440656.1_8 Forward -359 -340 -8.06369 0.272
NP_441414.1_9 Forward -348 -329 -1.67217 0.103
NP_441487.1_9 Reverse -338 -357 15.6341 0.0454
NP_441487.1_9 Reverse -236 -255 15.6341 0.0454
NP_442937.1_5 Forward -251 -232 6.68596 0.272
NP_442937.1_5 Reverse -334 -353 6.58763 0.275
NP_442321.1_1 Forward -350 -331 -2.85214 0.214
NP_442321.1_4 Reverse -101 -120 -9.14533 0.293
NP_441958.1_5 Forward -349 -339 21.2195 0.000805
NP_441958.1_5 Reverse -338 -348 12.2714 0.00183
NP_441127.1_1 Reverse -234 -248 10.3243 0.251
NP_443001.1_3 Forward -365 -346 20.354 0.0243
NP_440995.1_8 Reverse -329 -348 3.14605 0.264
NP_440984.1_7 Reverse -334 -348 7.86607 0.161
NP_440984.1_7 Forward -353 -339 5.99778 0.231
NP_442911.1_2 Reverse -271 -290 -11.0136 0.296
NP_440153.1_5 Reverse -340 -354 1.67122 0.245
NP_440153.1_8 Forward -249 -236 -3.12731 0.285
NP_440153.1_8 Forward -162 -149 -3.22564 0.292
NP_441591.1_10 Forward -248 -229 6.58763 0.282
NP_443055.1_6 Reverse -331 -349 0.0184138 0.251
NP_443055.1_6 Forward -356 -338 -0.76823 0.266
NP_440993.1_2 Forward -353 -337 1.33684 0.284
NP_440169.1_7 Forward -338 -319 16.6174 0.138
NP_440615.1_6 Forward -57 -38 26.7455 0.00107
NP_441099.1_5 Reverse -329 -348 -5.50708 0.152
NP_441099.1_5 Forward -225 -206 -11.5053 0.283
NP_442002.1_9 Reverse -338 -345 10.7572 0.185
NP_440809.1_9 Forward -357 -339 -7.749 0.225
NP_441646.1_1 Reverse -332 -351 -0.295539 0.26
NP_441646.1_1 Forward -220 -201 -0.4922 0.266
NP_441000.1_6 Reverse -338 -352 13.2743 0.0396
NP_441000.1_6 Forward -349 -335 -3.63866 0.225
NP_440484.1_3 Forward -350 -336 12.8809 0.242
NP_440484.1_3 Reverse -74 -88 10.816 0.242
NP_440147.1_4 Reverse -337 -350 19.6855 0.00258
NP_440147.1_4 Forward -350 -337 9.06573 0.0437
NP_441175.1_7 Reverse -98 -117 8.25926 0.211
NP_441550.1_8 Forward -350 -340 15.8108 0.0132
NP_441550.1_8 Reverse -337 -347 8.3377 0.124
NP_441916.1_7 Reverse -339 -349 18.9579 0.00144
NP_441916.1_7 Forward -348 -338 18.4663 0.00144
NP_440465.1_10 Forward -255 -236 3.6377 0.248
NP_441041.1_4 Reverse -147 -166 -3.54046 0.123
NP_441041.1_4 Reverse -237 -256 -10.3253 0.231
NP_441041.1_4 Forward -348 -329 -10.4236 0.232
NP_441041.1_4 Forward -296 -277 -11.8986 0.254
NP_441041.1_7 Forward -351 -339 16.6495 0.0131
NP_441041.1_7 Reverse -336 -348 9.55551 0.109
NP_442396.1_5 Reverse -335 -348 9.95071 0.128
NP_442004.1_8 Forward -229 -211 14.4738 0.218
NP_441725.1_4 Forward -353 -339 3.8339 0.278
NP_441725.1_5 Forward -347 -337 2.04498 0.115
NP_441725.1_5 Reverse -340 -350 1.94665 0.115
NP_439966.1_7 Forward -350 -340 14.3359 0.0203
NP_439966.1_7 Reverse -337 -347 9.91099 0.0968
NP_439966.1_9 Reverse -337 -346 0.884706 0.253
NP_440202.1_9 Forward -358 -339 13.6675 0.115
NP_442941.1_3 Reverse -340 -350 19.2529 0.00262
NP_442941.1_3 Forward -347 -337 2.63497 0.14
NP_440289.1_2 Forward -351 -338 6.01747 0.0605
NP_440289.1_2 Reverse -336 -349 -3.71729 0.267
NP_440983.1_5 Reverse -112 -131 -6.39206 0.276
NP_440983.1_5 Forward -162 -143 -8.06369 0.294
NP_440260.1_8 Forward -94 -76 -7.35568 0.295
NP_442281.1_1 Forward -353 -339 17.5018 0.00555
NP_442281.1_1 Reverse -334 -348 12.782 0.034
NP_440018.1_3 Forward -161 -142 11.8975 0.13
NP_441457.1_7 Forward -254 -235 7.47261 0.167
NP_441644.1_6 Reverse -339 -349 19.0557 0.000803
NP_441644.1_6 Forward -348 -338 10.1076 0.0628
NP_441644.1_6 Reverse -237 -247 3.51951 0.277
NP_442177.1_5 Forward -130 -116 7.57108 0.297
NP_442029.1_6 Reverse -148 -167 2.45773 0.296
NP_442247.1_5 Forward -380 -366 16.7792 0.234
NP_442247.1_8 Forward -350 -336 11.8976 0.247
NP_440253.1_2 Reverse -339 -357 9.36059 0.0491
NP_440253.1_2 Forward -348 -330 -0.177514 0.204
NP_440929.1_8 Forward -348 -339 19.2726 0.000701
NP_440929.1_8 Reverse -339 -348 19.2726 0.000701
NP_440780.1_1 Forward -118 -99 8.16414 0.274
NP_442933.1_10 Forward -348 -339 17.601 0.00325
NP_442933.1_10 Reverse -339 -348 17.601 0.00325
NP_441751.2_8 Reverse -340 -354 4.22782 0.0521
NP_442554.1_4 Forward -340 -321 5.89931 0.291
NP_442554.1_8 Reverse -340 -350 17.2863 0.00543
NP_442554.1_8 Forward -347 -337 13.2547 0.0187
NP_441762.1_7 Forward -349 -337 10.2654 0.0142
NP_441762.1_7 Reverse -338 -350 2.30059 0.0676
NP_442142.1_4 Forward -351 -338 14.1783 0.0311
NP_442142.1_4 Reverse -336 -349 5.23026 0.197
NP_442292.1_1 Reverse -340 -349 17.5026 0.00435
NP_442292.1_1 Forward -347 -338 9.63616 0.0183
NP_442381.1_8 Forward -351 -332 1.86774 0.103
NP_443009.1_5 Forward -349 -338 19.626 0.00102
NP_443009.1_5 Reverse -338 -349 7.82632 0.118
NP_441726.1_1 Forward -254 -235 20.944 0.0817
NP_442271.1_6 Reverse -331 -350 14.8474 0.294
NP_441715.1_4 Reverse -340 -350 16.7946 0.0106
NP_441715.1_4 Forward -347 -337 9.41981 0.097
NP_440357.1_9 Forward -257 -238 18.289 0.213
NP_440881.1_5 Forward -254 -235 13.2741 0.299
NP_440379.1_5 Forward -246 -227 4.62101 0.136
NP_441468.1_1 Forward -347 -340 15.8704 0.0124
NP_441468.1_1 Reverse -340 -347 15.8704 0.0124
NP_441020.2_6 Forward -350 -333 11.1502 0.127
NP_441015.1_10 Forward -248 -229 -4.32711 0.202
NP_441015.1_10 Forward -257 -238 -4.42544 0.203
NP_441673.1_1 Forward -348 -339 20.8459 0.000698
NP_441673.1_1 Reverse -339 -348 20.8459 0.000698
NP_441673.1_1 Reverse -237 -246 -7.86675 0.187
NP_441673.1_1 Forward -246 -237 -7.96508 0.206
NP_441731.1_2 Forward -245 -226 10.2259 0.224
NP_441330.1_1 Forward -353 -334 -2.0655 0.0791
NP_442063.1_9 Reverse -325 -344 5.60432 0.231
NP_441764.1_8 Reverse -80 -90 13.8947 0.284
NP_442868.1_6 Forward -350 -340 10.4031 0.038
NP_442868.1_6 Reverse -337 -347 0.865012 0.205
NP_442719.1_2 Reverse -322 -340 -11.2896 0.291
NP_441612.1_2 Forward -333 -323 8.93654 0.21
NP_442227.1_6 Forward -171 -152 15.2399 0.292
NP_441911.1_7 Forward -22 -3 -9.53937 0.125
NP_442808.1_1 Reverse -338 -348 18.4657 0.00201
NP_442808.1_1 Forward -349 -339 8.73102 0.0481
NP_440145.1_3 Forward -358 -339 17.3057 0.00972
NP_442718.1_2 Reverse -1 -20 -3.3438 0.291
NP_442050.1_5 Forward -350 -340 15.9091 0.0091
NP_441114.1_3 Forward -84 -75 7.86621 0.231
NP_440558.1_2 Forward -357 -338 -4.72043 0.248
NP_440558.1_2 Reverse -240 -259 -5.21209 0.254
NP_442789.1_4 Reverse -238 -257 -0.0988766 0.198
NP_442789.1_5 Reverse -74 -93 6.58763 0.215
NP_441518.1_3 Reverse -329 -348 -5.80207 0.128
NP_441878.1_6 Forward -349 -339 10.5014 0.0176
NP_441878.1_6 Reverse -338 -348 10.4031 0.0176
NP_441878.1_6 Reverse -236 -246 -7.00147 0.201
NP_441036.1_8 Reverse -338 -348 17.7779 0.000554
NP_441036.1_8 Forward -349 -339 15.713 0.00724
NP_441557.1_5 Forward -348 -339 19.9609 0.000699
NP_441557.1_5 Reverse -339 -348 19.9609 0.000699
NP_441445.1_1 Reverse -228 -247 9.43923 0.104
NP_441445.1_1 Forward -255 -236 5.80098 0.163
NP_442066.2_9 Forward -352 -339 10.2457 0.154
NP_440101.1_10 Reverse -237 -256 6.29264 0.197
NP_442192.1_5 Forward -119 -100 13.2741 0.193
NP_442183.1_1 Forward -348 -334 11.111 0.0757
NP_442183.1_1 Reverse -339 -353 9.73436 0.094
NP_441407.1_5 Forward -358 -339 7.37428 0.173
NP_441574.1_1 Forward -249 -230 -4.6221 0.253
NP_441238.1_9 Reverse -244 -263 15.0441 0.223
NP_442170.1_5 Reverse -339 -358 2.85105 0.173
NP_442347.1_2 Forward -347 -338 11.1111 0.056
NP_442347.1_2 Forward -174 -165 9.83282 0.0679
NP_442347.1_2 Reverse -113 -122 5.60459 0.229
NP_442347.1_2 Reverse -340 -349 3.34298 0.284
NP_442645.1_2 Forward -356 -337 -11.8003 0.144
NP_442645.1_2 Forward -254 -235 -12.0953 0.144
NP_442645.1_2 Forward -287 -268 -15.0452 0.189
NP_442888.1_8 Reverse -142 -161 16.0274 0.139
NP_441037.1_4 Reverse -337 -347 14.7245 0.028
NP_441037.1_4 Forward -350 -340 7.22024 0.237
NP_442317.1_6 Reverse -334 -353 5.211 0.24
NP_441633.1_3 Forward -350 -337 3.65753 0.0699
NP_441633.1_3 Reverse -337 -350 3.36254 0.0699
NP_440136.1_2 Forward -347 -340 15.9687 0.0123
NP_440136.1_2 Reverse -340 -347 15.9687 0.0123
NP_442590.1_10 Forward -249 -230 4.03102 0.282
NP_442998.1_5 Forward -145 -135 9.81313 0.233
NP_442998.1_5 Forward -67 -57 8.53483 0.261
NP_442998.1_10 Forward -346 -339 15.5754 0.0102
NP_442998.1_10 Reverse -341 -348 15.5754 0.0102
NP_440299.1_1 Reverse -335 -348 10.9334 0.0529
NP_441799.1_1 Forward -352 -338 15.0436 0.0206
NP_441799.1_1 Reverse -335 -349 13.2736 0.0337
NP_441007.1_5 Forward -347 -328 11.9958 0.203
NP_441007.1_10 Forward -353 -340 2.37923 0.19
NP_442201.1_10 Reverse -328 -347 -13.7669 0.277
NP_440256.1_1 Forward -351 -332 16.4207 0.0061
NP_440256.1_1 Reverse -336 -355 1.86774 0.0702
NP_440256.1_1 Reverse -143 -162 0.687771 0.0814
NP_440256.1_1 Reverse -224 -243 -7.57203 0.24
NP_440087.1_1 Forward -357 -338 -7.27704 0.272
NP_441559.1_8 Forward -353 -339 -7.17857 0.287
NP_440915.1_6 Reverse -335 -349 4.81781 0.0953
NP_440915.1_6 Forward -352 -338 1.76955 0.131
NP_442785.1_7 Forward -350 -336 10.0294 0.231
NP_441866.1_6 Reverse -273 -292 20.2548 0.117
NP_441464.1_8 Forward -246 -232 6.09611 0.247
NP_441464.1_8 Forward -348 -334 3.93283 0.283
NP_441464.1_10 Forward -136 -122 12.291 0.201
NP_440026.1_6 Reverse -272 -291 12.6833 0.284
NP_441199.1_6 Reverse -236 -255 -1.08219 0.285
NP_441494.1_6 Reverse -238 -251 8.08242 0.242
NP_442993.1_1 Reverse -339 -355 -9.5779 0.188
NP_442993.1_1 Reverse -240 -256 -11.2495 0.24
NP_442386.1_9 Reverse -338 -347 15.7322 0.0144
NP_442386.1_9 Forward -349 -340 6.39082 0.219
NP_440570.1_5 Reverse -143 -162 6.4893 0.185
NP_440570.1_5 Reverse -66 -85 -3.63879 0.291
NP_441340.1_5 Forward -347 -340 15.6737 0.0124
NP_441340.1_5 Reverse -340 -347 15.6737 0.0124
NP_442791.1_5 Reverse -331 -350 -8.16202 0.279
NP_442791.1_9 Reverse -235 -254 15.5349 0.155
NP_440327.1_6 Forward -302 -283 6.88262 0.229
NP_442240.1_2 Reverse -99 -118 -20.945 0.3
NP_440161.1_3 Forward -350 -331 16.2241 0.084
NP_440586.1_1 Reverse -149 -168 -1.57384 0.237
NP_440586.1_8 Forward -347 -340 13.2151 0.026
NP_440586.1_8 Reverse -340 -347 13.2151 0.026
NP_440586.1_8 Forward -12 -5 7.51192 0.239
NP_442251.1_6 Forward -347 -340 15.2804 0.0124
NP_442251.1_6 Reverse -340 -347 15.2804 0.0124
NP_440684.1_9 Reverse -333 -347 11.7993 0.168
NP_441262.1_3 Reverse -339 -346 14.7888 0.0223
NP_441262.1_3 Forward -348 -341 14.7888 0.0223
NP_440027.1_3 Forward -253 -235 6.40989 0.225
NP_440027.1_3 Reverse -227 -245 4.44329 0.26
NP_440027.1_8 Forward -159 -140 7.4718 0.261
NP_443051.1_1 Forward -349 -340 19.5676 0.00335
NP_443051.1_1 Reverse -338 -347 10.4228 0.00754
NP_441232.1_10 Reverse -328 -347 13.7658 0.0688
NP_439937.1_9 Reverse -242 -259 -13.8265 0.287
NP_439937.1_9 Forward -169 -152 -14.2198 0.287
NP_439937.1_9 Reverse -338 -355 -16.5797 0.287
NP_440371.1_4 Reverse -244 -263 8.75009 0.286
NP_440408.1_10 Forward -255 -236 9.14423 0.176
NP_440408.1_10 Forward -258 -239 7.96426 0.185
NP_440626.1_1 Forward -347 -328 8.55343 0.299
NP_440439.1_1 Forward -351 -338 10.934 0.0339
NP_440439.1_1 Reverse -336 -349 1.00259 0.164
NP_440372.1_2 Forward -347 -340 16.3621 0.0124
NP_440372.1_2 Reverse -340 -347 16.3621 0.0124
NP_441789.1_7 Reverse -229 -248 -4.22953 0.28
NP_440316.1_10 Reverse -146 -156 7.25653 0.251
NP_441803.1_2 Forward -251 -232 0.294447 0.255
NP_441803.1_2 Forward -248 -229 -0.688862 0.284
NP_440267.1_2 Forward -353 -339 21.6317 0.00946
NP_442384.1_10 Forward -348 -335 7.09911 0.0875
NP_442384.1_10 Reverse -339 -352 2.57589 0.22
NP_442384.1_10 Forward -19 -6 2.2809 0.23
NP_442384.1_10 Reverse -4 -17 0.314277 0.294
NP_442085.1_1 Reverse -179 -198 10.265 0.278
NP_441604.1_4 Reverse -139 -158 -5.01543 0.248
NP_441877.1_5 Reverse -132 -151 1.57275 0.276
NP_441877.1_7 Reverse -226 -245 1.6703 0.242
NP_441018.1_7 Reverse -266 -285 9.0459 0.236
NP_441018.1_7 Reverse -223 -242 6.58763 0.285
NP_442790.1_4 Reverse -330 -349 -5.60541 0.144
NP_442262.1_10 Forward -347 -340 14.1988 0.0123
NP_442262.1_10 Reverse -340 -347 14.1988 0.0123
NP_441689.1_5 Forward -350 -340 8.3377 0.132
NP_440344.1_10 Forward -355 -338 0.432165 0.0358
NP_440344.1_10 Reverse -332 -349 -3.40274 0.0825
NP_440344.1_10 Reverse -230 -247 -12.2525 0.246
NP_440531.1_6 Forward -356 -337 -5.40875 0.297
NP_440531.1_6 Forward -157 -138 -5.40875 0.297
NP_442123.1_3 Forward -348 -329 10.2259 0.294
NP_442910.1_1 Forward -355 -336 -8.35868 0.291
NP_440189.1_10 Reverse -328 -347 6.58763 0.249
NP_441640.1_8 Reverse -148 -167 -4.22878 0.26
NP_442529.1_4 Reverse -330 -349 13.3725 0.175
NP_440297.1_9 Forward -347 -337 -0.118297 0.282
NP_440297.1_9 Reverse -340 -350 -0.216628 0.282
NP_442280.1_10 Forward -89 -71 12.5647 0.177
NP_442280.1_10 Forward -94 -76 6.13623 0.28
NP_440999.1_9 Reverse -233 -247 1.76955 0.158
NP_440999.1_9 Forward -247 -233 -2.55701 0.27
NP_440888.1_2 Reverse -339 -353 12.8803 0.0369
NP_440888.1_2 Forward -348 -334 7.17714 0.205
NP_440888.1_2 Forward -168 -154 6.68548 0.223
NP_440888.1_2 Reverse -243 -257 5.01387 0.298
NP_440792.1_5 Forward -347 -328 7.66927 0.237
NP_440792.1_5 Reverse -340 -359 6.29264 0.237
NP_440600.1_4 Reverse -331 -349 10.8356 0.0557
NP_442277.1_4 Reverse -115 -134 2.85027 0.237
NP_441759.1_2 Forward -356 -337 0.884433 0.22
NP_441543.1_2 Forward -347 -338 18.486 0.00236
NP_441543.1_2 Reverse -340 -349 15.9293 0.00518
NP_442845.1_2 Forward -291 -277 5.60446 0.228
NP_440771.1_2 Reverse -339 -358 10.0292 0.293
NP_441469.1_8 Reverse -338 -347 16.126 0.00797
NP_441469.1_8 Forward -349 -340 6.5879 0.227
NP_443064.1_6 Reverse -339 -349 10.8217 0.13
NP_442578.1_7 Forward -347 -340 14.5921 0.026
NP_442578.1_7 Reverse -340 -347 14.5921 0.026
NP_440710.1_1 Reverse -331 -349 -7.94566 0.249
NP_440071.1_1 Forward -157 -140 8.10125 0.295
NP_441462.1_2 Reverse -339 -349 20.2362 0.000805
NP_441462.1_2 Forward -348 -338 11.5831 0.00406
NP_441621.1_7 Reverse -337 -351 -5.60527 0.256
NP_441621.1_7 Forward -248 -234 -5.90027 0.267
NP_443062.1_1 Reverse -339 -357 20.4418 0.0208
NP_443062.1_1 Reverse -276 -294 8.15589 0.159
NP_443062.1_1 Forward -348 -330 7.27833 0.18
NP_442204.1_1 Forward -352 -341 2.02529 0.266
NP_442204.1_1 Forward -153 -142 0.255333 0.282
NP_440516.1_8 Forward -348 -339 16.9127 0.00442
NP_440516.1_8 Reverse -339 -348 16.9127 0.00442
NP_441033.1_2 Reverse -329 -348 -8.06369 0.293
NP_442428.1_5 Forward -347 -340 15.8704 0.0124
NP_442428.1_5 Reverse -340 -347 15.8704 0.0124
NP_442120.1_10 Reverse -237 -256 4.52268 0.141
NP_442823.1_8 Forward -290 -271 9.93088 0.299
NP_440673.1_2 Forward -256 -237 9.41407 0.245
NP_440673.1_3 Forward -346 -339 12.4288 0.0426
NP_440673.1_3 Reverse -341 -348 12.4288 0.0426
NP_440673.1_3 Forward -8 -1 8.29892 0.221
NP_440673.1_3 Forward -315 -308 8.20058 0.234
NP_440673.1_7 Reverse -142 -161 0.786102 0.262
NP_440865.1_9 Forward -255 -236 6.78429 0.0689
NP_441052.1_2 Forward -348 -338 10.5014 0.0285
NP_441052.1_2 Reverse -339 -349 10.4031 0.0285
NP_442219.1_9 Forward -347 -338 8.35786 0.0681
NP_442219.1_9 Reverse -340 -349 8.25953 0.0681
NP_440436.1_4 Forward -347 -338 18.1905 0.00233
NP_440436.1_4 Reverse -340 -349 9.24241 0.0871
NP_441884.1_8 Forward -349 -330 -7.86702 0.254
NP_441884.1_9 Forward -351 -332 -23.2067 0.284
NP_442864.1_3 Reverse -333 -352 7.07928 0.284
NP_440314.1_9 Reverse -340 -359 2.16274 0.0862
NP_441719.1_4 Forward -347 -340 16.3621 0.0124
NP_441719.1_4 Reverse -340 -347 16.3621 0.0124
NP_441733.1_10 Forward -351 -338 8.27909 0.14
NP_442813.1_4 Reverse -138 -157 -5.31042 0.299
NP_442366.1_3 Reverse -338 -356 -3.71743 0.255
NP_442366.1_5 Reverse -336 -346 13.3526 0.0775
NP_442695.1_3 Forward -117 -103 16.4202 0.213
NP_442873.1_9 Forward -256 -237 5.99684 0.259
NP_443054.1_2 Forward -350 -336 9.04604 0.102
NP_440508.1_2 Reverse -198 -217 14.9324 0.234
NP_441851.1_10 Reverse -338 -348 16.008 0.00552
NP_441851.1_10 Forward -349 -339 8.53483 0.114
NP_442622.1_1 Forward -349 -330 -1.7705 0.177
NP_442622.1_1 Reverse -227 -246 -7.08038 0.257
NP_442622.1_8 Forward -348 -330 -9.12563 0.143
NP_441668.1_3 Reverse -99 -118 13.9625 0.111
NP_441668.1_4 Forward -108 -89 -2.16383 0.288
NP_442515.1_1 Reverse -9 -23 -0.492064 0.224
NP_442515.1_1 Forward -349 -335 -3.24533 0.289
NP_440593.1_3 Forward -257 -238 -1.7705 0.215
NP_440593.1_3 Forward -301 -282 -4.03212 0.244
NP_440593.1_9 Forward -249 -235 10.226 0.24
NP_440593.1_9 Reverse -231 -245 10.226 0.24
NP_441982.1_6 Forward -334 -325 11.3395 0.288
NP_440165.1_5 Reverse -338 -357 1.27776 0.128
NP_441046.1_2 Forward -257 -238 -1.47551 0.29
NP_441349.1_10 Forward -358 -339 6.88262 0.0342
NP_440389.1_3 Forward -255 -236 13.7658 0.232
NP_440432.1_9 Reverse -340 -355 13.3529 0.0197
NP_440432.1_9 Forward -347 -332 9.71466 0.0419
NP_442843.1_1 Forward -347 -328 1.67108 0.165
NP_442843.1_1 Reverse -364 -383 -11.6036 0.291
NP_439960.1_10 Reverse -227 -245 2.96908 0.165
NP_440474.1_8 Forward -347 -333 7.07881 0.21
NP_440474.1_8 Reverse -340 -354 4.71887 0.268
NP_440474.1_8 Reverse -241 -255 4.32555 0.284
NP_440396.1_10 Forward -388 -372 9.89093 0.259
NP_440431.1_4 Forward -386 -367 -4.15432 0.224
NP_442450.1_5 Reverse -337 -347 7.55152 0.13
NP_442168.1_5 Reverse -277 -296 1.86774 0.235
NP_440943.1_4 Reverse -69 -81 16.5586 0.122
NP_442006.1_2 Reverse -76 -93 -18.0541 0.287
NP_442006.1_2 Reverse -330 -347 -18.2507 0.289
NP_442006.1_2 Reverse -287 -304 -18.7424 0.295
NP_441570.1_1 Forward -348 -330 2.67408 0.0239
NP_441570.1_1 Reverse -339 -357 -10.3056 0.166
NP_441078.1_4 Forward -348 -339 19.6659 0.0007
NP_441078.1_4 Reverse -339 -348 19.6659 0.0007
NP_441078.1_4 Reverse -237 -246 -1.57357 0.266
NP_442443.1_1 Forward -347 -328 0.392778 0.218
NP_442443.1_1 Forward -260 -241 -1.96717 0.246
NP_442443.1_4 Reverse -121 -131 16.1058 0.155
NP_442906.1_9 Reverse -213 -232 7.86593 0.207
NP_440526.1_3 Reverse -340 -351 1.92649 0.267
NP_441432.1_8 Forward -349 -340 16.8143 0.00595
NP_441432.1_8 Reverse -338 -347 8.25953 0.0755
NP_442320.1_8 Forward -354 -340 5.30946 0.0394
NP_442320.1_8 Reverse -333 -347 4.91614 0.0442
NP_442344.1_7 Forward -347 -328 -6.09707 0.17
NP_442344.1_7 Reverse -340 -359 -6.68705 0.172
NP_440760.1_1 Forward -348 -329 -20.8467 0.225
NP_442797.1_7 Forward -169 -151 1.59244 0.257
NP_442146.1_8 Forward -254 -235 14.7491 0.271
NP_441945.1_10 Reverse -140 -159 11.4058 0.238
NP_441805.1_2 Forward -263 -244 -4.52377 0.275
NP_442489.1_7 Forward -348 -339 20.1576 0.000695
NP_442489.1_7 Reverse -339 -348 20.1576 0.000695
NP_442489.1_7 Reverse -237 -246 -1.08191 0.179
NP_440565.1_7 Forward -263 -244 -2.16383 0.291
NP_442079.1_7 Forward -347 -328 2.3594 0.229
NP_440559.1_1 Forward -347 -338 8.75118 0.0586
NP_440559.1_1 Reverse -340 -349 8.65285 0.0586
NP_441659.2_8 Reverse -339 -349 20.9245 0.000805
NP_441659.2_8 Forward -348 -338 11.9764 0.0147
NP_442913.1_10 Forward -357 -338 -4.72043 0.244
NP_441040.1_2 Reverse -145 -164 -14.1602 0.285
NP_441185.1_6 Forward -301 -282 2.55606 0.208
NP_442346.1_5 Forward -349 -339 16.303 0.00248
NP_442346.1_5 Reverse -338 -348 9.02648 0.118
NP_442346.1_5 Forward -14 -4 6.46988 0.201
NP_440545.1_3 Forward -294 -277 -0.157821 0.149
NP_440831.1_1 Reverse -302 -321 13.3725 0.261
NP_440831.1_3 Reverse -150 -169 4.63975 0.298
NP_440459.1_2 Forward -158 -141 12.6252 0.142
NP_441585.1_7 Forward -272 -253 19.3707 0.184
NP_441888.1_7 Reverse -334 -348 2.85119 0.225
NP_441888.1_7 Forward -353 -339 2.35953 0.225
NP_441948.1_4 Reverse -332 -350 6.11567 0.067
NP_441833.1_4 Forward -347 -340 15.9687 0.0124
NP_441833.1_4 Reverse -340 -347 15.9687 0.0124
NP_441112.1_5 Forward -365 -346 6.4893 0.277
NP_442162.1_9 Forward -347 -340 16.2637 0.0124
NP_442162.1_9 Reverse -340 -347 16.2637 0.0124
NP_440772.1_6 Forward -347 -328 12.8808 0.202
NP_440204.1_4 Forward -137 -118 0.392778 0.287
NP_442199.1_5 Forward -356 -337 9.53756 0.0606
NP_442140.1_3 Forward -347 -337 16.2046 0.0255
NP_442140.1_3 Reverse -340 -350 4.69992 0.238
NP_442914.1_8 Forward -257 -238 7.7676 0.237
NP_441671.1_10 Forward -359 -340 3.6377 0.222
NP_440875.1_9 Reverse -341 -351 15.867 0.0233
NP_441813.1_5 Forward -350 -340 18.1713 0.00743
NP_441813.1_5 Reverse -337 -347 9.91146 0.021
NP_440590.1_4 Forward -347 -334 1.39592 0.125
NP_440590.1_4 Reverse -340 -353 -4.20895 0.258
NP_440567.1_1 Forward -347 -333 4.81781 0.111
NP_440567.1_1 Reverse -340 -354 -0.0987402 0.264
NP_442497.1_10 Reverse -340 -349 17.601 0.00813
NP_442497.1_10 Forward -347 -338 10.4228 0.0087
NP_440821.1_4 Reverse -337 -347 10.2065 0.0163
NP_440821.1_4 Forward -350 -340 2.24165 0.131
NP_441239.1_9 Forward -350 -338 15.5753 0.0186
NP_441239.1_9 Reverse -337 -349 12.3303 0.0477
NP_441892.1_1 Forward -158 -141 3.57876 0.123
NP_441892.1_1 Reverse -330 -347 2.49712 0.14
NP_442270.1_6 Forward -349 -331 15.8504 0.279
NP_442270.1_10 Forward -250 -232 17.6204 0.15
NP_441874.1_1 Forward -300 -286 8.75105 0.294
NP_441541.1_7 Forward -122 -104 8.84397 0.294
NP_442138.1_10 Reverse -339 -358 -4.81876 0.266
NP_442138.1_10 Forward -348 -329 -6.49039 0.285
NP_440546.1_4 Reverse -339 -349 13.5365 0.0459
NP_440546.1_4 Forward -348 -338 11.8882 0.0679
NP_440546.1_6 Forward -262 -243 9.3409 0.247
NP_440546.1_7 Reverse -147 -157 17.0896 0.234
NP_441603.1_5 Reverse -50 -69 15.8299 0.163
NP_440675.1_3 Forward -348 -329 7.17762 0.25
NP_440462.1_6 Forward -350 -340 18.7612 0.00454
NP_440462.1_6 Reverse -337 -347 9.02648 0.0498
NP_440462.1_6 Forward -287 -277 3.91327 0.224
NP_440868.1_4 Reverse -335 -347 8.39711 0.0602
NP_440868.1_4 Forward -352 -340 7.80712 0.0637
NP_441474.1_1 Reverse -329 -348 4.62021 0.221
NP_442840.1_7 Forward -253 -234 7.27595 0.204
NP_442402.1_2 Forward -169 -155 13.8636 0.263
NP_442402.1_4 Reverse -315 -334 3.73524 0.149
NP_442402.1_4 Reverse -104 -123 3.53858 0.152
NP_442402.1_4 Reverse -273 -292 -8.94939 0.285
NP_442402.1_10 Reverse -324 -334 14.8275 0.18
NP_442402.1_10 Forward -165 -155 11.091 0.269
NP_441848.1_4 Forward -115 -99 7.93263 0.288
NP_442258.1_2 Reverse -142 -161 -2.75381 0.198
NP_441084.1_6 Forward -350 -336 16.2281 0.0689
NP_441843.2_9 Reverse -341 -359 9.42214 0.285
NP_442039.1_4 Forward -347 -340 15.1821 0.0124
NP_442039.1_4 Reverse -340 -347 15.1821 0.0124
NP_442039.1_7 Forward -337 -327 7.94484 0.269
NP_441926.1_3 Reverse -339 -355 7.63002 0.17
NP_440825.1_6 Forward -143 -124 11.0125 0.282
NP_440825.1_7 Forward -347 -337 12.4217 0.155
NP_442837.1_3 Forward -347 -340 15.7721 0.0124
NP_442837.1_3 Reverse -340 -347 15.7721 0.0124
NP_440160.1_10 Forward -260 -241 16.4207 0.244
NP_442053.1_1 Forward -348 -339 18.3876 0.0007
NP_442053.1_1 Reverse -339 -348 18.3876 0.0007
NP_440505.1_3 Forward -350 -340 17.188 0.00332
NP_440505.1_3 Reverse -337 -347 6.76487 0.169
NP_442360.1_5 Forward -262 -252 14.238 0.237
NP_441102.1_3 Forward -120 -101 19.469 0.0904
NP_442532.1_7 Forward -348 -334 3.63784 0.192
NP_441408.2_7 Forward -287 -268 9.53756 0.102
NP_440914.1_1 Reverse -339 -349 16.3248 0.00196
NP_440914.1_1 Forward -348 -338 8.6151 0.186
NP_441011.1_8 Forward -347 -338 16.9127 0.00602
NP_441011.1_8 Reverse -340 -349 16.6177 0.00602
NP_442533.1_6 Forward -348 -339 17.2076 0.00137
NP_442533.1_6 Reverse -339 -348 17.2076 0.00137
NP_442533.1_6 Forward -246 -237 5.50626 0.14
NP_442533.1_6 Reverse -237 -246 4.22796 0.186
NP_441089.1_10 Forward -374 -355 0.982764 0.294
NP_441482.1_7 Forward -354 -340 -4.62196 0.153
NP_439944.1_9 Reverse -340 -350 9.12481 0.1
NP_441749.1_8 Forward -245 -226 16.0274 0.176
NP_441028.1_6 Reverse -325 -335 10.0093 0.21
NP_441028.1_6 Reverse -326 -336 8.04271 0.217
NP_441527.1_1 Forward -317 -298 21.8289 0.0145
NP_441527.1_3 Forward -292 -273 24.1889 0.00863
NP_441527.1_8 Forward -365 -346 10.0292 0.221
NP_440115.1_6 Forward -351 -341 4.89658 0.28
NP_440007.1_9 Forward -294 -280 0.88457 0.29
NP_441602.1_3 Reverse -238 -257 5.11266 0.145
NP_441602.1_4 Reverse -328 -347 10.8159 0.278
NP_441170.1_4 Reverse -330 -348 6.41066 0.205
NP_441106.1_1 Forward -349 -340 18.486 0.0028
NP_441106.1_1 Reverse -338 -347 18.191 0.0028
NP_441106.1_1 Reverse -236 -245 2.85133 0.255
NP_439903.1_6 Forward -351 -332 -0.39464 0.282
NP_439903.1_7 Reverse -148 -167 8.06259 0.255
NP_442588.1_4 Reverse -238 -257 16.9124 0.237
NP_442588.1_6 Reverse -92 -111 -0.983855 0.268
NP_442306.1_10 Forward -353 -334 -9.73531 0.11
NP_442306.1_10 Forward -99 -80 -21.9284 0.296
NP_441286.1_1 Forward -349 -337 -3.40261 0.145
NP_441286.1_1 Reverse -338 -350 -3.59927 0.145
NP_440670.1_8 Forward -348 -339 18.3876 0.000699
NP_440670.1_8 Reverse -339 -348 18.3876 0.000699
NP_440886.1_7 Reverse -338 -348 17.7774 0.0011
NP_440886.1_7 Forward -349 -339 8.04271 0.0805
NP_440828.1_1 Reverse -229 -248 -0.197979 0.269
NP_440828.1_4 Forward -253 -234 -1.18128 0.204
NP_440083.1_2 Forward -293 -274 5.11266 0.124
NP_442072.1_9 Forward -231 -213 -21.8103 0.212
NP_440513.1_6 Forward -358 -339 13.9616 0.189
NP_442022.1_4 Reverse -380 -399 8.06259 0.268
NP_440907.2_8 Forward -347 -337 14.2375 0.0312
NP_440907.2_8 Reverse -340 -350 9.616 0.103
NP_442264.1_2 Forward -23 -6 6.03703 0.267
NP_441021.1_1 Forward -161 -142 -12.2919 0.283
NP_441021.1_8 Forward -353 -335 5.42735 0.215
NP_441463.1_3 Reverse -329 -348 9.43923 0.0481
NP_441463.1_3 Forward -358 -339 7.17762 0.0545
NP_441463.1_3 Forward -20 -1 -7.57203 0.259
NP_441463.1_5 Reverse -338 -352 12.4876 0.188
NP_441626.1_2 Forward -347 -340 15.7721 0.0124
NP_441626.1_2 Reverse -340 -347 15.7721 0.0124
NP_442211.1_9 Forward -254 -235 2.45773 0.247
NP_442794.1_1 Forward -294 -282 7.70879 0.132
NP_441401.1_1 Forward -119 -100 15.2408 0.135
NP_442615.1_1 Forward -357 -339 -1.06249 0.124
NP_441962.1_4 Forward -251 -232 2.85105 0.102
NP_440387.1_1 Forward -348 -332 7.63002 0.0282
NP_441431.1_2 Forward -351 -337 14.4536 0.0655
NP_441431.1_2 Reverse -240 -254 8.25877 0.221
NP_441431.1_2 Forward -246 -232 7.07881 0.251
NP_441993.1_1 Forward -252 -233 1.4594 0.276
NP_442084.1_6 Forward -299 -281 4.9357 0.276
NP_441174.1_2 Forward -255 -241 14.2576 0.172
NP_441174.1_4 Reverse -298 -308 13.943 0.267
NP_440114.1_10 Reverse -339 -353 19.0758 0.00367
NP_440114.1_10 Forward -348 -334 11.406 0.115
NP_440287.1_5 Reverse -324 -343 10.3234 0.286
NP_440766.1_4 Reverse -155 -169 0.392915 0.286
NP_440766.1_5 Forward -334 -322 8.41973 0.277
NP_441237.1_9 Forward -284 -274 11.2881 0.189
NP_439910.1_2 Forward -356 -339 -22.0856 0.207
NP_442867.1_8 Forward -346 -327 4.32602 0.284
NP_440457.1_1 Reverse -149 -161 0.23564 0.25
NP_440457.1_1 Forward -352 -340 -0.551008 0.268
NP_440798.1_6 Forward -347 -334 4.54251 0.145
NP_442680.1_5 Forward -124 -105 1.24451 0.248
NP_442297.1_4 Forward -294 -275 14.3777 0.201
NP_442297.1_4 Reverse -335 -354 14.2804 0.207
NP_440473.1_9 Reverse -74 -93 -8.55534 0.252
NP_440473.1_9 Reverse -328 -347 -9.14533 0.26
NP_440473.1_9 Reverse -226 -245 -11.1119 0.288
NP_442509.1_9 Forward -348 -338 16.2041 0.00739
NP_442509.1_9 Reverse -339 -349 8.04271 0.192
NP_440554.1_4 Reverse -340 -350 17.9746 0.0131
NP_440554.1_4 Forward -347 -337 7.35486 0.103
NP_441885.1_5 Forward -348 -338 11.4848 0.00668
NP_441885.1_5 Reverse -339 -349 11.3864 0.00668
NP_440478.1_10 Reverse -337 -351 8.35772 0.257
NP_441428.1_8 Reverse -229 -248 2.55606 0.268
NP_442341.1_7 Forward -163 -149 1.67122 0.282
NP_442341.1_9 Reverse -337 -351 5.21053 0.277
NP_442341.1_9 Forward -350 -336 4.62054 0.296
NP_441173.1_9 Reverse -351 -359 12.9004 0.206
NP_441173.1_9 Reverse -327 -335 11.3271 0.226
NP_441173.1_9 Reverse -326 -334 11.3271 0.226
NP_442534.1_7 Reverse -331 -350 6.58763 0.272
NP_440423.1_6 Forward -356 -337 -14.6519 0.229
NP_443000.1_7 Forward -350 -340 20.3345 0.00223
NP_443000.1_7 Reverse -337 -347 1.94665 0.226
NP_441842.1_10 Reverse -332 -346 11.2093 0.138
NP_440275.1_3 Forward -350 -340 16.1063 0.0155
NP_440275.1_3 Reverse -337 -347 8.33817 0.0602
NP_442932.1_9 Forward -345 -326 3.6377 0.298
NP_440091.1_1 Forward -352 -340 1.41561 0.197
NP_440091.1_1 Reverse -335 -347 1.41561 0.197
NP_441902.1_3 Forward -335 -325 11.524 0.298
NP_440679.1_10 Forward -346 -327 -17.7001 0.275
NP_441359.1_5 Reverse -143 -162 1.86774 0.285
NP_439962.1_4 Reverse -226 -245 -8.06369 0.292
NP_439962.1_4 Forward -245 -226 -8.752 0.298
NP_440149.1_8 Forward -348 -329 2.26107 0.112
NP_440149.1_8 Reverse -153 -172 -7.67036 0.29
NP_441804.1_9 Reverse -293 -309 20.3147 0.15
NP_442373.1_2 Reverse -150 -169 -7.4737 0.233
NP_440216.1_1 Reverse -339 -353 15.8309 0.00314
NP_440216.1_1 Forward -348 -334 5.40779 0.0209
NP_440216.1_9 Forward -283 -274 10.4228 0.286
NP_440216.1_9 Forward -148 -139 7.17789 0.286
NP_440172.1_1 Reverse -339 -349 17.5813 0.00421
NP_440172.1_1 Forward -348 -338 8.73149 0.0586
NP_442015.1_10 Forward -294 -281 2.47756 0.191
NP_442015.1_10 Reverse -335 -348 1.78924 0.204
NP_441226.1_7 Forward -347 -340 14.4934 0.0123
NP_441226.1_7 Reverse -340 -347 14.4934 0.0123
NP_442034.1_7 Forward -259 -241 8.57394 0.245
NP_441111.1_7 Forward -347 -339 18.7023 0.00294
NP_441111.1_7 Reverse -340 -348 18.7023 0.00294
NP_441766.1_2 Forward -348 -339 17.5026 0.00297
NP_441766.1_2 Reverse -339 -348 17.5026 0.00297
NP_442417.1_5 Forward -348 -334 10.6193 0.11
NP_442252.1_3 Forward -355 -337 9.95058 0.224
NP_440416.1_1 Reverse -339 -358 15.7324 0.0223
NP_440416.1_9 Reverse -226 -245 -18.8801 0.266
NP_443052.1_8 Forward -358 -339 -0.295539 0.0688
NP_443052.1_8 Reverse -75 -94 -10.4236 0.208
NP_443052.1_9 Reverse -142 -161 -4.42544 0.258
NP_443052.1_9 Forward -166 -147 -6.39206 0.282
NP_440261.1_5 Reverse -340 -353 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCAGCCCTACATCAAAGACCAAAATCTCACCATTGAAGAGTTGGTTAAACAGGCGATCGCCGAATTGGGGGAAAACATCCAAGTTCGTCGCTTTATCCGCTTTAACCTTGGTGAAGGCATCGAAAAAGCAGAAACCAACTTTGCGGAAGAAGTGGCCGCCGCCGCTAAGGGCTAGTAACTCAGGCTTGATTACCGCACTACTTATTAGCTAAATCTAAGAACCTTTTGAACCCAGATTTCCACCGCCACAGGCCAGGGAAGATTTGGGTTTTTGCTTTTGGGATAAACCCCAGAAAATCTTGGCAGCCCATCTTTGCTTTGCCCAGAGAGTGTGTCAAAATCGTGGGTAACTTAGTCTGTCCTAGGCTTCCATAACTTATAATTATCGCCATCATTGCT

CDS

ATGTTGCCATTGCCATTAATTGCTAACGGAAAAGGATTTATCCGCGCTCTAGAAAACGACGGGGCTTTGGCAGTGTATGCCCCCCTAGAAGGTGGTTATGAAGGTCGTTACCAAAGACGCCTACGGGCCAACGGCTACGCCAGTATATCCCTTTCGGCAAGGGGTTTGGGGGACGTGGAAGCCTATTTGATGCAAGTCCATGGAGTACGTCCGGCCCATTTAGGTAAGAAAAACATTGCCCAAGAAGGAGCGGTGGGACCGATTTATTTTGCCCAGCCGATCGCCGGTTATCAGTTGGAAAATTTACCGGCCCAAAGTAAAGGTTTGGTGTTGTGGATTTTGGAAGGTTATATTCTCTCCCAAACCGAAATTCAAGACTTAATTAGTCTCACCAAAAGAGTGCCCAAACTGAAAGTGGTGTTGGAAATGGGCGGCGATCGGGTTTTCCGCTGGCAACCTTTACTGGATTGCTTGCAGGCGGCCTAG

Protein

MLPLPLIANGKGFIRALENDGALAVYAPLEGGYEGRYQRRLRANGYASISLSARGLGDVEAYLMQVHGVRPAHLGKKNIAQEGAVGPIYFAQPIAGYQLENLPAQSKGLVLWILEGYILSQTEIQDLISLTKRVPKLKVVLEMGGDRVFRWQPLLDCLQAA