Your browser is old and dusty. Try Google Chrome!

Details for sll1258

ORF sll1258
Accession NP_441469.1
Symbol
Category Pyrimidine ribonucleotide biosynthesis
Definition dCTP deaminase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -57 -43 4.52282 0.147
NP_441061.1_2 Reverse -50 -64 -0.590395 0.234
NP_440795.1_7 Forward -57 -50 14.6904 0.0123
NP_440795.1_7 Reverse -50 -57 14.6904 0.0123
NP_442100.1_1 Forward -197 -178 5.0129 0.3
NP_441418.1_6 Reverse -49 -68 -11.9969 0.0586
NP_441418.1_6 Forward -58 -39 -18.8801 0.0839
NP_442657.1_1 Reverse -344 -361 11.0337 0.245
NP_442657.1_5 Reverse -12 -26 15.7511 0.293
NP_442291.1_5 Forward -59 -43 3.00846 0.116
NP_440897.1_6 Reverse -49 -68 9.7334 0.0705
NP_441453.1_4 Reverse -49 -57 16.539 0.00633
NP_441453.1_4 Forward -58 -50 16.539 0.00633
NP_442151.1_6 Forward -58 -44 18.4858 0.0071
NP_442151.1_6 Reverse -49 -63 10.521 0.122
NP_441818.1_1 Forward -57 -46 18.8393 0.00301
NP_440226.1_1 Forward -58 -39 1.96607 0.282
NP_441342.1_2 Reverse -131 -145 16.3225 0.174
NP_441098.1_3 Reverse -184 -203 -4.20496 0.28
NP_442173.1_1 Forward -57 -49 15.4574 0.00633
NP_442173.1_1 Reverse -50 -58 15.4574 0.00633
NP_442752.1_4 Forward -58 -51 13.8055 0.0199
NP_442752.1_4 Reverse -49 -56 13.8055 0.0199
NP_443027.1_4 Reverse -47 -57 14.0414 0.0452
NP_443027.1_4 Forward -60 -50 5.87989 0.294
NP_442975.1_10 Forward -62 -48 19.6651 0.00325
NP_442975.1_10 Reverse -45 -59 5.01387 0.234
NP_440784.1_7 Forward -57 -50 15.9687 0.0123
NP_440784.1_7 Reverse -50 -57 15.9687 0.0123
NP_442909.1_7 Forward -57 -43 6.29216 0.252
NP_441476.1_5 Reverse -38 -57 -4.72043 0.255
NP_441476.1_5 Forward -42 -23 -6.49039 0.274
NP_442062.1_8 Reverse -49 -59 19.4496 0.000558
NP_442062.1_8 Forward -58 -48 17.3846 0.00193
NP_440304.1_4 Reverse -47 -57 10.8948 0.051
NP_440304.1_4 Forward -60 -50 1.84832 0.299
NP_442242.1_4 Forward -57 -50 14.3954 0.0124
NP_442242.1_4 Reverse -50 -57 14.3954 0.0124
NP_440044.1_8 Forward -57 -38 12.0942 0.0449
NP_441581.1_6 Forward -67 -48 12.589 0.283
NP_441594.1_6 Reverse -40 -59 2.3594 0.252
NP_440370.1_10 Reverse -40 -59 7.37428 0.258
NP_442110.1_7 Forward -58 -44 10.1277 0.0684
NP_442110.1_7 Reverse -49 -63 2.35953 0.222
NP_440014.1_7 Forward -67 -53 17.3052 0.119
NP_441083.1_5 Forward -58 -48 20.3345 0.00053
NP_441083.1_5 Reverse -49 -59 11.3864 0.0159
NP_442827.1_8 Forward -66 -47 -2.36125 0.274
NP_441738.1_2 Forward -56 -49 15.28 0.0102
NP_441738.1_2 Reverse -51 -58 15.28 0.0102
NP_441738.1_4 Reverse -39 -58 7.07928 0.203
NP_441558.1_5 Reverse -47 -66 6.78429 0.202
NP_440209.1_1 Reverse -49 -57 18.1123 0.00295
NP_440209.1_1 Forward -58 -50 18.1123 0.00295
NP_442889.1_8 Forward -61 -47 11.4053 0.0733
NP_442889.1_8 Reverse -46 -60 3.73557 0.273
NP_442398.1_3 Forward -125 -106 16.5752 0.298
NP_441713.1_1 Reverse -43 -62 -16.1268 0.277
NP_440178.1_7 Forward -59 -40 -14.5535 0.155
NP_441716.1_1 Forward -58 -44 15.3392 0.0498
NP_441716.1_2 Forward -246 -227 7.47092 0.229
NP_443013.1_8 Forward -106 -88 7.59063 0.299
NP_442111.1_4 Reverse -48 -62 17.4042 0.0102
NP_441163.1_1 Forward -66 -49 10.2645 0.217
NP_440906.1_5 Forward -57 -50 15.8704 0.0124
NP_440906.1_5 Reverse -50 -57 15.8704 0.0124
NP_440747.1_10 Reverse -46 -58 7.51213 0.00286
NP_440747.1_10 Forward -61 -49 5.44718 0.0137
NP_441130.1_10 Reverse -47 -61 9.34103 0.126
NP_442973.1_5 Forward -67 -48 13.0775 0.183
NP_441486.1_1 Reverse -46 -60 22.2224 0.00191
NP_441486.1_1 Forward -61 -47 20.2558 0.00309
NP_440944.1_2 Reverse -2 -21 8.75091 0.151
NP_440403.1_4 Reverse -40 -59 -8.26035 0.251
NP_441014.1_10 Forward -59 -40 8.55343 0.131
NP_442848.1_1 Reverse -43 -57 16.5192 0.0143
NP_443018.1_3 Forward -57 -50 14.8871 0.0123
NP_443018.1_3 Reverse -50 -57 14.8871 0.0123
NP_443018.1_3 Forward -51 -44 8.49558 0.141
NP_441634.1_8 Reverse -47 -61 12.6843 0.0486
NP_440376.1_1 Forward -58 -49 19.4693 0.000692
NP_440376.1_1 Reverse -49 -58 19.4693 0.000692
NP_440376.1_1 Forward -261 -252 0.688044 0.262
NP_441588.1_4 Forward -56 -46 8.63316 0.14
NP_441588.1_4 Reverse -51 -61 7.25653 0.178
NP_442687.1_7 Forward -59 -49 15.8113 0.0125
NP_442687.1_7 Reverse -48 -58 8.92815 0.0994
NP_442687.1_7 Reverse -24 -34 3.61828 0.299
NP_441077.1_6 Reverse -117 -133 1.9342 0.293
NP_442485.1_3 Reverse -38 -57 -5.40875 0.291
NP_442946.1_6 Reverse -355 -374 14.5621 0.291
NP_442296.1_9 Reverse -50 -69 -4.72043 0.28
NP_442658.1_1 Forward -60 -50 15.9091 0.00966
NP_442658.1_1 Reverse -47 -57 6.76441 0.214
NP_442658.1_1 Reverse -41 -51 5.78111 0.25
NP_441414.1_9 Reverse -49 -68 -3.54046 0.138
NP_442937.1_5 Forward -266 -247 13.0775 0.095
NP_442937.1_5 Reverse -20 -39 8.55425 0.219
NP_441317.1_4 Forward -124 -110 15.0024 0.161
NP_441958.1_5 Forward -59 -49 12.2714 0.00183
NP_441958.1_5 Reverse -48 -58 12.2714 0.00183
NP_440318.1_1 Forward -282 -263 2.94938 0.261
NP_440950.1_8 Reverse -112 -131 17.5675 0.116
NP_440203.1_6 Reverse -158 -177 14.9441 0.238
NP_440984.1_7 Forward -63 -49 11.8976 0.122
NP_439990.1_5 Reverse -44 -57 19.4888 0.00712
NP_442690.1_1 Forward -213 -194 -6.58872 0.168
NP_442911.1_1 Forward -178 -165 16.3909 0.236
NP_442911.1_2 Forward -68 -49 6.19431 0.03
NP_441580.1_6 Reverse -38 -57 2.65439 0.117
NP_440153.1_5 Reverse -50 -64 5.21113 0.191
NP_440858.1_5 Reverse -76 -95 10.6184 0.248
NP_442064.1_4 Forward -271 -252 12.7816 0.147
NP_441099.1_5 Reverse -39 -58 6.19431 0.0468
NP_442002.1_9 Forward -59 -52 10.7572 0.185
NP_442002.1_9 Reverse -24 -31 9.08556 0.289
NP_441712.1_1 Reverse -116 -135 14.3526 0.251
NP_441712.1_3 Forward -164 -151 12.5073 0.288
NP_441294.1_7 Forward -62 -48 19.5214 0.00282
NP_441294.1_7 Forward -148 -134 10.1145 0.207
NP_441646.1_1 Forward -65 -46 12.7825 0.092
NP_442438.1_10 Forward -63 -49 10.4227 0.0536
NP_442438.1_10 Reverse -44 -58 6.19444 0.119
NP_441000.1_6 Reverse -48 -62 -4.03198 0.225
NP_441000.1_6 Forward -59 -45 -4.91696 0.254
NP_440147.1_4 Forward -60 -47 12.6056 0.0326
NP_440147.1_4 Reverse -47 -60 0.904263 0.244
NP_441550.1_8 Reverse -47 -57 12.3692 0.0336
NP_441550.1_8 Forward -60 -50 8.3377 0.124
NP_441916.1_7 Reverse -49 -59 18.4663 0.00144
NP_441916.1_7 Forward -58 -48 10.3048 0.0261
NP_440345.1_3 Reverse -367 -381 13.285 0.219
NP_441041.1_4 Forward -58 -39 0.687771 0.084
NP_441041.1_7 Forward -61 -49 9.65268 0.108
NP_442004.1_6 Forward -58 -44 1.86788 0.276
NP_441725.1_5 Forward -57 -47 11.2881 0.0247
NP_441725.1_5 Reverse -50 -60 2.04498 0.115
NP_439966.1_7 Reverse -47 -57 15.8108 0.0124
NP_439966.1_7 Forward -60 -50 9.91099 0.0968
NP_439966.1_9 Forward -60 -51 0.884706 0.253
NP_442941.1_3 Forward -57 -47 19.9412 0.00262
NP_442941.1_3 Reverse -50 -60 2.63497 0.14
NP_440289.1_2 Reverse -46 -59 6.60746 0.0591
NP_440289.1_2 Forward -61 -48 3.16588 0.0811
NP_442281.1_1 Forward -63 -49 11.7987 0.0437
NP_442281.1_1 Reverse -44 -58 8.75042 0.0764
NP_441079.1_7 Reverse -207 -226 0.883656 0.182
NP_442256.1_2 Reverse -47 -65 2.87075 0.107
NP_440437.1_1 Reverse -43 -62 -3.14714 0.232
NP_440437.1_1 Forward -64 -45 -3.73712 0.244
NP_441556.1_10 Forward -63 -49 16.8407 0.102
NP_441644.1_6 Forward -58 -48 17.3841 0.00127
NP_441644.1_6 Reverse -49 -59 10.1076 0.0628
NP_442215.1_2 Forward -60 -44 15.1032 0.0185
NP_442215.1_2 Reverse -47 -63 0.943514 0.144
NP_440253.1_2 Forward -58 -40 19.7837 0.00589
NP_440929.1_8 Forward -58 -49 19.2726 0.000701
NP_440929.1_8 Reverse -49 -58 19.2726 0.000701
NP_440780.1_1 Reverse -115 -134 7.87766 0.274
NP_442933.1_10 Forward -58 -49 17.601 0.00325
NP_442933.1_10 Reverse -49 -58 17.601 0.00325
NP_441751.2_8 Forward -57 -43 4.03116 0.0563
NP_442554.1_8 Forward -57 -47 15.9097 0.00747
NP_442554.1_8 Reverse -50 -60 13.2547 0.0187
NP_441762.1_7 Reverse -48 -60 10.1671 0.0142
NP_441762.1_7 Forward -59 -47 2.30059 0.0676
NP_442142.1_4 Reverse -46 -59 16.7349 0.0264
NP_442142.1_4 Forward -61 -48 4.73861 0.212
NP_442142.1_4 Forward -55 -42 2.18201 0.299
NP_442292.1_1 Forward -57 -48 18.486 0.00229
NP_442292.1_1 Reverse -50 -59 9.63616 0.0183
NP_442143.1_8 Forward -66 -47 11.7983 0.223
NP_443009.1_5 Reverse -48 -59 18.3477 0.00265
NP_443009.1_5 Forward -35 -24 3.69644 0.282
NP_441715.1_4 Forward -57 -47 14.828 0.0268
NP_441715.1_4 Reverse -50 -60 9.41981 0.097
NP_440357.1_6 Reverse -39 -58 2.94938 0.296
NP_440183.1_9 Reverse -51 -70 -16.4218 0.276
NP_440379.1_5 Reverse -40 -59 -11.5053 0.297
NP_441468.1_1 Forward -57 -50 15.8704 0.0124
NP_441468.1_1 Reverse -50 -57 15.8704 0.0124
NP_441020.2_6 Reverse -47 -64 7.217 0.237
NP_441015.1_10 Reverse -44 -63 -4.13045 0.199
NP_441673.1_1 Forward -58 -49 20.8459 0.000698
NP_441673.1_1 Reverse -49 -58 20.8459 0.000698
NP_441096.1_10 Forward -365 -352 18.3523 0.0718
NP_440265.1_4 Forward -63 -44 17.6373 0.287
NP_441826.1_2 Reverse -43 -57 13.5693 0.0214
NP_441826.1_2 Forward -64 -50 3.44117 0.11
NP_441826.1_2 Forward -58 -44 -0.492064 0.213
NP_441764.1_8 Reverse -115 -125 10.7365 0.3
NP_442868.1_6 Reverse -47 -57 9.91146 0.038
NP_442868.1_6 Forward -60 -50 0.865012 0.205
NP_441251.1_7 Reverse -185 -198 13.1956 0.266
NP_441056.1_1 Forward -58 -39 11.7008 0.0478
NP_441612.1_2 Reverse -115 -125 8.83972 0.21
NP_441612.1_2 Forward -58 -48 8.54929 0.21
NP_442361.1_3 Forward -64 -51 9.36073 0.276
NP_442808.1_1 Forward -59 -49 18.4657 0.00201
NP_442808.1_1 Reverse -48 -58 8.63269 0.0481
NP_441849.1_2 Reverse -65 -84 4.05798 0.245
NP_441849.1_7 Reverse -230 -243 17.8233 0.133
NP_440145.1_3 Reverse -39 -58 -1.37718 0.151
NP_442542.1_2 Forward -60 -47 11.3273 0.114
NP_442542.1_9 Forward -65 -51 5.60385 0.26
NP_442050.1_5 Reverse -47 -57 16.4991 0.00812
NP_442903.1_2 Reverse -110 -129 9.50102 0.165
NP_442342.1_9 Forward -60 -44 3.79511 0.258
NP_440558.1_2 Reverse -40 -59 -2.65548 0.229
NP_441518.1_3 Reverse -39 -58 -11.6036 0.261
NP_441878.1_6 Forward -59 -49 10.4031 0.0176
NP_441878.1_6 Reverse -48 -58 10.4031 0.0176
NP_441036.1_3 Reverse -1 -20 -0.197208 0.181
NP_441036.1_8 Forward -59 -49 17.7779 0.000554
NP_441036.1_8 Reverse -48 -58 8.33817 0.174
NP_441557.1_5 Forward -58 -49 19.9609 0.000699
NP_441557.1_5 Reverse -49 -58 19.9609 0.000699
NP_441445.1_1 Reverse -40 -59 2.94938 0.224
NP_441445.1_1 Forward -67 -48 0.392778 0.275
NP_440084.1_8 Forward -133 -119 10.5157 0.27
NP_440101.1_3 Forward -63 -44 4.916 0.207
NP_441458.1_10 Forward -67 -48 5.70265 0.212
NP_441458.1_10 Reverse -40 -59 2.55606 0.269
NP_442183.1_1 Forward -58 -44 9.14437 0.101
NP_440248.1_2 Forward -279 -261 18.8237 0.124
NP_440248.1_4 Forward -353 -334 18.0541 0.0793
NP_442347.1_2 Forward -57 -48 12.4878 0.056
NP_442347.1_2 Reverse -50 -59 11.1111 0.056
NP_442645.1_2 Reverse -41 -60 4.916 0.0216
NP_441037.1_4 Forward -60 -50 14.7245 0.028
NP_442594.1_9 Forward -79 -60 9.14342 0.228
NP_442594.1_10 Forward -31 -12 10.0284 0.28
NP_441633.1_3 Forward -60 -47 3.36254 0.0699
NP_441633.1_3 Reverse -47 -60 1.39592 0.109
NP_441633.1_3 Reverse -133 -146 -3.32397 0.177
NP_440136.1_2 Forward -57 -50 15.9687 0.0123
NP_440136.1_2 Reverse -50 -57 15.9687 0.0123
NP_442590.1_10 Forward -64 -45 5.50599 0.258
NP_442998.1_10 Forward -56 -49 15.5754 0.0102
NP_442998.1_10 Reverse -51 -58 15.5754 0.0102
NP_440899.1_2 Reverse -38 -57 12.3883 0.112
NP_440299.1_1 Forward -62 -49 17.8166 0.00525
NP_440299.1_1 Reverse -45 -58 14.08 0.0259
NP_441799.1_1 Forward -62 -48 9.43874 0.0922
NP_441799.1_1 Reverse -45 -59 5.99717 0.187
NP_442201.1_10 Forward -69 -50 -6.1954 0.184
NP_442333.2_5 Reverse -38 -57 -13.4719 0.259
NP_440256.1_1 Reverse -46 -65 15.0441 0.00731
NP_440256.1_1 Forward -61 -42 -6.68705 0.217
NP_441362.1_2 Reverse -365 -384 6.03536 0.243
NP_441559.1_8 Forward -63 -49 2.35953 0.145
NP_441559.1_8 Reverse -44 -58 -5.9986 0.271
NP_440915.1_6 Reverse -45 -59 4.52282 0.0953
NP_440915.1_6 Forward -62 -48 -2.16369 0.26
NP_442785.1_7 Reverse -47 -61 10.0294 0.231
NP_441704.1_8 Reverse -38 -57 9.04509 0.196
NP_440695.1_6 Reverse -364 -378 11.3809 0.265
NP_441199.1_7 Reverse -4 -23 6.4893 0.211
NP_442993.1_1 Forward -58 -42 -7.61128 0.146
NP_442386.1_9 Forward -59 -50 15.7322 0.0144
NP_442386.1_9 Reverse -48 -57 13.8639 0.0289
NP_441340.1_5 Forward -57 -50 15.6737 0.0124
NP_441340.1_5 Reverse -50 -57 15.6737 0.0124
NP_441947.1_4 Forward -69 -50 14.0608 0.199
NP_441248.1_8 Reverse -350 -366 15.7908 0.283
NP_440194.1_3 Reverse -125 -144 1.0811 0.277
NP_440586.1_8 Forward -57 -50 13.2151 0.026
NP_440586.1_8 Reverse -50 -57 13.2151 0.026
NP_442251.1_6 Forward -57 -50 15.2804 0.0124
NP_442251.1_6 Reverse -50 -57 15.2804 0.0124
NP_441262.1_3 Reverse -49 -56 14.7888 0.0223
NP_441262.1_3 Forward -58 -51 14.7888 0.0223
NP_440523.1_7 Forward -330 -311 15.8307 0.0507
NP_443051.1_1 Reverse -48 -57 10.4228 0.00754
NP_443051.1_1 Forward -59 -50 10.4228 0.00754
NP_443051.1_5 Reverse -107 -126 6.4893 0.256
NP_439937.1_9 Reverse -48 -65 -8.22161 0.176
NP_440439.1_1 Forward -61 -48 3.65753 0.11
NP_440439.1_1 Reverse -46 -59 0.117615 0.202
NP_439943.1_7 Forward -57 -38 3.04771 0.29
NP_440372.1_2 Forward -57 -50 16.3621 0.0124
NP_440372.1_2 Reverse -50 -57 16.3621 0.0124
NP_441138.1_5 Forward -122 -109 3.21301 0.297
NP_441138.1_5 Forward -369 -356 2.92653 0.297
NP_440819.1_5 Reverse -61 -69 7.8859 0.266
NP_440819.1_5 Reverse -373 -381 7.59091 0.272
NP_441803.1_2 Reverse -44 -63 8.55425 0.114
NP_441803.1_2 Forward -63 -44 3.53937 0.191
NP_439977.1_5 Forward -64 -45 -3.14714 0.296
NP_440139.1_1 Forward -64 -45 4.22689 0.189
NP_442384.1_10 Reverse -49 -62 17.3255 0.00599
NP_442384.1_10 Forward -58 -45 10.049 0.047
NP_442085.1_1 Forward -241 -222 9.50102 0.286
NP_441018.1_7 Forward -62 -43 6.78429 0.282
NP_442262.1_10 Forward -57 -50 14.1988 0.0123
NP_442262.1_10 Reverse -50 -57 14.1988 0.0123
NP_442262.1_10 Forward -51 -44 8.59391 0.22
NP_441689.1_5 Reverse -47 -57 15.3192 0.0403
NP_440163.1_10 Reverse -46 -56 11.3864 0.169
NP_442165.1_4 Forward -387 -368 20.4569 0.0481
NP_440344.1_10 Forward -65 -48 10.1669 0.00745
NP_440344.1_10 Reverse -42 -59 8.98696 0.00932
NP_440531.1_6 Reverse -41 -60 6.4893 0.106
NP_442910.1_1 Reverse -42 -61 -7.27704 0.254
NP_440562.1_3 Forward -57 -40 6.62702 0.15
NP_441965.1_10 Reverse -46 -62 5.76173 0.197
NP_440297.1_9 Forward -57 -47 9.32148 0.0917
NP_440297.1_9 Reverse -50 -60 -0.118297 0.282
NP_440350.1_5 Forward -133 -114 -4.6221 0.281
NP_441896.1_3 Reverse -40 -59 8.94757 0.0872
NP_440894.1_10 Forward -63 -44 7.37428 0.205
NP_440894.1_10 Reverse -44 -63 5.40766 0.233
NP_440999.1_9 Forward -62 -48 12.0943 0.0414
NP_440888.1_2 Forward -58 -44 19.0751 0.00173
NP_440888.1_2 Reverse -49 -63 11.7987 0.0588
NP_440600.1_4 Forward -66 -48 -2.24246 0.193
NP_440491.1_1 Reverse -46 -65 13.2517 0.127
NP_440052.1_5 Forward -69 -50 -5.01543 0.271
NP_442277.1_4 Forward -67 -48 12.3883 0.0685
NP_442277.1_7 Reverse -162 -178 -1.23459 0.268
NP_442033.1_10 Forward -60 -41 -5.99873 0.182
NP_440575.1_1 Forward -390 -371 -2.95123 0.294
NP_441543.1_2 Reverse -50 -59 18.486 0.00236
NP_441543.1_2 Forward -57 -48 16.9127 0.00359
NP_441543.1_2 Reverse -136 -145 4.0313 0.293
NP_441543.1_4 Reverse -244 -262 5.03403 0.171
NP_442845.1_2 Reverse -43 -57 4.62115 0.256
NP_441319.1_8 Reverse -43 -61 4.6407 0.29
NP_441469.1_3 Forward -288 -269 16.0762 0.141
NP_441469.1_8 Forward -59 -50 16.126 0.00797
NP_441469.1_8 Reverse -48 -57 6.48957 0.227
NP_443064.1_6 Forward -58 -48 12.5669 0.0796
NP_442578.1_7 Forward -57 -50 14.5921 0.026
NP_442578.1_7 Reverse -50 -57 14.5921 0.026
NP_442286.1_7 Forward -384 -365 16.5182 0.133
NP_441462.1_2 Forward -58 -48 11.5831 0.00406
NP_441462.1_2 Reverse -49 -59 11.5831 0.00406
NP_443062.1_6 Reverse -41 -60 3.53937 0.235
NP_440349.1_3 Forward -57 -38 15.6332 0.18
NP_442204.1_1 Forward -62 -51 6.94184 0.144
NP_442204.1_1 Reverse -45 -56 0.353664 0.281
NP_442204.1_5 Forward -68 -49 20.649 0.0241
NP_441560.1_8 Forward -39 -20 12.1944 0.261
NP_440544.1_5 Forward -122 -115 14.5681 0.264
NP_440516.1_2 Reverse -43 -61 3.26407 0.152
NP_440516.1_8 Forward -58 -49 16.9127 0.00442
NP_440516.1_8 Reverse -49 -58 16.9127 0.00442
NP_441785.1_1 Forward -58 -44 15.5501 0.132
NP_442428.1_5 Forward -57 -50 15.8704 0.0124
NP_442428.1_5 Reverse -50 -57 15.8704 0.0124
NP_440673.1_2 Reverse -39 -58 16.9256 0.0543
NP_440673.1_3 Forward -56 -49 12.4288 0.0426
NP_440673.1_3 Reverse -51 -58 12.4288 0.0426
NP_440673.1_3 Forward -32 -25 7.51227 0.252
NP_441714.1_3 Forward -65 -47 14.0797 0.198
NP_441052.1_2 Forward -58 -48 19.9412 0.00106
NP_441052.1_2 Reverse -49 -59 10.5014 0.0285
NP_442219.1_8 Reverse -39 -58 8.45701 0.245
NP_442219.1_9 Forward -57 -48 17.7976 0.00718
NP_442219.1_9 Reverse -50 -59 8.35786 0.0681
NP_440436.1_4 Reverse -50 -59 18.1905 0.00233
NP_440436.1_4 Forward -57 -48 17.2072 0.00233
NP_441884.1_9 Reverse -46 -65 -12.6852 0.138
NP_441884.1_9 Forward -61 -42 -22.715 0.284
NP_442907.1_5 Reverse -344 -363 13.6675 0.262
NP_441086.1_3 Reverse -180 -199 6.23263 0.278
NP_441719.1_4 Forward -57 -50 16.3621 0.0124
NP_441719.1_4 Reverse -50 -57 16.3621 0.0124
NP_441733.1_10 Reverse -46 -59 9.95071 0.106
NP_442366.1_3 Reverse -48 -66 8.08229 0.0693
NP_442366.1_3 Forward -59 -41 -2.43913 0.228
NP_442366.1_5 Forward -61 -51 15.2208 0.0375
NP_442873.1_9 Reverse -39 -58 5.11187 0.275
NP_441115.1_4 Reverse -48 -66 10.9331 0.158
NP_443054.1_2 Reverse -47 -61 10.9143 0.0761
NP_441851.1_10 Forward -59 -49 16.008 0.00552
NP_441851.1_10 Reverse -48 -58 15.8113 0.00552
NP_442856.1_7 Forward -67 -48 -2.36049 0.236
NP_442515.1_1 Reverse -48 -62 -4.52363 0.298
NP_440593.1_3 Reverse -44 -63 -0.983855 0.211
NP_441982.1_6 Reverse -372 -381 13.5358 0.274
NP_442709.1_3 Reverse -356 -375 1.96607 0.296
NP_441046.1_2 Reverse -363 -382 -2.16383 0.295
NP_441124.1_5 Forward -178 -168 12.7217 0.215
NP_442450.1_5 Reverse -47 -57 9.32148 0.115
NP_442450.1_5 Forward -60 -50 7.55152 0.13
NP_440588.1_2 Forward -67 -48 -0.688862 0.152
NP_440954.1_1 Forward -58 -39 -6.09707 0.289
NP_441570.1_1 Forward -58 -40 1.98577 0.0273
NP_441570.1_1 Reverse -49 -67 -17.8771 0.295
NP_441078.1_4 Forward -58 -49 19.6659 0.0007
NP_441078.1_4 Reverse -49 -58 19.6659 0.0007
NP_442729.1_8 Reverse -45 -58 8.47575 0.125
NP_440793.1_1 Forward -130 -116 8.84875 0.295
NP_440526.1_3 Forward -57 -46 10.1862 0.0646
NP_441432.1_3 Reverse -363 -382 10.2251 0.275
NP_441432.1_8 Reverse -48 -57 16.8143 0.00595
NP_441432.1_8 Forward -59 -50 8.25953 0.0755
NP_442320.1_8 Reverse -43 -57 5.01447 0.0442
NP_442320.1_8 Forward -64 -50 -2.95034 0.1
NP_442320.1_8 Reverse -19 -33 -5.60527 0.236
NP_442344.1_7 Reverse -50 -69 -6.1954 0.17
NP_441732.1_2 Forward -62 -46 1.82849 0.026
NP_441732.1_2 Reverse -45 -61 -6.43131 0.0495
NP_441732.1_2 Forward -148 -132 -16.8544 0.207
NP_440497.1_2 Forward -57 -38 10.1275 0.201
NP_440760.1_1 Forward -58 -39 -14.3569 0.129
NP_440199.1_10 Reverse -46 -56 16.7946 0.0381
NP_442353.1_4 Forward -64 -45 5.99684 0.182
NP_442353.1_4 Forward -150 -131 5.2102 0.185
NP_442751.1_2 Forward -59 -40 10.815 0.187
NP_441072.1_2 Reverse -45 -64 6.29264 0.283
NP_442400.1_10 Forward -199 -186 9.32449 0.271
NP_442489.1_2 Reverse -44 -63 1.17943 0.293
NP_442489.1_7 Forward -58 -49 20.1576 0.000695
NP_442489.1_7 Reverse -49 -58 20.1576 0.000695
NP_442079.1_7 Forward -57 -38 11.9958 0.0886
NP_440559.1_1 Forward -57 -48 17.4043 0.00658
NP_440559.1_1 Reverse -50 -59 8.75118 0.0586
NP_441659.2_8 Forward -58 -48 18.1713 0.00133
NP_441659.2_8 Reverse -49 -59 11.9764 0.0147
NP_441022.1_1 Reverse -165 -174 10.8747 0.284
NP_442913.1_10 Forward -67 -48 8.55425 0.0469
NP_441040.1_5 Forward -63 -44 3.93269 0.266
NP_440315.1_6 Reverse -368 -384 10.9733 0.0667
NP_442346.1_5 Reverse -48 -58 16.6963 0.00248
NP_442346.1_5 Forward -59 -49 9.02648 0.118
NP_440545.1_3 Reverse -45 -62 -2.22277 0.181
NP_440545.1_3 Forward -62 -45 -2.71443 0.191
NP_442603.1_7 Forward -58 -44 12.6836 0.0948
NP_440034.1_4 Reverse -346 -358 17.587 0.223
NP_441888.1_7 Forward -63 -49 4.03116 0.225
NP_440449.1_6 Forward -66 -48 11.7573 0.128
NP_441948.1_4 Reverse -42 -60 0.117479 0.136
NP_441948.1_4 Forward -65 -47 -1.75081 0.152
NP_441502.1_3 Reverse -47 -66 5.80098 0.287
NP_441833.1_4 Forward -57 -50 15.9687 0.0124
NP_441833.1_4 Reverse -50 -57 15.9687 0.0124
NP_441329.1_1 Forward -242 -223 11.9838 0.187
NP_440912.1_3 Forward -126 -107 13.0766 0.254
NP_442162.1_9 Forward -57 -50 16.2637 0.0124
NP_442162.1_9 Reverse -50 -57 16.2637 0.0124
NP_440671.1_4 Reverse -43 -57 16.1259 0.0322
NP_440224.1_1 Reverse -38 -57 1.76941 0.132
NP_440772.1_8 Reverse -43 -62 6.98095 0.297
NP_442140.1_3 Reverse -50 -60 16.2046 0.0255
NP_442140.1_3 Forward -57 -47 4.40493 0.243
NP_441813.1_5 Reverse -47 -57 15.9097 0.01
NP_441813.1_5 Forward -60 -50 9.91146 0.021
NP_441259.1_7 Reverse -3 -21 16.8337 0.188
NP_442089.1_1 Reverse -46 -65 -2.0655 0.288
NP_440590.1_4 Reverse -50 -63 20.1771 0.00597
NP_440590.1_4 Forward -57 -44 14.3756 0.0109
NP_440567.1_1 Reverse -50 -64 15.6342 0.017
NP_442497.1_10 Forward -57 -48 10.4228 0.0087
NP_442497.1_10 Reverse -50 -59 10.4228 0.0087
NP_440821.1_4 Reverse -47 -57 18.2696 0.00448
NP_440821.1_4 Forward -60 -50 10.2065 0.0163
NP_440227.1_2 Forward -200 -184 12.9399 0.271
NP_441239.1_9 Forward -60 -48 12.3303 0.0477
NP_441239.1_9 Reverse -47 -59 6.92215 0.173
NP_442691.1_8 Reverse -239 -258 15.8036 0.251
NP_441892.1_1 Forward -67 -50 3.28376 0.128
NP_441892.1_1 Reverse -40 -57 -5.86102 0.29
NP_442270.1_9 Reverse -38 -57 -7.4737 0.213
NP_442270.1_9 Forward -63 -44 -8.26035 0.217
NP_441017.1_6 Reverse -45 -59 15.7319 0.0926
NP_441567.1_10 Forward -67 -48 18.4848 0.202
NP_441617.1_6 Forward -383 -364 -4.42544 0.265
NP_440546.1_4 Reverse -49 -59 11.8882 0.0679
NP_440546.1_4 Forward -58 -48 10.046 0.109
NP_440462.1_6 Forward -60 -50 9.02648 0.0498
NP_440462.1_6 Reverse -47 -57 7.74818 0.0699
NP_442592.1_7 Forward -57 -38 19.3707 0.123
NP_440868.1_4 Forward -62 -50 11.2487 0.0327
NP_440868.1_4 Reverse -45 -57 -0.846001 0.282
NP_441848.1_4 Reverse -182 -198 9.36501 0.285
NP_440653.1_10 Reverse -50 -69 3.73603 0.265
NP_440696.1_3 Forward -62 -44 -0.865831 0.249
NP_442882.1_7 Forward -65 -51 12.2903 0.261
NP_442039.1_4 Forward -57 -50 15.1821 0.0124
NP_442039.1_4 Reverse -50 -57 15.1821 0.0124
NP_441811.1_8 Forward -40 -26 11.3077 0.218
NP_440825.1_7 Reverse -50 -60 12.4217 0.155
NP_442837.1_3 Forward -57 -50 15.7721 0.0124
NP_442837.1_3 Reverse -50 -57 15.7721 0.0124
NP_439994.1_3 Forward -59 -40 10.7798 0.203
NP_442053.1_1 Forward -58 -49 18.3876 0.0007
NP_442053.1_1 Reverse -49 -58 18.3876 0.0007
NP_440505.1_3 Reverse -47 -57 16.303 0.00696
NP_440505.1_3 Forward -60 -50 6.76487 0.169
NP_441959.1_8 Forward -197 -184 16.3254 0.189
NP_441252.1_6 Reverse -371 -378 11.6422 0.288
NP_441203.1_1 Reverse -50 -69 -20.0601 0.297
NP_441777.1_1 Reverse -366 -384 17.1905 0.167
NP_440914.1_1 Forward -58 -48 17.5935 0.000537
NP_440914.1_1 Reverse -49 -59 8.6151 0.186
NP_441011.1_8 Reverse -50 -59 16.9127 0.00602
NP_441011.1_8 Forward -57 -48 8.25953 0.144
NP_442533.1_3 Reverse -368 -386 16.9006 0.186
NP_442533.1_6 Forward -58 -49 17.2076 0.00137
NP_442533.1_6 Reverse -49 -58 17.2076 0.00137
NP_443016.1_5 Forward -384 -365 6.68515 0.21
NP_441482.1_7 Reverse -43 -57 0.786239 0.0554
NP_439944.1_9 Forward -57 -47 19.0562 0.00329
NP_441697.1_5 Forward -183 -164 2.24364 0.178
NP_441697.1_5 Reverse -118 -137 -10.5523 0.28
NP_440116.1_8 Forward -57 -38 -0.0988766 0.104
NP_441527.1_4 Reverse -101 -120 -9.40638 0.258
NP_440007.1_9 Reverse -45 -59 2.16287 0.281
NP_441347.1_9 Forward -178 -165 10.8283 0.235
NP_441602.1_3 Forward -57 -38 -4.32711 0.263
NP_441972.1_5 Forward -57 -38 -8.65367 0.27
NP_441106.1_1 Forward -59 -50 18.191 0.0028
NP_441106.1_1 Reverse -48 -57 9.63616 0.0311
NP_440429.1_2 Reverse -44 -63 12.0942 0.218
NP_440429.1_2 Forward -57 -38 9.73422 0.272
NP_442704.1_7 Reverse -105 -124 19.764 0.181
NP_441286.1_1 Forward -59 -47 11.8387 0.0114
NP_441286.1_1 Reverse -48 -60 6.03717 0.0258
NP_440670.1_8 Forward -58 -49 18.3876 0.000699
NP_440670.1_8 Reverse -49 -58 18.3876 0.000699
NP_441705.1_9 Forward -169 -150 21.8195 0.0791
NP_440886.1_7 Forward -59 -49 17.7774 0.0011
NP_440886.1_7 Reverse -48 -58 7.94438 0.0805
NP_439940.1_1 Reverse -225 -244 6.78429 0.0127
NP_442614.1_2 Forward -58 -44 5.99778 0.295
NP_442072.1_9 Reverse -48 -66 -22.7936 0.259
NP_442072.1_9 Forward -59 -41 -23.482 0.297
NP_442401.1_2 Reverse -24 -43 9.24175 0.211
NP_440223.1_2 Reverse -6 -25 18.289 0.133
NP_440907.2_8 Reverse -50 -60 14.2375 0.0312
NP_440664.1_9 Reverse -241 -260 14.2574 0.172
NP_441021.1_1 Forward -57 -38 -12.4886 0.288
NP_440841.1_4 Reverse -47 -66 -11.2103 0.298
NP_441463.1_3 Forward -114 -95 -8.85033 0.274
NP_441463.1_6 Reverse -47 -61 6.02939 0.283
NP_442842.1_10 Forward -22 -3 0.950819 0.254
NP_442893.1_6 Forward -39 -20 3.93269 0.241
NP_441626.1_2 Forward -57 -50 15.7721 0.0124
NP_441626.1_2 Reverse -50 -57 15.7721 0.0124
NP_441460.1_5 Forward -287 -273 14.6503 0.251
NP_440107.1_5 Forward -59 -40 -0.787193 0.178
NP_442794.1_1 Reverse -45 -57 10.1671 0.0721
NP_442794.1_1 Forward -62 -50 2.89058 0.286
NP_442615.1_1 Forward -67 -49 1.10079 0.0906
NP_441962.1_4 Forward -57 -38 -11.2103 0.238
NP_441962.1_4 Forward -39 -20 -12.3902 0.256
NP_440387.1_1 Reverse -49 -65 6.64671 0.0282
NP_440387.1_1 Forward -58 -42 -3.97304 0.171
NP_441431.1_2 Forward -61 -47 7.17714 0.247
NP_441993.1_1 Forward -58 -39 2.53143 0.257
NP_441510.2_6 Forward -44 -25 17.1082 0.113
NP_441510.2_6 Reverse -39 -58 16.0265 0.132
NP_440766.1_4 Reverse -45 -59 17.7975 0.0255
NP_439988.1_7 Reverse -51 -65 11.602 0.292
NP_442743.1_4 Reverse -50 -69 -7.17871 0.279
NP_439998.1_7 Forward -293 -274 19.174 0.107
NP_442930.1_1 Forward -72 -62 13.3526 0.239
NP_439910.1_2 Reverse -41 -58 -13.7275 0.162
NP_440457.1_1 Reverse -45 -57 7.02048 0.105
NP_440457.1_1 Forward -62 -50 0.137309 0.25
NP_440798.1_6 Reverse -50 -63 15.3589 0.0423
NP_442509.1_9 Reverse -49 -59 16.2041 0.00739
NP_442509.1_9 Forward -58 -48 8.14104 0.192
NP_440554.1_4 Reverse -50 -60 7.35486 0.103
NP_440554.1_4 Forward -57 -47 7.05986 0.106
NP_441885.1_5 Forward -58 -48 20.9245 0.000538
NP_441885.1_5 Reverse -49 -59 11.4848 0.00668
NP_442703.1_9 Forward -188 -170 9.55725 0.244
NP_442341.1_7 Reverse -48 -62 19.3708 0.00848
NP_442341.1_7 Forward -59 -45 18.0925 0.0111
NP_442341.1_9 Forward -60 -46 15.8302 0.0419
NP_442395.2_4 Reverse -251 -270 -0.29631 0.288
NP_443000.1_7 Reverse -47 -57 17.0896 0.00865
NP_443000.1_7 Forward -60 -50 1.94665 0.226
NP_440076.1_5 Reverse -42 -61 12.88 0.252
NP_440507.2_3 Reverse -40 -59 9.43841 0.221
NP_442513.1_5 Reverse -41 -60 9.24175 0.266
NP_441842.1_1 Reverse -51 -64 13.785 0.133
NP_441842.1_10 Forward -65 -51 21.2391 0.0073
NP_440275.1_3 Forward -60 -50 8.33817 0.0602
NP_440275.1_3 Reverse -47 -57 8.1415 0.0602
NP_440091.1_1 Reverse -45 -57 8.88877 0.0567
NP_440091.1_1 Forward -62 -50 0.727295 0.233
NP_443010.1_10 Forward -61 -44 8.95536 0.153
NP_442451.1_2 Reverse -41 -60 -1.47551 0.172
NP_441635.1_2 Forward -177 -158 9.69201 0.285
NP_442753.1_6 Reverse -333 -352 4.62021 0.29
NP_440149.1_8 Forward -58 -39 10.6192 0.0455
NP_440149.1_8 Reverse -49 -68 -5.50708 0.228
NP_440149.1_8 Reverse -25 -44 -5.60541 0.23
NP_441105.1_3 Forward -69 -50 -6.49039 0.236
NP_440216.1_1 Reverse -49 -63 8.65272 0.00592
NP_440216.1_1 Forward -58 -44 -9.63684 0.145
NP_440216.1_6 Forward -65 -49 6.74504 0.189
NP_440172.1_1 Forward -58 -48 15.0247 0.00945
NP_440172.1_1 Reverse -49 -59 8.73149 0.0586
NP_442015.1_10 Forward -62 -49 20.5705 0.00366
NP_442015.1_10 Reverse -45 -58 10.344 0.0391
NP_441226.1_7 Forward -57 -50 14.4934 0.0123
NP_441226.1_7 Reverse -50 -57 14.4934 0.0123
NP_441226.1_7 Forward -64 -57 6.82361 0.246
NP_441226.1_7 Reverse -56 -63 6.82361 0.246
NP_441111.1_7 Forward -57 -49 18.7023 0.00294
NP_441111.1_7 Reverse -50 -58 18.7023 0.00294
NP_441766.1_2 Forward -58 -49 17.5026 0.00297
NP_441766.1_2 Reverse -49 -58 17.5026 0.00297
NP_442417.1_5 Reverse -49 -63 9.5377 0.13
NP_440416.1_9 Forward -65 -46 -5.70374 0.0814
NP_440416.1_9 Reverse -42 -61 -16.4218 0.215
NP_443052.1_8 Forward -68 -49 -5.60541 0.131
NP_442116.1_6 Reverse -181 -198 10.9382 0.215
NP_442154.1_1 Forward -275 -257 -18.2704 0.279
NP_440261.1_5 Reverse -50 -63 -2.53732 0.0924
NP_440261.1_5 Forward -57 -44 -12.3704 0.284
NP_440988.1_10 Reverse -47 -61 8.19046 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCAGGTCATGAAGTTCTTTTTTTGCCGAAATATTCTCCTGATTTAAATGATATTGAGCATGACTTTAGTGCCTTGAAACGAGCTAGAATGTACGCTCCTATTGACACGTCTCTTGATGAAATTATCCGTTCTTACTGTGGCGTTTAGCGTCTCAGCTTTATTTGAAACTACTATATAATCGTTGATATTTACTGTTCCATAAATTTATTCACAAATCATAGTATTAAAATTTATTTGATGAAGCCAAAATTCGTCGGTGATAACAAACATTTTCAGTTTTTCTCCTGATTAATCATTTCATTGATCAGATCAATTCAAGACTAGCTCAAATTATTCCCGTCGGCGATCGCCATTGATGCAGCTATAATGATTGCCGCTTTATTTCCCTGAACTTTGCCC

CDS

ATGATTAAGAATGATATTTGGATCCGTGCTCAAGCTGCCCAAGGCATGATTGAGCCTTTTGAACCCAAGTTAATGCGGCAAATAGAGGGACAACCGGCTATTTCCTTTGGTCTGAGCAGTTTTGGTTATGATATTAGGCTTTCTGCGGCGGATTTTCGCATTTTTCGCCATATTCCGGGCACTGTAGTTGATCCCAAAAACTTTAACCCCCACAATTTGGAAGCTACCCAACTGCACAGGGATGACAGTGGCAGTTATTTTATTTTGCCAGCCCACTCCTACGGCCTGGGAGTTGCAGTGGAAAGATTGGCCATCCCTGCTAATGTAACCGTACTTTGTATTGGTAAAAGTACTTACGCCAGGGCTGGTATTATTGCCAACTTAACTCCGGGGGAAGCGGGGTGGTGTGGTCACCTCACCCTAGAATTTTCCAATTCCTCCAGTGCTGATTGCCGTATCTACGCCAACGAAGGCATCGTACAGTTACTCTTTTTTGAAGGGGAAGACTGCGATATTAGCTATGAAACCAGAAGGGGCAAATATCAAAATCAGCCCCAATCAGTTACACTACCCCGGGTTTAG

Protein

MIKNDIWIRAQAAQGMIEPFEPKLMRQIEGQPAISFGLSSFGYDIRLSAADFRIFRHIPGTVVDPKNFNPHNLEATQLHRDDSGSYFILPAHSYGLGVAVERLAIPANVTVLCIGKSTYARAGIIANLTPGEAGWCGHLTLEFSNSSSADCRIYANEGIVQLLFFEGEDCDISYETRRGKYQNQPQSVTLPRV