Your browser is old and dusty. Try Google Chrome!

Details for sll1256

ORF sll1256
Accession NP_441471.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY100p: 1725405 - 1726350]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_4 Forward -285 -277 11.9175 0.0344
NP_442151.1_6 Reverse -304 -318 11.406 0.101
NP_442752.1_4 Reverse -283 -290 10.8555 0.0846
NP_442975.1_10 Reverse -108 -122 4.71887 0.241
NP_440061.1_9 Forward -287 -273 5.70218 0.275
NP_442242.1_4 Reverse -305 -312 9.47889 0.251
NP_442981.1_10 Reverse -346 -365 17.7974 0.274
NP_441492.1_1 Forward -21 -2 11.1109 0.148
NP_441208.1_1 Reverse -286 -305 -6.49039 0.287
NP_441365.1_5 Forward -21 -2 37.5619 0.000000115
NP_442110.1_7 Reverse -270 -284 1.37622 0.23
NP_440300.1_5 Reverse -30 -48 12.225 0.271
NP_441772.1_8 Reverse -76 -95 20.7464 0.136
NP_441149.1_7 Reverse -250 -269 0.491109 0.28
NP_441434.1_1 Reverse -372 -386 9.84729 0.237
NP_441434.1_1 Forward -331 -317 9.36983 0.24
NP_441434.1_1 Forward -245 -231 7.3645 0.284
NP_441434.1_1 Reverse -138 -152 7.26901 0.287
NP_442889.1_8 Reverse -116 -130 8.94708 0.107
NP_442889.1_8 Reverse -301 -315 5.50552 0.226
NP_441713.1_1 Forward -302 -283 -13.1769 0.252
NP_441716.1_1 Reverse -283 -297 5.60446 0.224
NP_441716.1_2 Reverse -53 -72 3.35565 0.229
NP_441327.1_1 Reverse -128 -147 3.92505 0.276
NP_441327.1_1 Forward -147 -128 3.63672 0.277
NP_440438.2_8 Forward -93 -74 4.62101 0.218
NP_440747.1_10 Forward -295 -283 -12.2524 0.254
NP_442145.1_4 Forward -94 -75 4.43995 0.282
NP_442145.1_4 Reverse -231 -250 2.91208 0.299
NP_442145.1_4 Reverse -171 -190 2.53011 0.299
NP_440470.1_5 Forward -379 -360 6.06331 0.28
NP_443018.1_3 Forward -284 -277 10.4622 0.103
NP_443018.1_3 Reverse -277 -284 4.36568 0.254
NP_441077.1_2 Reverse -171 -190 0.238307 0.299
NP_441077.1_6 Forward -196 -180 4.05516 0.261
NP_441846.1_10 Reverse -282 -301 -20.65 0.256
NP_441013.1_2 Forward -286 -268 1.39578 0.248
NP_441013.1_2 Reverse -265 -283 -3.81576 0.292
NP_441080.1_7 Reverse -63 -81 11.7197 0.238
NP_441855.2_4 Forward -293 -274 14.0542 0.156
NP_442205.1_9 Forward -127 -111 -3.67804 0.291
NP_441414.1_9 Reverse -304 -323 -9.83364 0.269
NP_441137.1_3 Forward -95 -76 14.3711 0.273
NP_442690.1_1 Reverse -66 -85 -15.0452 0.277
NP_442911.1_1 Reverse -76 -89 14.0991 0.298
NP_441099.1_5 Reverse -213 -232 -8.65367 0.201
NP_441712.1_1 Reverse -368 -387 10.1007 0.282
NP_441294.1_7 Reverse -300 -314 9.53859 0.241
NP_442438.1_10 Reverse -299 -313 9.14437 0.0692
NP_441000.1_1 Forward -22 -4 13.3937 0.184
NP_440147.1_4 Forward -287 -274 4.05085 0.173
NP_441916.1_7 Reverse -276 -286 4.60159 0.169
NP_441369.1_1 Forward -56 -37 38.7419 0.000000157
NP_441369.1_2 Forward -26 -7 38.9385 0.0000000955
NP_441369.1_3 Forward -73 -59 28.5156 0.00021
NP_441568.1_6 Forward -215 -197 12.034 0.27
NP_442941.1_3 Reverse -305 -315 -1.19994 0.288
NP_442941.1_5 Forward -311 -297 14.716 0.272
NP_441514.1_4 Reverse -138 -157 13.9592 0.25
NP_442281.1_1 Forward -290 -276 4.91554 0.176
NP_441079.1_7 Reverse -78 -97 -3.73788 0.238
NP_441079.1_7 Reverse -69 -88 -7.96609 0.298
NP_442288.1_5 Forward -58 -44 16.7159 0.12
NP_441556.1_6 Forward -54 -36 12.4797 0.296
NP_441644.1_6 Forward -285 -275 3.51951 0.277
NP_442029.1_6 Reverse -271 -290 17.404 0.0883
NP_442247.1_5 Reverse -29 -43 14.4865 0.234
NP_442933.1_10 Reverse -276 -285 4.62128 0.227
NP_442671.1_2 Forward -48 -29 24.6829 0.000359
NP_442970.1_1 Forward -46 -32 9.56081 0.269
NP_443009.1_5 Forward -314 -303 5.95804 0.18
NP_441865.1_3 Reverse -61 -79 13.8838 0.242
NP_441741.1_6 Reverse -367 -386 8.55425 0.249
NP_440620.1_4 Reverse -315 -329 15.2903 0.236
NP_442076.1_5 Forward -52 -33 9.93088 0.186
NP_441468.1_1 Reverse -277 -284 4.07068 0.263
NP_441015.1_10 Reverse -271 -290 -2.55715 0.178
NP_441764.1_10 Forward -197 -178 18.8592 0.231
NP_440871.1_3 Reverse -52 -66 15.905 0.166
NP_440111.2_2 Reverse -265 -284 -4.81876 0.292
NP_442593.1_9 Forward -330 -311 14.327 0.278
NP_441036.1_9 Forward -145 -127 8.96727 0.22
NP_441739.1_2 Forward -187 -171 12.5458 0.132
NP_441739.1_2 Reverse -314 -330 2.61447 0.288
NP_441458.1_10 Reverse -267 -286 8.55425 0.186
NP_441819.1_5 Reverse -77 -96 10.7424 0.261
NP_441819.1_5 Forward -148 -129 10.074 0.261
NP_441819.1_5 Reverse -166 -185 8.35512 0.295
NP_441574.1_5 Forward -199 -180 11.7992 0.186
NP_442590.1_10 Reverse -276 -295 4.03102 0.282
NP_442998.1_5 Forward -225 -215 12.5664 0.165
NP_442998.1_5 Forward -25 -15 8.53483 0.261
NP_440899.1_8 Reverse -33 -52 -9.14533 0.258
NP_440299.1_1 Forward -289 -276 2.18201 0.294
NP_441799.1_1 Forward -289 -275 10.1271 0.0797
NP_440256.1_1 Forward -288 -269 -5.99873 0.198
NP_441362.1_2 Forward -50 -31 5.55684 0.243
NP_440915.1_6 Reverse -272 -286 -1.67204 0.243
NP_440733.1_2 Forward -80 -62 18.8139 0.102
NP_442452.1_8 Reverse -223 -237 12.0937 0.273
NP_440537.1_7 Forward -72 -53 16.6629 0.0599
NP_441464.1_2 Reverse -268 -278 12.9597 0.299
NP_440695.1_6 Forward -269 -255 14.7744 0.208
NP_440695.1_6 Reverse -260 -274 11.3809 0.265
NP_441939.1_4 Reverse -105 -124 17.8088 0.137
NP_442386.1_9 Forward -286 -277 11.4057 0.0942
NP_441340.1_5 Reverse -277 -284 4.07068 0.239
NP_440586.1_8 Forward -284 -277 7.61025 0.227
NP_440027.1_3 Forward -295 -277 8.3765 0.193
NP_443051.1_1 Forward -314 -305 -0.0986038 0.256
NP_440372.1_2 Reverse -277 -284 4.07068 0.262
NP_440372.1_3 Forward -45 -31 15.0039 0.165
NP_442493.1_6 Forward -346 -328 15.2604 0.261
NP_442085.1_1 Reverse -85 -104 10.265 0.278
NP_441877.1_9 Reverse -75 -92 2.79211 0.285
NP_441018.1_7 Forward -317 -298 6.09597 0.299
NP_442262.1_10 Forward -284 -277 10.6589 0.14
NP_442917.1_1 Reverse -310 -329 7.66846 0.254
NP_442129.1_6 Forward -47 -28 13.9464 0.246
NP_440888.1_2 Forward -285 -271 9.93039 0.11
NP_442454.1_2 Reverse -232 -251 12.5568 0.251
NP_440792.1_4 Forward -287 -268 10.7175 0.189
NP_441543.1_2 Reverse -305 -314 9.83282 0.0818
NP_441543.1_2 Forward -120 -111 4.91628 0.213
NP_442710.1_7 Forward -49 -30 -7.22274 0.294
NP_443064.1_6 Forward -292 -282 12.1791 0.0975
NP_442578.1_7 Forward -120 -113 9.38056 0.138
NP_442578.1_7 Reverse -305 -312 9.28223 0.152
NP_440936.1_2 Reverse -175 -194 23.5989 0.0113
NP_442204.1_2 Forward -242 -223 7.96426 0.263
NP_442428.1_5 Reverse -277 -284 4.46401 0.267
NP_440673.1_3 Forward -283 -276 13.2155 0.0426
NP_441884.1_8 Reverse -275 -294 -5.70374 0.194
NP_442694.1_8 Reverse -32 -50 12.3105 0.191
NP_441851.1_9 Forward -366 -347 10.8159 0.234
NP_441982.1_10 Reverse -4 -23 8.55343 0.143
NP_440338.1_4 Forward -253 -234 7.37347 0.28
NP_442689.1_8 Reverse -32 -49 -8.61428 0.294
NP_442843.1_1 Reverse -277 -296 2.45773 0.161
NP_442843.1_3 Forward -344 -325 10.6192 0.0878
NP_441124.1_5 Reverse -76 -86 13.6766 0.215
NP_441124.1_5 Forward -53 -43 12.7217 0.215
NP_441031.1_1 Forward -146 -127 6.82273 0.259
NP_441570.1_1 Forward -313 -295 -11.0923 0.187
NP_441570.1_1 Reverse -283 -301 -17.7788 0.291
NP_441078.1_4 Forward -313 -304 -1.47524 0.266
NP_441432.1_8 Forward -314 -305 5.70292 0.144
NP_441432.1_9 Forward -328 -315 9.27706 0.28
NP_440760.1_1 Reverse -304 -323 -23.305 0.293
NP_442400.1_10 Reverse -381 -394 10.5659 0.26
NP_442400.1_10 Reverse -80 -93 7.31916 0.29
NP_441659.2_8 Forward -285 -275 1.06167 0.251
NP_442749.1_5 Reverse -169 -186 11.9836 0.174
NP_441040.1_5 Forward -290 -271 5.70265 0.229
NP_440315.1_7 Reverse -315 -334 17.1382 0.233
NP_442346.1_5 Forward -314 -304 6.8632 0.188
NP_440545.1_2 Reverse -358 -377 13.4819 0.296
NP_441856.1_3 Reverse -301 -320 -3.73712 0.299
NP_440743.1_8 Forward -177 -158 15.3382 0.215
NP_441047.1_2 Forward -284 -265 10.7175 0.113
NP_441329.1_1 Reverse -74 -93 13.7027 0.175
NP_441329.1_6 Reverse -140 -159 -1.67153 0.293
NP_441973.1_6 Forward -96 -78 14.8015 0.271
NP_442943.1_1 Reverse -129 -144 15.26 0.0725
NP_442140.1_3 Reverse -277 -287 5.68323 0.198
NP_442140.1_3 Forward -284 -274 4.10993 0.261
NP_442254.1_1 Forward -241 -222 -6.29373 0.297
NP_440227.1_6 Reverse -127 -141 14.6219 0.263
NP_441239.1_9 Forward -287 -275 5.93884 0.202
NP_440156.1_4 Forward -186 -176 12.9592 0.176
NP_442643.1_5 Forward -345 -326 -1.18052 0.265
NP_441541.1_1 Forward -36 -18 -3.43572 0.264
NP_441541.1_1 Reverse -75 -93 -3.91318 0.27
NP_441541.1_7 Forward -217 -199 9.22679 0.294
NP_440546.1_4 Reverse -276 -286 14.7 0.0459
NP_440546.1_4 Forward -285 -275 8.20381 0.199
NP_442479.1_9 Reverse -369 -388 -7.08038 0.266
NP_441672.1_10 Reverse -278 -297 21.8289 0.0526
NP_441959.1_8 Forward -46 -33 8.61288 0.286
NP_441102.1_2 Reverse -170 -189 5.70265 0.298
NP_441252.1_2 Forward -93 -75 17.9835 0.208
NP_442532.1_1 Reverse -139 -153 15.5556 0.215
NP_442532.1_2 Forward -80 -61 -0.143661 0.299
NP_442532.1_4 Forward -97 -79 22.6055 0.0155
NP_442532.1_4 Reverse -169 -187 9.32234 0.273
NP_441011.1_8 Reverse -277 -286 11.1111 0.0855
NP_440068.1_1 Reverse -289 -308 -3.63879 0.249
NP_442533.1_6 Forward -285 -276 2.75299 0.241
NP_442541.1_10 Reverse -260 -274 1.47397 0.286
NP_440263.1_5 Reverse -172 -186 17.4042 0.172
NP_440854.1_5 Reverse -368 -382 14.5264 0.274
NP_441697.1_5 Forward -88 -69 -10.6478 0.28
NP_441697.1_5 Forward -222 -203 -11.4117 0.295
NP_440116.1_8 Reverse -288 -307 -9.83364 0.29
NP_441680.1_4 Forward -284 -265 -0.787193 0.256
NP_441602.1_3 Reverse -271 -290 -5.60541 0.291
NP_441420.1_4 Reverse -286 -305 11.6025 0.282
NP_442881.1_1 Reverse -366 -385 17.5015 0.123
NP_441930.1_2 Reverse -298 -308 12.3697 0.262
NP_439940.1_1 Forward -74 -55 31.957 0.00000438
NP_440387.1_1 Forward -121 -105 -5.448 0.232
NP_441431.1_1 Reverse -31 -49 5.06306 0.245
NP_442224.1_1 Forward -287 -268 6.09597 0.164
NP_440766.1_4 Forward -236 -222 1.96621 0.205
NP_440422.1_10 Forward -109 -90 9.24252 0.212
NP_442930.1_1 Reverse -369 -379 14.0409 0.239
NP_442930.1_1 Forward -187 -177 13.0576 0.239
NP_440987.1_6 Reverse -77 -96 11.3948 0.247
NP_440798.1_1 Reverse -178 -196 11.7014 0.294
NP_440798.1_6 Reverse -277 -290 2.2809 0.182
NP_441489.1_3 Reverse -172 -186 8.31942 0.244
NP_441489.1_3 Forward -329 -315 6.98253 0.287
NP_440081.1_4 Reverse -197 -216 16.9008 0.183
NP_442582.1_3 Reverse -170 -184 12.903 0.284
NP_442582.1_3 Forward -86 -72 12.6166 0.284
NP_440554.1_4 Forward -284 -274 5.09324 0.162
NP_440478.1_10 Forward -287 -273 6.58777 0.288
NP_441173.1_9 Forward -181 -173 10.9338 0.242
NP_440191.1_6 Forward -149 -135 13.3805 0.294
NP_440191.1_6 Reverse -31 -45 13.1895 0.294
NP_440091.1_1 Reverse -300 -312 7.11881 0.0874
NP_442451.1_7 Forward -51 -32 12.9791 0.113
NP_441389.1_5 Reverse -163 -182 10.7175 0.265
NP_440804.1_7 Reverse -316 -333 12.2311 0.175
NP_441226.1_7 Forward -284 -277 11.2485 0.0971
NP_443052.1_8 Reverse -294 -313 -2.95047 0.0955
NP_442116.1_6 Forward -146 -129 8.93289 0.238
NP_442116.1_6 Reverse -30 -47 7.50051 0.254
NP_442116.1_6 Forward -86 -69 5.87715 0.289
NP_442154.1_1 Reverse -277 -295 -15.4188 0.218
NP_441430.1_2 Forward -311 -292 2.26107 0.132
NP_440261.1_7 Reverse -117 -136 -1.96717 0.19
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATGAGCTTGTTGTCAATTATAGGAAATTTTTTAGGCCTGTCAGTGAGATAATTCTGATTCTTCAGGGGTTAATTTAGTCAAATTTTAGGTTATCGCAGTTCCCTGCCTCACGCTCACCCATCGCTAGAGCTGGAAATTTCCGCCTAGAACAGTTAAAAGATTCTCAATTTCGACCGGGACAGATTTAGATAATAATGAAATAACATAATCAGTTAAAATTTCTCCAAATTGTAGTTCTGACTACGCCTACTTATATTATTTTTAAACAATTTAGCTAGAGGCGATAAATTAAGACTTTATAGCTAAGTTTCTAGAAATTTTAAAAATATAGTCATTTCAATTAACGATGAGAGAATTTAATGTAAAATTATGGAGTGTACAAAATGAACAGGTTTAAACA

CDS

ATGGCTTACAGTTTAGATTTAAGGCAAAGGGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAACAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGCCGTATATTACGCATTAAAGAAAATGAAAATAAACAGAAAAAAAAAGAACTACGTTATCGAGAAAGAAACCGGGAGGAACGAGTTAAGTACTATAGAATGTTAA

Protein

MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKNYVIEKETGRNELSTIEC