Your browser is old and dusty. Try Google Chrome!

Details for sll1251

ORF sll1251
Accession NP_441482.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -130 -123 14.6904 0.0123
NP_440795.1_7 Reverse -123 -130 14.6904 0.0123
NP_441418.1_6 Forward -131 -112 -3.63879 0.0246
NP_441418.1_6 Reverse -268 -287 -12.3902 0.0643
NP_441418.1_6 Reverse -122 -141 -19.7651 0.0955
NP_442291.1_5 Reverse -121 -137 -2.30141 0.215
NP_441453.1_1 Reverse -115 -133 6.99988 0.221
NP_441453.1_4 Reverse -122 -130 16.539 0.00633
NP_441453.1_4 Forward -131 -123 16.539 0.00633
NP_441453.1_4 Forward -277 -269 14.7691 0.0119
NP_441453.1_4 Reverse -268 -276 6.80426 0.121
NP_441453.1_7 Forward -17 -10 11.9372 0.298
NP_442151.1_6 Forward -131 -117 19.5675 0.0045
NP_442151.1_10 Reverse -267 -285 11.8189 0.289
NP_442838.1_7 Reverse -153 -172 -4.52377 0.232
NP_441818.1_1 Forward -276 -265 11.8579 0.155
NP_441818.1_1 Forward -130 -119 11.4645 0.177
NP_440226.1_1 Forward -277 -258 8.35759 0.0885
NP_440226.1_1 Reverse -122 -141 8.25926 0.0904
NP_440226.1_1 Forward -131 -112 6.39097 0.129
NP_442173.1_1 Forward -130 -122 15.4574 0.00633
NP_442173.1_1 Reverse -123 -131 15.4574 0.00633
NP_442173.1_1 Forward -276 -268 12.0158 0.0316
NP_442173.1_1 Reverse -269 -277 12.0158 0.0316
NP_442752.1_4 Reverse -268 -275 13.8055 0.0199
NP_442752.1_4 Forward -131 -124 13.8055 0.0199
NP_442752.1_4 Reverse -122 -129 13.8055 0.0199
NP_443027.1_4 Forward -133 -123 11.8781 0.0872
NP_443027.1_4 Reverse -120 -130 6.46988 0.275
NP_440613.1_7 Forward -198 -179 14.5524 0.187
NP_442975.1_10 Forward -135 -121 3.93223 0.249
NP_442975.1_10 Reverse -118 -132 3.14559 0.263
NP_440784.1_7 Forward -130 -123 15.9687 0.0123
NP_440784.1_7 Reverse -123 -130 15.9687 0.0123
NP_440784.1_7 Reverse -269 -276 6.23397 0.241
NP_440784.1_7 Forward -276 -269 6.13563 0.241
NP_440061.1_9 Forward -133 -119 19.1735 0.00631
NP_440061.1_9 Reverse -266 -280 11.7987 0.105
NP_440061.1_9 Forward -279 -265 9.73373 0.14
NP_441054.1_4 Reverse -112 -130 2.28076 0.169
NP_441054.1_4 Reverse -258 -276 -1.35749 0.198
NP_440878.1_9 Reverse -112 -131 5.99764 0.174
NP_442062.1_8 Reverse -122 -132 19.4496 0.000558
NP_442062.1_8 Forward -131 -121 17.6796 0.00193
NP_442062.1_8 Reverse -268 -278 8.23984 0.0793
NP_442062.1_8 Forward -277 -267 7.55152 0.0946
NP_440761.1_4 Reverse -202 -221 -13.0786 0.257
NP_441900.1_1 Reverse -206 -225 19.0062 0.139
NP_441859.1_3 Forward -132 -113 12.9783 0.0859
NP_440304.1_4 Reverse -120 -130 17.9746 0.00654
NP_440304.1_4 Forward -133 -123 1.84832 0.299
NP_442242.1_4 Forward -130 -123 14.3954 0.0124
NP_442242.1_4 Reverse -123 -130 14.3954 0.0124
NP_441208.1_9 Reverse -119 -133 6.3911 0.246
NP_442110.1_7 Forward -131 -117 2.2612 0.222
NP_440330.1_2 Forward -228 -209 8.94757 0.297
NP_440856.1_4 Forward -138 -119 1.0811 0.161
NP_441083.1_5 Forward -131 -121 19.3512 0.000718
NP_441083.1_5 Forward -277 -267 19.0562 0.00147
NP_441083.1_5 Reverse -268 -278 16.7946 0.00546
NP_441083.1_5 Reverse -122 -132 11.3864 0.0159
NP_442827.1_8 Reverse -114 -133 -2.65624 0.286
NP_441434.1_1 Forward -365 -351 18.6325 0.0703
NP_441434.1_7 Forward -129 -115 4.03116 0.225
NP_441434.1_7 Reverse -124 -138 3.14618 0.259
NP_441738.1_2 Forward -275 -268 15.28 0.0102
NP_441738.1_2 Forward -129 -122 15.28 0.0102
NP_441738.1_2 Reverse -124 -131 15.28 0.0102
NP_441558.1_5 Forward -279 -260 13.8641 0.0544
NP_441558.1_5 Forward -133 -114 11.6025 0.0789
NP_441558.1_5 Reverse -120 -139 4.32602 0.283
NP_441645.1_7 Forward -61 -47 17.5963 0.237
NP_440209.1_1 Reverse -122 -130 18.1123 0.00295
NP_440209.1_1 Forward -131 -123 18.1123 0.00295
NP_440209.1_1 Reverse -268 -276 8.57422 0.0425
NP_440209.1_1 Forward -277 -269 8.47588 0.0457
NP_442889.1_1 Forward -234 -215 -6.39206 0.191
NP_442889.1_8 Forward -134 -120 4.03056 0.27
NP_440447.1_6 Reverse -114 -132 9.55725 0.135
NP_441713.1_1 Reverse -116 -135 -14.6519 0.259
NP_441713.1_1 Reverse -212 -231 -16.5201 0.284
NP_441713.1_8 Reverse -214 -232 9.95058 0.268
NP_441716.1_1 Reverse -268 -282 5.40779 0.231
NP_441327.1_1 Reverse -356 -375 11.3255 0.184
NP_442111.1_4 Reverse -267 -281 13.3726 0.039
NP_442111.1_4 Forward -132 -118 11.996 0.0462
NP_442111.1_4 Reverse -121 -135 9.04604 0.0655
NP_440906.1_5 Forward -130 -123 15.8704 0.0124
NP_440906.1_5 Reverse -123 -130 15.8704 0.0124
NP_440906.1_5 Reverse -269 -276 6.23397 0.234
NP_440906.1_5 Forward -276 -269 6.13563 0.241
NP_440747.1_10 Forward -280 -268 7.31547 0.00577
NP_440747.1_10 Forward -134 -122 7.21714 0.00643
NP_440747.1_10 Reverse -265 -277 7.02048 0.0108
NP_440747.1_10 Reverse -119 -131 -2.02597 0.0196
NP_441847.1_9 Forward -147 -129 9.0656 0.269
NP_441130.1_10 Forward -133 -119 10.0294 0.117
NP_441130.1_10 Reverse -120 -134 9.14437 0.128
NP_441486.1_1 Forward -134 -120 -3.63866 0.18
NP_442634.1_4 Forward -133 -119 -3.34366 0.161
NP_442634.1_4 Reverse -120 -134 -4.7203 0.217
NP_441265.1_3 Reverse -116 -130 11.406 0.0897
NP_440470.1_5 Reverse -354 -373 8.92807 0.243
NP_440403.1_4 Forward -140 -121 -4.52377 0.213
NP_440842.1_4 Reverse -160 -179 3.3521 0.207
NP_441695.1_8 Reverse -218 -232 12.9793 0.22
NP_441014.1_10 Forward -223 -204 -1.18128 0.257
NP_442848.1_9 Forward -137 -118 0.294447 0.275
NP_443018.1_3 Forward -130 -123 14.8871 0.0123
NP_443018.1_3 Reverse -123 -130 14.8871 0.0123
NP_443018.1_3 Forward -276 -269 11.7405 0.0655
NP_443018.1_3 Forward -215 -208 8.49558 0.141
NP_443018.1_3 Reverse -269 -276 5.44732 0.193
NP_441634.1_8 Forward -133 -119 -3.04867 0.295
NP_441634.1_8 Forward -71 -57 -4.32697 0.295
NP_441634.1_8 Reverse -49 -63 -4.81863 0.298
NP_440376.1_1 Forward -131 -122 19.4693 0.000692
NP_440376.1_1 Reverse -122 -131 19.4693 0.000692
NP_440376.1_1 Reverse -268 -277 15.7327 0.00625
NP_440376.1_1 Forward -277 -268 9.63616 0.0385
NP_441857.1_5 Reverse -115 -133 8.57394 0.185
NP_441588.1_4 Forward -275 -265 6.46988 0.193
NP_442687.1_7 Reverse -121 -131 18.5646 0.0028
NP_442687.1_7 Forward -132 -122 15.8113 0.0125
NP_442687.1_7 Forward -278 -268 8.73149 0.101
NP_442687.1_7 Reverse -267 -277 6.66654 0.155
NP_441077.1_6 Forward -375 -359 4.34438 0.255
NP_441077.1_6 Forward -376 -360 3.38031 0.271
NP_442946.1_7 Forward -320 -305 12.9008 0.284
NP_440642.1_8 Forward -129 -110 13.9006 0.229
NP_441422.1_7 Forward -133 -116 -8.71262 0.279
NP_442296.1_5 Forward -40 -21 9.93088 0.18
NP_442658.1_1 Reverse -120 -130 17.6791 0.00565
NP_442658.1_1 Forward -133 -123 17.0891 0.00615
NP_442658.1_1 Forward -279 -269 6.37109 0.231
NP_440141.1_8 Reverse -7 -26 9.73422 0.214
NP_441855.2_4 Forward -285 -266 17.332 0.0605
NP_442782.1_2 Reverse -218 -232 0.294584 0.291
NP_441414.1_9 Forward -277 -258 3.83436 0.0572
NP_441414.1_9 Reverse -122 -141 0.0977854 0.0851
NP_440607.1_1 Reverse -370 -389 13.3725 0.236
NP_442937.1_5 Forward -136 -117 10.0292 0.173
NP_441958.1_5 Reverse -121 -131 20.5312 0.000966
NP_441958.1_5 Forward -132 -122 12.2714 0.00183
NP_441958.1_5 Forward -278 -268 10.6981 0.0112
NP_441958.1_5 Reverse -267 -277 10.0098 0.0167
NP_439905.1_1 Forward -276 -263 14.8673 0.106
NP_439905.1_1 Forward -130 -117 7.49244 0.258
NP_443001.1_7 Forward -130 -111 1.96607 0.279
NP_440984.1_7 Reverse -117 -131 12.291 0.122
NP_440984.1_7 Forward -136 -122 8.16106 0.154
NP_439990.1_5 Reverse -263 -276 10.4424 0.128
NP_442690.1_1 Reverse -357 -376 -10.227 0.212
NP_442690.1_1 Reverse -354 -373 -13.3736 0.26
NP_442911.1_2 Reverse -112 -131 11.6025 0.0131
NP_442911.1_2 Reverse -258 -277 5.01433 0.0356
NP_442911.1_2 Forward -141 -122 -0.4922 0.0759
NP_441580.1_6 Reverse -111 -130 1.96607 0.117
NP_440153.1_5 Reverse -123 -137 9.14437 0.127
NP_440153.1_5 Reverse -269 -283 0.786239 0.289
NP_443055.1_6 Reverse -114 -132 1.00172 0.237
NP_440993.1_2 Reverse -117 -133 5.46674 0.234
NP_440993.1_2 Forward -136 -120 2.12349 0.269
NP_440993.1_3 Reverse -112 -131 13.5683 0.066
NP_440993.1_3 Forward -76 -57 3.44025 0.181
NP_440602.1_8 Reverse -295 -309 9.73436 0.298
NP_441429.1_4 Forward -389 -370 8.55343 0.267
NP_441913.1_3 Reverse -250 -263 16.3909 0.218
NP_441099.1_5 Reverse -112 -131 -1.18052 0.105
NP_441099.1_5 Forward -287 -268 -10.0303 0.24
NP_442002.1_9 Reverse -121 -128 14.1004 0.074
NP_442002.1_9 Forward -132 -125 10.7572 0.185
NP_442002.1_9 Forward -305 -298 9.97054 0.246
NP_442438.1_10 Reverse -117 -131 2.06454 0.188
NP_441000.1_6 Reverse -121 -135 15.2409 0.0396
NP_441000.1_6 Forward -278 -264 -5.21195 0.266
NP_440147.1_4 Forward -133 -120 19.6855 0.00258
NP_440147.1_4 Reverse -266 -279 14.8673 0.0213
NP_440147.1_4 Reverse -120 -133 10.344 0.0355
NP_440147.1_4 Forward -279 -266 8.37742 0.0518
NP_441295.1_4 Reverse -117 -136 6.29264 0.29
NP_441550.1_8 Reverse -120 -130 19.8424 0.00352
NP_441550.1_8 Forward -279 -269 17.1874 0.00906
NP_441550.1_8 Reverse -266 -276 13.8442 0.0207
NP_441550.1_8 Forward -133 -123 8.82935 0.112
NP_441916.1_7 Reverse -122 -132 18.4663 0.00144
NP_441916.1_7 Forward -131 -121 16.893 0.00407
NP_441916.1_7 Reverse -268 -278 7.15819 0.0745
NP_441916.1_7 Reverse -207 -217 3.91327 0.198
NP_441916.1_10 Reverse -14 -33 9.43923 0.157
NP_441916.1_10 Forward -383 -364 1.0811 0.27
NP_441041.1_7 Reverse -119 -131 12.4708 0.0611
NP_441041.1_7 Forward -134 -122 8.48655 0.135
NP_441041.1_7 Forward -280 -268 7.22324 0.171
NP_442996.1_1 Forward -373 -354 4.91741 0.251
NP_441725.1_4 Forward -282 -268 11.7987 0.0767
NP_441725.1_4 Forward -136 -122 2.35894 0.287
NP_441725.1_5 Forward -130 -120 18.7612 0.0119
NP_441725.1_5 Reverse -269 -279 2.04498 0.115
NP_441725.1_5 Reverse -123 -133 2.04498 0.115
NP_439966.1_7 Forward -133 -123 17.9741 0.00631
NP_439966.1_7 Forward -62 -52 8.53436 0.135
NP_439966.1_7 Reverse -120 -130 8.14104 0.14
NP_439966.1_7 Forward -279 -269 7.64939 0.15
NP_439966.1_7 Reverse -266 -276 5.58445 0.216
NP_439966.1_9 Reverse -120 -129 0.983037 0.253
NP_439966.1_9 Forward -133 -124 0.884706 0.253
NP_442941.1_3 Reverse -123 -133 10.7964 0.0116
NP_442941.1_3 Forward -276 -266 9.41981 0.0319
NP_442941.1_3 Forward -130 -120 2.43831 0.14
NP_442941.1_3 Reverse -269 -279 0.963343 0.16
NP_440289.1_2 Forward -134 -121 13.9823 0.0123
NP_440289.1_2 Reverse -119 -132 4.73917 0.0649
NP_440289.1_2 Forward -280 -267 2.57589 0.0936
NP_440289.1_2 Reverse -265 -278 -3.81562 0.271
NP_440260.1_8 Forward -231 -213 1.59244 0.183
NP_441678.1_9 Reverse -40 -59 -4.81876 0.297
NP_439908.1_6 Reverse -267 -286 18.9773 0.0859
NP_442281.1_1 Forward -282 -268 18.9768 0.00347
NP_442281.1_1 Forward -136 -122 11.7003 0.0438
NP_442281.1_1 Reverse -117 -131 9.6354 0.0684
NP_442281.1_1 Forward -309 -295 7.47213 0.0993
NP_441079.1_7 Reverse -348 -367 -7.96609 0.298
NP_440647.1_9 Forward -279 -261 2.87075 0.283
NP_442500.1_8 Forward -377 -363 16.1556 0.137
NP_442012.1_1 Reverse -116 -135 1.47442 0.215
NP_441644.1_6 Forward -277 -267 17.0891 0.00219
NP_441644.1_6 Forward -131 -121 15.7125 0.0048
NP_441644.1_6 Reverse -122 -132 10.1076 0.0628
NP_441644.1_6 Reverse -268 -278 6.0761 0.167
NP_442215.1_2 Forward -133 -117 1.43517 0.134
NP_442215.1_2 Forward -224 -208 -2.49807 0.198
NP_442247.1_8 Forward -133 -119 13.7659 0.247
NP_440253.1_2 Reverse -122 -140 13.7855 0.0208
NP_440253.1_2 Forward -277 -259 4.24738 0.106
NP_440253.1_2 Forward -131 -113 -0.275845 0.207
NP_440929.1_8 Forward -131 -122 19.2726 0.000701
NP_440929.1_8 Reverse -122 -131 19.2726 0.000701
NP_440929.1_8 Forward -277 -268 16.5193 0.00413
NP_440929.1_8 Reverse -268 -277 9.53783 0.0296
NP_442933.1_10 Forward -131 -122 17.601 0.00325
NP_442933.1_10 Reverse -122 -131 17.601 0.00325
NP_442933.1_10 Forward -277 -268 8.06287 0.0885
NP_442933.1_10 Reverse -268 -277 7.96454 0.0937
NP_440382.1_2 Forward -366 -347 1.47364 0.286
NP_441751.2_8 Reverse -269 -283 -4.03198 0.158
NP_441751.2_8 Forward -276 -262 -6.88358 0.289
NP_442554.1_8 Forward -130 -120 16.9913 0.0065
NP_442554.1_8 Reverse -123 -133 14.1397 0.0144
NP_442554.1_8 Reverse -269 -279 12.7631 0.0225
NP_442554.1_8 Forward -276 -266 6.37155 0.12
NP_442970.1_1 Reverse -250 -264 11.1842 0.269
NP_441762.1_7 Forward -132 -120 11.7404 0.0142
NP_441762.1_7 Reverse -121 -133 11.5437 0.0142
NP_442142.1_4 Reverse -119 -132 6.50855 0.163
NP_442142.1_4 Forward -280 -267 4.64028 0.214
NP_442142.1_4 Forward -219 -206 4.14862 0.231
NP_442292.1_1 Reverse -123 -132 9.63616 0.0183
NP_442292.1_1 Forward -130 -121 9.53783 0.0183
NP_442292.1_1 Forward -276 -267 8.65285 0.0335
NP_442292.1_1 Reverse -269 -278 -0.196935 0.239
NP_442476.1_6 Forward -130 -116 12.8809 0.0454
NP_442476.1_6 Reverse -123 -137 8.16106 0.105
NP_442381.1_8 Reverse -119 -138 -6.1954 0.154
NP_441711.1_4 Reverse -113 -132 6.39097 0.154
NP_441523.1_6 Forward -281 -262 2.16274 0.299
NP_443009.1_5 Reverse -121 -132 20.6093 0.001
NP_443009.1_5 Forward -132 -121 9.10461 0.0965
NP_443009.1_5 Reverse -267 -278 6.05637 0.177
NP_441715.1_4 Reverse -123 -133 18.8596 0.00741
NP_441715.1_4 Forward -276 -266 7.55152 0.108
NP_441198.1_8 Reverse -120 -130 15.2245 0.0427
NP_441468.1_1 Forward -130 -123 15.8704 0.0124
NP_441468.1_1 Reverse -123 -130 15.8704 0.0124
NP_441468.1_1 Reverse -52 -59 6.72562 0.126
NP_441468.1_1 Reverse -269 -276 6.13563 0.209
NP_441468.1_1 Forward -276 -269 6.0373 0.223
NP_441020.2_6 Reverse -120 -137 17.0501 0.0221
NP_441015.1_8 Reverse -206 -225 -0.590531 0.293
NP_441673.1_1 Forward -131 -122 20.8459 0.000698
NP_441673.1_1 Reverse -122 -131 20.8459 0.000698
NP_441673.1_1 Reverse -268 -277 11.1111 0.0121
NP_441673.1_1 Forward -277 -268 11.0128 0.018
NP_441826.1_2 Reverse -116 -130 6.3911 0.0937
NP_441826.1_2 Forward -283 -269 0.687908 0.177
NP_441330.1_1 Forward -136 -117 -12.0953 0.183
NP_441764.1_4 Forward -372 -355 15.6156 0.107
NP_442868.1_6 Reverse -120 -130 16.7946 0.0131
NP_442868.1_6 Forward -133 -123 10.3048 0.038
NP_442868.1_6 Reverse -266 -276 9.51814 0.0447
NP_442868.1_6 Forward -279 -269 8.73149 0.0555
NP_440785.1_2 Forward -387 -368 7.37428 0.223
NP_442427.1_8 Reverse -259 -278 12.1925 0.152
NP_442427.1_8 Reverse -113 -132 8.06259 0.203
NP_442808.1_1 Forward -132 -122 18.4657 0.00201
NP_442808.1_1 Forward -278 -268 9.321 0.0481
NP_442808.1_1 Reverse -121 -131 8.73102 0.0481
NP_442542.1_2 Forward -279 -266 13.9823 0.114
NP_442542.1_2 Reverse -120 -133 12.0157 0.114
NP_442542.1_2 Forward -133 -120 8.18076 0.16
NP_442542.1_2 Reverse -266 -279 6.60746 0.216
NP_442050.1_5 Reverse -120 -130 14.9258 0.0175
NP_442050.1_5 Forward -279 -269 11.4843 0.0959
NP_442050.1_5 Forward -133 -123 6.96107 0.27
NP_442903.1_2 Forward -382 -363 7.97315 0.165
NP_442342.1_9 Forward -133 -117 4.3851 0.25
NP_440385.1_8 Reverse -356 -375 8.45061 0.288
NP_441114.1_3 Forward -226 -217 7.86621 0.231
NP_440558.1_2 Forward -225 -206 -1.86883 0.218
NP_440558.1_2 Forward -231 -212 -5.21209 0.254
NP_441878.1_6 Reverse -121 -131 20.2362 0.0046
NP_441878.1_6 Forward -278 -268 10.4031 0.0176
NP_441878.1_6 Forward -132 -122 10.4031 0.0176
NP_441878.1_6 Reverse -267 -277 0.668351 0.139
NP_441878.1_6 Forward -63 -53 -7.98478 0.285
NP_441036.1_3 Reverse -218 -237 0.687771 0.177
NP_441036.1_8 Forward -132 -122 17.7779 0.000554
NP_441036.1_8 Reverse -121 -131 8.4365 0.174
NP_441036.1_8 Reverse -267 -277 7.05986 0.21
NP_441557.1_5 Forward -131 -122 19.9609 0.000699
NP_441557.1_5 Reverse -122 -131 19.9609 0.000699
NP_441557.1_5 Reverse -268 -277 10.2261 0.0144
NP_441557.1_5 Forward -277 -268 10.1278 0.0188
NP_442066.2_9 Forward -135 -122 10.934 0.154
NP_442066.2_9 Reverse -264 -277 10.4424 0.154
NP_441433.1_8 Reverse -379 -398 5.99764 0.174
NP_442962.1_5 Forward -30 -11 5.40766 0.242
NP_442419.1_2 Reverse -117 -136 -2.16383 0.247
NP_441458.1_10 Forward -286 -267 2.55606 0.269
NP_442192.1_5 Forward -278 -259 10.3242 0.236
NP_442192.1_8 Forward -232 -213 18.7807 0.0812
NP_442183.1_1 Reverse -122 -136 11.111 0.0757
NP_442183.1_1 Forward -131 -117 10.816 0.0784
NP_442183.1_1 Reverse -268 -282 5.60446 0.21
NP_442397.1_3 Forward -198 -180 18.702 0.23
NP_441459.1_8 Reverse -115 -128 12.9006 0.286
NP_441819.1_5 Forward -346 -327 8.92807 0.287
NP_442347.1_2 Reverse -123 -132 11.1111 0.056
NP_442347.1_2 Forward -276 -267 10.3245 0.058
NP_442347.1_2 Forward -236 -227 3.7363 0.284
NP_442347.1_2 Forward -130 -121 3.34298 0.284
NP_442645.1_2 Reverse -260 -279 -22.42 0.291
NP_441037.1_4 Reverse -120 -130 18.9151 0.00351
NP_441037.1_4 Forward -133 -123 6.92787 0.237
NP_441633.1_3 Forward -133 -120 24.897 0.00268
NP_441633.1_3 Reverse -266 -279 3.16588 0.0738
NP_441633.1_3 Reverse -120 -133 -5.78224 0.236
NP_440136.1_2 Forward -130 -123 15.9687 0.0123
NP_440136.1_2 Reverse -123 -130 15.9687 0.0123
NP_440136.1_2 Reverse -269 -276 6.23397 0.171
NP_440136.1_2 Forward -276 -269 6.13563 0.193
NP_442590.1_10 Reverse -262 -281 4.916 0.27
NP_442590.1_10 Forward -234 -215 3.44104 0.293
NP_442998.1_5 Reverse -39 -49 11.8781 0.176
NP_442998.1_5 Forward -142 -132 11.0914 0.196
NP_442998.1_5 Reverse -13 -23 9.41981 0.241
NP_442998.1_5 Reverse -217 -227 7.05986 0.3
NP_442998.1_10 Forward -275 -268 15.5754 0.0102
NP_442998.1_10 Forward -129 -122 15.5754 0.0102
NP_442998.1_10 Reverse -124 -131 15.5754 0.0102
NP_442998.1_10 Reverse -270 -277 5.84064 0.235
NP_440899.1_8 Reverse -303 -322 -7.86702 0.246
NP_440299.1_1 Reverse -118 -131 18.9965 0.00298
NP_440299.1_1 Forward -135 -122 8.86849 0.0835
NP_440299.1_1 Forward -281 -268 7.39353 0.113
NP_441799.1_1 Reverse -118 -132 7.27547 0.147
NP_441799.1_1 Forward -281 -267 3.73557 0.284
NP_441799.1_1 Forward -135 -121 3.44058 0.298
NP_441007.1_10 Reverse -117 -130 9.16406 0.104
NP_442334.1_1 Reverse -110 -129 -2.65548 0.186
NP_442201.1_10 Forward -142 -123 -5.11376 0.156
NP_442333.2_5 Forward -288 -269 -12.3902 0.249
NP_440256.1_1 Reverse -265 -284 0.392778 0.0847
NP_440256.1_1 Reverse -119 -138 -1.67217 0.106
NP_440256.1_1 Forward -134 -115 -5.99873 0.198
NP_441362.1_2 Forward -385 -366 4.5041 0.269
NP_441559.1_8 Forward -232 -218 1.86788 0.153
NP_441559.1_8 Forward -136 -122 -5.9986 0.271
NP_441559.1_8 Forward -282 -268 -6.68692 0.279
NP_440915.1_6 Reverse -118 -132 14.9459 0.0183
NP_440915.1_6 Forward -135 -121 10.4227 0.0319
NP_440915.1_6 Reverse -264 -278 8.45605 0.0543
NP_440915.1_6 Forward -281 -267 2.65453 0.113
NP_442785.1_7 Forward -279 -265 8.94771 0.279
NP_441866.1_4 Reverse -373 -386 14.3148 0.273
NP_442866.1_1 Reverse -201 -220 -7.86702 0.271
NP_442866.1_1 Reverse -263 -282 -8.65367 0.282
NP_441464.1_1 Forward -281 -262 12.8808 0.24
NP_441464.1_8 Forward -63 -49 5.89945 0.248
NP_441494.1_6 Reverse -117 -130 8.86907 0.227
NP_442386.1_9 Forward -132 -123 15.7322 0.0144
NP_442386.1_9 Reverse -121 -130 6.39082 0.219
NP_441404.1_8 Reverse -326 -340 13.8636 0.271
NP_441340.1_5 Forward -130 -123 15.6737 0.0124
NP_441340.1_5 Reverse -123 -130 15.6737 0.0124
NP_441340.1_5 Reverse -269 -276 13.5105 0.0314
NP_441340.1_5 Forward -276 -269 5.84064 0.208
NP_442484.1_2 Reverse -111 -130 2.3594 0.226
NP_441952.1_9 Forward -152 -133 12.8215 0.29
NP_442474.1_6 Forward -266 -247 10.0292 0.219
NP_442240.1_1 Forward -285 -266 3.44025 0.29
NP_440161.1_3 Reverse -120 -139 13.8641 0.13
NP_440586.1_2 Reverse -207 -226 14.8474 0.185
NP_440586.1_8 Forward -130 -123 13.2151 0.026
NP_440586.1_8 Reverse -123 -130 13.2151 0.026
NP_440586.1_8 Forward -276 -269 9.47853 0.146
NP_440586.1_8 Reverse -269 -276 5.74197 0.283
NP_442251.1_6 Forward -130 -123 15.2804 0.0124
NP_442251.1_6 Reverse -123 -130 15.2804 0.0124
NP_442251.1_6 Reverse -159 -166 8.20058 0.23
NP_442251.1_6 Reverse -296 -303 6.43063 0.298
NP_441262.1_3 Reverse -268 -275 14.7888 0.0223
NP_441262.1_3 Reverse -122 -129 14.7888 0.0223
NP_441262.1_3 Forward -131 -124 14.7888 0.0223
NP_443051.1_1 Reverse -121 -130 18.0926 0.00402
NP_443051.1_1 Forward -132 -123 10.4228 0.00754
NP_443051.1_1 Forward -278 -269 8.25953 0.0414
NP_443051.1_1 Reverse -267 -276 7.47288 0.0571
NP_439984.1_3 Reverse -261 -275 16.3219 0.128
NP_439937.1_9 Forward -132 -115 1.21811 0.0948
NP_439937.1_9 Reverse -121 -138 -16.5797 0.287
NP_441595.1_5 Reverse -115 -133 6.50899 0.222
NP_440926.1_9 Reverse -218 -237 8.94757 0.275
NP_440439.1_1 Forward -134 -121 12.114 0.0272
NP_440439.1_1 Reverse -265 -278 1.59258 0.148
NP_440439.1_1 Reverse -119 -132 1.39592 0.156
NP_440439.1_1 Forward -280 -267 -0.177378 0.209
NP_440372.1_2 Forward -130 -123 16.3621 0.0124
NP_440372.1_2 Reverse -123 -130 16.3621 0.0124
NP_440372.1_2 Reverse -269 -276 13.8055 0.0214
NP_440372.1_2 Forward -276 -269 6.52896 0.188
NP_440819.1_5 Reverse -38 -46 7.59091 0.272
NP_439977.1_5 Forward -137 -118 6.68596 0.128
NP_439977.1_5 Reverse -262 -281 -3.04881 0.295
NP_440139.1_1 Forward -137 -118 8.25844 0.115
NP_441572.1_7 Reverse -116 -135 2.3594 0.133
NP_442384.1_10 Forward -277 -264 16.1456 0.00939
NP_442384.1_10 Forward -131 -118 12.2123 0.0296
NP_442384.1_10 Reverse -268 -281 11.7207 0.0337
NP_442384.1_10 Reverse -122 -135 10.5407 0.0439
NP_442114.1_4 Reverse -122 -133 9.20345 0.17
NP_442114.1_6 Forward -380 -361 10.8459 0.253
NP_441877.1_7 Forward -136 -117 8.35677 0.218
NP_441018.1_7 Reverse -264 -283 14.9458 0.118
NP_442790.1_4 Forward -140 -121 -6.39206 0.144
NP_442790.1_4 Forward -286 -267 -7.27704 0.152
NP_442790.1_4 Reverse -113 -132 -8.16202 0.164
NP_442262.1_10 Forward -130 -123 14.1988 0.0123
NP_442262.1_10 Reverse -123 -130 14.1988 0.0123
NP_442262.1_10 Forward -276 -269 13.2155 0.0213
NP_442262.1_10 Forward -215 -208 8.59391 0.22
NP_441689.1_5 Reverse -205 -215 4.99446 0.285
NP_440344.1_10 Reverse -115 -132 6.43035 0.0182
NP_440344.1_10 Forward -284 -267 -10.9742 0.197
NP_440531.1_6 Reverse -114 -133 -4.03212 0.273
NP_442917.1_1 Forward -382 -363 6.48849 0.272
NP_441060.1_9 Forward -131 -112 17.3057 0.105
NP_442910.1_1 Reverse -115 -134 -5.11376 0.254
NP_442910.1_1 Forward -284 -265 -5.50708 0.254
NP_440297.1_9 Forward -130 -120 9.51814 0.0917
NP_440297.1_9 Reverse -269 -279 -0.118297 0.282
NP_440297.1_9 Reverse -123 -133 -0.118297 0.282
NP_440350.1_5 Reverse -368 -387 -1.27885 0.199
NP_442280.1_10 Forward -231 -213 14.9023 0.115
NP_441896.1_3 Reverse -113 -132 12.2908 0.0804
NP_441896.1_3 Reverse -259 -278 1.0811 0.222
NP_440650.1_6 Reverse -262 -281 8.55425 0.239
NP_440999.1_9 Forward -281 -267 0.392915 0.187
NP_440999.1_9 Forward -135 -121 0.294584 0.189
NP_440888.1_2 Reverse -122 -136 14.2569 0.0193
NP_440888.1_2 Forward -131 -117 13.4703 0.0285
NP_440888.1_2 Forward -277 -263 13.1753 0.0324
NP_442454.1_2 Reverse -351 -370 12.1748 0.251
NP_442454.1_2 Forward -369 -350 11.1244 0.259
NP_440600.1_4 Forward -139 -121 -6.56903 0.285
NP_439969.1_3 Reverse -117 -136 3.34271 0.237
NP_442277.1_7 Forward -379 -363 0.293278 0.215
NP_442033.1_10 Forward -133 -114 -7.86702 0.186
NP_441543.1_2 Reverse -123 -132 18.486 0.00236
NP_441543.1_2 Forward -130 -121 9.34117 0.0818
NP_441543.1_2 Forward -276 -267 7.07956 0.131
NP_442845.1_2 Reverse -116 -130 4.81781 0.251
NP_442710.1_7 Forward -376 -357 -5.87721 0.294
NP_442710.1_7 Forward -377 -358 -6.35776 0.294
NP_441469.1_8 Forward -132 -123 16.126 0.00797
NP_441469.1_8 Reverse -121 -130 13.3727 0.073
NP_443064.1_6 Forward -131 -121 13.8273 0.0796
NP_443064.1_6 Reverse -268 -278 12.6639 0.0796
NP_443064.1_6 Forward -277 -267 10.4338 0.153
NP_442578.1_7 Forward -130 -123 14.5921 0.026
NP_442578.1_7 Reverse -123 -130 14.5921 0.026
NP_442578.1_7 Reverse -269 -276 6.0373 0.18
NP_441462.1_2 Forward -131 -121 20.1379 0.000967
NP_441462.1_2 Reverse -268 -278 18.3679 0.0036
NP_441462.1_2 Reverse -122 -132 11.5831 0.00406
NP_441462.1_2 Forward -277 -267 1.74999 0.0811
NP_441621.1_7 Reverse -120 -134 4.62115 0.0934
NP_441621.1_7 Forward -62 -48 -2.55701 0.188
NP_441621.1_7 Forward -133 -119 -3.34366 0.188
NP_443062.1_1 Reverse -122 -140 13.5188 0.0616
NP_443062.1_6 Forward -139 -120 4.12936 0.221
NP_443062.1_6 Reverse -260 -279 2.75272 0.25
NP_440936.1_10 Reverse -354 -373 -2.14899 0.241
NP_442204.1_1 Forward -220 -209 3.0086 0.266
NP_442204.1_1 Forward -281 -270 2.22195 0.266
NP_442204.1_1 Forward -122 -111 0.451995 0.281
NP_441560.1_10 Forward -285 -266 7.07928 0.287
NP_440454.1_2 Forward -373 -359 11.2797 0.286
NP_440516.1_2 Forward -283 -265 1.00246 0.211
NP_440516.1_6 Forward -24 -10 10.5204 0.226
NP_440516.1_8 Reverse -268 -277 16.9127 0.00442
NP_440516.1_8 Forward -131 -122 16.9127 0.00442
NP_440516.1_8 Reverse -122 -131 16.9127 0.00442
NP_440516.1_8 Forward -277 -268 14.8477 0.00685
NP_442080.1_7 Reverse -117 -136 4.12936 0.149
NP_441033.1_2 Forward -141 -122 -6.29373 0.293
NP_442428.1_5 Forward -130 -123 15.8704 0.0124
NP_442428.1_5 Reverse -123 -130 15.8704 0.0124
NP_442428.1_5 Reverse -269 -276 6.13563 0.209
NP_442428.1_5 Forward -276 -269 6.0373 0.212
NP_440618.1_1 Reverse -35 -54 -4.03212 0.196
NP_441835.1_2 Forward -33 -14 4.916 0.27
NP_440673.1_3 Forward -275 -268 12.4288 0.0426
NP_440673.1_3 Forward -129 -122 12.4288 0.0426
NP_440673.1_3 Reverse -124 -131 12.4288 0.0426
NP_440673.1_3 Forward -29 -22 7.02061 0.274
NP_441052.1_2 Reverse -122 -132 10.5014 0.0285
NP_441052.1_2 Forward -131 -121 10.4031 0.0285
NP_441052.1_2 Forward -277 -267 10.1081 0.0295
NP_441052.1_2 Reverse -268 -278 0.865012 0.256
NP_442219.1_9 Reverse -123 -132 8.35786 0.0681
NP_442219.1_9 Forward -130 -121 8.25953 0.0681
NP_442219.1_9 Forward -276 -267 7.96454 0.0696
NP_440436.1_4 Reverse -123 -132 18.1905 0.00233
NP_440436.1_4 Forward -130 -121 15.9289 0.00508
NP_440436.1_4 Forward -276 -267 7.57079 0.124
NP_440436.1_4 Reverse -269 -278 6.39082 0.162
NP_441884.1_8 Reverse -121 -140 -8.752 0.262
NP_441884.1_9 Forward -134 -115 -13.1769 0.138
NP_440314.1_9 Forward -130 -111 -8.85033 0.254
NP_442907.1_9 Reverse -61 -80 -6.29373 0.289
NP_441719.1_4 Forward -130 -123 16.3621 0.0124
NP_441719.1_4 Reverse -123 -130 16.3621 0.0124
NP_441719.1_4 Reverse -269 -276 6.82395 0.0855
NP_441719.1_4 Forward -276 -269 6.52896 0.188
NP_441733.1_10 Reverse -119 -132 16.6372 0.0423
NP_441733.1_10 Forward -134 -121 5.62415 0.21
NP_441733.1_10 Reverse -265 -278 3.75586 0.288
NP_441004.1_1 Reverse -116 -135 -8.752 0.202
NP_441004.1_5 Reverse -118 -132 10.7177 0.243
NP_442813.1_4 Forward -43 -24 -5.9004 0.299
NP_442366.1_3 Reverse -137 -155 -4.50408 0.272
NP_439949.1_7 Forward -324 -310 15.2409 0.215
NP_441115.1_4 Forward -132 -114 11.6214 0.133
NP_442206.1_10 Forward -221 -206 4.89645 0.178
NP_442206.1_10 Reverse -268 -283 -0.0201027 0.279
NP_443054.1_2 Forward -133 -119 8.35772 0.122
NP_441851.1_10 Reverse -121 -131 17.4829 0.0027
NP_441851.1_10 Forward -132 -122 16.008 0.00552
NP_441851.1_10 Forward -278 -268 7.64985 0.135
NP_441851.1_10 Reverse -267 -277 6.17489 0.182
NP_441668.1_4 Forward -141 -122 5.50599 0.167
NP_442515.1_1 Reverse -121 -135 12.291 0.0339
NP_442515.1_1 Forward -278 -264 10.4227 0.052
NP_442515.1_1 Forward -132 -118 7.76774 0.0871
NP_442515.1_1 Reverse -267 -281 -4.7203 0.298
NP_440593.1_9 Reverse -48 -62 8.16106 0.261
NP_441982.1_6 Reverse -253 -262 14.1087 0.274
NP_442709.1_3 Reverse -261 -280 7.96426 0.121
NP_442689.1_8 Reverse -358 -375 -8.12263 0.292
NP_441349.1_10 Forward -141 -122 1.17943 0.0845
NP_440389.1_3 Forward -72 -53 17.109 0.145
NP_440432.1_9 Forward -130 -115 15.9095 0.0125
NP_440432.1_9 Reverse -123 -138 5.48643 0.055
NP_440432.1_9 Reverse -269 -284 -3.85501 0.193
NP_439960.1_10 Forward -284 -266 -1.06249 0.242
NP_440431.1_3 Forward -132 -113 -11.8986 0.292
NP_440431.1_4 Forward -378 -359 -7.49654 0.262
NP_442450.1_5 Reverse -120 -130 10.1081 0.115
NP_440040.1_8 Forward -389 -370 8.73709 0.203
NP_441570.1_1 Reverse -268 -286 -16.9921 0.26
NP_441570.1_1 Reverse -122 -140 -17.1888 0.267
NP_441078.1_4 Forward -131 -122 19.6659 0.0007
NP_441078.1_4 Reverse -122 -131 19.6659 0.0007
NP_441078.1_4 Reverse -268 -277 9.93116 0.0203
NP_441078.1_4 Forward -277 -268 9.83282 0.0226
NP_442729.1_8 Reverse -118 -131 18.5055 0.0312
NP_441663.1_8 Forward -283 -264 5.70265 0.139
NP_440526.1_3 Forward -130 -119 11.4645 0.0646
NP_440526.1_3 Forward -24 -13 0.254868 0.292
NP_441432.1_8 Reverse -267 -276 14.0611 0.0258
NP_441432.1_8 Reverse -121 -130 8.35786 0.0755
NP_441432.1_8 Forward -132 -123 8.25953 0.0755
NP_441432.1_9 Reverse -362 -375 9.95576 0.26
NP_441432.1_9 Reverse -363 -376 9.18011 0.28
NP_442320.1_8 Reverse -116 -130 15.1426 0.011
NP_442320.1_8 Forward -137 -123 5.01447 0.0442
NP_442344.1_7 Reverse -123 -142 0.786102 0.0908
NP_441732.1_2 Forward -281 -265 -16.2644 0.165
NP_442343.1_8 Reverse -33 -49 17.364 0.293
NP_440760.1_1 Forward -131 -112 -4.03212 0.0386
NP_440760.1_1 Forward -277 -258 -13.7669 0.112
NP_440760.1_1 Reverse -268 -287 -15.6352 0.152
NP_442797.1_7 Forward -132 -114 -0.177514 0.282
NP_441131.1_5 Forward -71 -52 0.392778 0.298
NP_441057.1_3 Forward -236 -217 -12.0953 0.255
NP_440913.1_1 Reverse -266 -284 10.2456 0.175
NP_440913.1_1 Reverse -318 -336 3.85406 0.288
NP_442489.1_7 Forward -131 -122 20.1576 0.000695
NP_442489.1_7 Reverse -122 -131 20.1576 0.000695
NP_442489.1_7 Forward -277 -268 10.5211 0.0102
NP_442489.1_7 Reverse -268 -277 10.4228 0.0151
NP_442079.1_7 Forward -130 -111 4.12936 0.198
NP_440559.1_1 Forward -130 -121 17.306 0.00658
NP_440559.1_1 Reverse -269 -278 14.5527 0.0154
NP_440559.1_1 Reverse -123 -132 8.75118 0.0586
NP_440559.1_1 Forward -276 -267 7.76787 0.0918
NP_441659.2_8 Forward -131 -121 19.3512 0.000966
NP_441659.2_8 Forward -277 -267 15.0247 0.00732
NP_441659.2_8 Reverse -122 -132 11.9764 0.0147
NP_441659.2_8 Reverse -268 -278 9.81313 0.0269
NP_441659.2_8 Reverse -22 -32 0.275027 0.27
NP_441092.1_3 Forward -275 -256 2.85105 0.188
NP_441040.1_2 Forward -20 -1 -14.0619 0.284
NP_439956.1_7 Reverse -262 -281 4.81767 0.257
NP_441807.1_5 Reverse -257 -276 10.1275 0.224
NP_440779.1_5 Forward -131 -114 -14.7108 0.269
NP_442346.1_5 Reverse -121 -131 17.9746 0.00128
NP_442346.1_5 Forward -132 -122 9.02648 0.118
NP_442346.1_5 Forward -278 -268 8.1415 0.146
NP_442346.1_5 Reverse -267 -277 7.55152 0.165
NP_442346.1_5 Reverse -21 -31 7.45319 0.169
NP_440545.1_3 Reverse -118 -135 -1.92778 0.177
NP_440831.1_9 Reverse -112 -131 16.3224 0.179
NP_440459.1_2 Forward -133 -116 15.3785 0.113
NP_440459.1_2 Reverse -204 -221 8.29864 0.266
NP_441653.1_2 Forward -142 -123 12.3233 0.0959
NP_442603.1_7 Forward -131 -117 19.5668 0.00949
NP_442603.1_7 Reverse -268 -282 14.4536 0.0655
NP_442603.1_7 Forward -277 -263 13.2736 0.0897
NP_441888.1_7 Forward -136 -122 12.6843 0.0743
NP_441888.1_7 Forward -282 -268 3.53951 0.225
NP_440449.1_6 Reverse -114 -132 6.40784 0.252
NP_441948.1_4 Forward -138 -120 4.83737 0.0877
NP_441948.1_4 Reverse -115 -133 -2.14413 0.16
NP_441833.1_4 Forward -130 -123 15.9687 0.0124
NP_441833.1_4 Reverse -123 -130 15.9687 0.0124
NP_441833.1_4 Forward -276 -269 6.52896 0.0924
NP_441833.1_4 Reverse -269 -276 6.23397 0.163
NP_441329.1_6 Forward -378 -359 12.9387 0.106
NP_441329.1_6 Forward -376 -357 2.62561 0.225
NP_442498.1_7 Forward -291 -274 16.5894 0.243
NP_442699.1_8 Reverse -211 -230 -11.9969 0.238
NP_442162.1_9 Forward -130 -123 16.2637 0.0124
NP_442162.1_9 Reverse -123 -130 16.2637 0.0124
NP_442162.1_9 Forward -276 -269 12.9205 0.0282
NP_442162.1_9 Reverse -269 -276 12.9205 0.0282
NP_440671.1_4 Forward -283 -269 7.37441 0.219
NP_442199.1_5 Forward -139 -120 0.294447 0.174
NP_442140.1_3 Forward -130 -120 14.828 0.0433
NP_442140.1_3 Reverse -123 -133 14.238 0.0486
NP_442140.1_3 Forward -276 -266 8.23984 0.122
NP_441609.1_1 Reverse -103 -122 -0.0988766 0.226
NP_440951.1_4 Reverse -373 -392 14.8474 0.236
NP_440875.1_9 Reverse -209 -219 12.3628 0.12
NP_440875.1_9 Reverse -124 -134 8.46937 0.233
NP_441813.1_5 Forward -133 -123 19.4496 0.00647
NP_441813.1_5 Forward -279 -269 15.2213 0.0118
NP_441813.1_5 Reverse -120 -130 8.92815 0.0347
NP_441813.1_5 Reverse -266 -276 8.4365 0.0432
NP_442028.1_1 Forward -363 -350 8.94252 0.269
NP_440590.1_4 Forward -130 -117 11.1307 0.0221
NP_440590.1_4 Reverse -123 -136 3.26421 0.0749
NP_440590.1_4 Forward -276 -263 2.08423 0.101
NP_440590.1_4 Reverse -269 -282 -3.02898 0.252
NP_440567.1_1 Forward -130 -116 16.8142 0.0165
NP_442497.1_10 Forward -130 -121 19.8626 0.00532
NP_442497.1_10 Reverse -123 -132 10.4228 0.0087
NP_442497.1_10 Reverse -269 -278 10.1278 0.0166
NP_442497.1_10 Forward -276 -267 0.589713 0.153
NP_440821.1_4 Reverse -120 -130 19.5479 0.00399
NP_440821.1_4 Forward -133 -123 10.2065 0.0163
NP_440821.1_4 Forward -279 -269 1.16001 0.141
NP_440821.1_4 Reverse -266 -276 -0.314959 0.251
NP_441239.1_9 Forward -133 -121 17.7386 0.0146
NP_441239.1_9 Reverse -120 -132 17.0502 0.0153
NP_441239.1_9 Forward -279 -267 11.347 0.0627
NP_441009.1_4 Reverse -207 -226 15.3391 0.167
NP_442568.1_8 Forward -375 -361 9.34103 0.257
NP_441892.1_1 Reverse -113 -130 0.333834 0.17
NP_441892.1_1 Forward -286 -269 -4.28772 0.258
NP_440219.1_1 Reverse -370 -389 14.9422 0.186
NP_440212.1_9 Reverse -347 -366 7.96164 0.146
NP_440212.1_9 Forward -374 -355 6.13556 0.169
NP_440949.1_7 Forward -139 -120 9.7334 0.258
NP_440354.1_7 Reverse -116 -134 7.88563 0.26
NP_442138.1_10 Reverse -122 -141 -5.50708 0.269
NP_440546.1_4 Reverse -268 -278 13.8273 0.0459
NP_440546.1_4 Forward -131 -121 12.8578 0.0572
NP_440546.1_4 Reverse -122 -132 11.8882 0.0679
NP_440546.1_4 Forward -277 -267 7.42815 0.241
NP_440462.1_6 Forward -133 -123 17.2863 0.00752
NP_440462.1_6 Reverse -120 -130 10.4031 0.0396
NP_440462.1_6 Forward -279 -269 6.76487 0.102
NP_440868.1_4 Forward -135 -123 10.2654 0.0398
NP_440868.1_4 Reverse -264 -276 7.4138 0.0691
NP_441204.1_1 Forward -140 -121 7.96426 0.25
NP_441497.1_2 Reverse -370 -389 9.53756 0.233
NP_442402.1_10 Reverse -190 -200 12.0743 0.224
NP_441848.1_4 Forward -373 -357 11.4658 0.224
NP_441084.1_6 Reverse -210 -224 9.63499 0.273
NP_441084.1_6 Reverse -120 -134 9.05325 0.295
NP_440653.1_10 Forward -130 -111 5.80098 0.22
NP_442923.1_6 Reverse -348 -362 14.3354 0.199
NP_442039.1_4 Forward -130 -123 15.1821 0.0124
NP_442039.1_4 Reverse -123 -130 15.1821 0.0124
NP_442039.1_4 Reverse -269 -276 11.6422 0.0747
NP_442039.1_7 Reverse -18 -28 10.3048 0.257
NP_442679.1_1 Forward -382 -363 -3.24547 0.25
NP_442829.1_2 Forward -376 -360 9.78387 0.287
NP_442837.1_3 Forward -130 -123 15.7721 0.0124
NP_442837.1_3 Reverse -123 -130 15.7721 0.0124
NP_442837.1_3 Forward -276 -269 6.0373 0.25
NP_442837.1_3 Reverse -269 -276 6.0373 0.25
NP_440160.1_5 Forward -273 -263 15.0242 0.267
NP_442053.1_1 Forward -131 -122 18.3876 0.0007
NP_442053.1_1 Reverse -122 -131 18.3876 0.0007
NP_442053.1_1 Forward -277 -268 16.6177 0.00257
NP_442053.1_1 Reverse -268 -277 8.65285 0.0741
NP_440505.1_3 Reverse -266 -276 16.7946 0.00614
NP_440505.1_3 Forward -133 -123 15.9097 0.00857
NP_440505.1_3 Reverse -120 -130 7.84651 0.147
NP_440505.1_7 Forward -73 -54 7.17762 0.162
NP_441203.1_1 Forward -130 -111 -12.2919 0.143
NP_442532.1_7 Reverse -122 -136 3.63784 0.192
NP_440914.1_1 Forward -277 -267 15.6417 0.00456
NP_440914.1_1 Reverse -122 -132 8.6151 0.186
NP_440914.1_1 Forward -131 -121 8.51751 0.186
NP_441011.1_8 Reverse -123 -132 16.9127 0.00602
NP_441011.1_8 Forward -130 -121 14.356 0.0249
NP_441011.1_8 Reverse -269 -278 10.8161 0.094
NP_442533.1_6 Forward -131 -122 17.2076 0.00137
NP_442533.1_6 Reverse -122 -131 17.2076 0.00137
NP_442533.1_6 Forward -277 -268 14.2577 0.0132
NP_442533.1_6 Reverse -268 -277 7.47288 0.0898
NP_440263.1_5 Reverse -251 -265 7.57108 0.294
NP_440854.1_5 Reverse -351 -365 18.3461 0.251
NP_440854.1_6 Forward -383 -364 19.6232 0.0885
NP_440854.1_7 Reverse -136 -150 14.0475 0.261
NP_441482.1_7 Forward -283 -269 24.2873 0.00253
NP_441482.1_7 Forward -137 -123 4.81781 0.0442
NP_441482.1_7 Reverse -116 -130 -0.885388 0.0612
NP_441482.1_9 Forward -230 -217 16.5383 0.278
NP_439944.1_9 Forward -130 -120 17.4829 0.00423
NP_441697.1_5 Forward -375 -356 2.14815 0.178
NP_441697.1_5 Forward -374 -355 -2.0535 0.207
NP_441697.1_5 Reverse -348 -367 -3.10391 0.217
NP_441697.1_5 Reverse -358 -377 -7.40105 0.243
NP_440816.1_2 Reverse -344 -363 5.66045 0.296
NP_441028.1_6 Reverse -75 -85 5.78111 0.243
NP_440116.1_5 Reverse -265 -282 5.44704 0.176
NP_440116.1_8 Forward -130 -111 -4.91709 0.182
NP_441527.1_4 Forward -378 -359 15.135 0.0458
NP_441527.1_4 Forward -388 -369 3.38954 0.118
NP_441527.1_4 Forward -376 -357 -8.06949 0.24
NP_441527.1_4 Forward -375 -356 -8.73794 0.25
NP_441527.1_4 Reverse -3 -22 -10.2658 0.268
NP_441527.1_4 Forward -381 -362 -10.6478 0.272
NP_441527.1_4 Forward -385 -366 -11.4117 0.282
NP_441527.1_4 Forward -387 -368 -11.8892 0.284
NP_440115.1_6 Reverse -119 -129 10.0098 0.115
NP_440115.1_6 Reverse -265 -275 6.76487 0.167
NP_440115.1_6 Forward -280 -270 6.46988 0.181
NP_440007.1_9 Forward -281 -267 9.5377 0.171
NP_441602.1_3 Forward -136 -117 6.29264 0.133
NP_441602.1_3 Reverse -263 -282 2.75272 0.191
NP_442890.1_1 Forward -140 -121 12.4875 0.27
NP_441972.1_5 Forward -130 -111 9.63589 0.065
NP_441106.1_1 Forward -132 -123 18.191 0.0028
NP_441106.1_1 Reverse -121 -130 9.73449 0.0311
NP_441420.1_1 Forward -132 -113 2.3594 0.166
NP_442306.1_10 Forward -136 -117 -19.9617 0.201
NP_440797.1_2 Reverse -11 -30 14.7126 0.21
NP_442704.1_7 Forward -323 -304 14.8474 0.181
NP_441286.1_1 Forward -132 -120 14.6903 0.00418
NP_441286.1_1 Reverse -267 -279 6.03717 0.0258
NP_441286.1_1 Reverse -121 -133 -3.40261 0.145
NP_441286.1_1 Forward -278 -266 -6.35254 0.26
NP_440670.1_8 Forward -131 -122 18.3876 0.000699
NP_440670.1_8 Reverse -122 -131 18.3876 0.000699
NP_440670.1_8 Reverse -268 -277 18.0926 0.00136
NP_440670.1_8 Forward -277 -268 15.831 0.00494
NP_440886.1_7 Forward -132 -122 17.7774 0.0011
NP_440886.1_7 Reverse -121 -131 8.04271 0.0805
NP_440886.1_7 Forward -278 -268 6.76441 0.114
NP_440886.1_7 Forward -61 -51 4.60114 0.227
NP_442614.1_2 Forward -63 -49 7.9644 0.257
NP_442614.1_2 Forward -277 -263 5.70279 0.298
NP_442072.1_9 Forward -132 -114 -11.7806 0.0798
NP_442072.1_9 Reverse -121 -139 -13.6489 0.118
NP_442072.1_9 Forward -278 -260 -22.007 0.216
NP_441753.1_10 Reverse -113 -132 2.65439 0.228
NP_441753.1_10 Reverse -24 -43 1.67108 0.257
NP_440907.2_8 Forward -130 -120 19.449 0.00351
NP_440907.2_8 Reverse -123 -133 7.94438 0.117
NP_440841.1_4 Reverse -205 -224 -10.7186 0.286
NP_441463.1_3 Forward -141 -122 3.34271 0.103
NP_442842.1_4 Forward -130 -111 4.52268 0.249
NP_441626.1_2 Forward -130 -123 15.7721 0.0124
NP_441626.1_2 Reverse -123 -130 15.7721 0.0124
NP_441626.1_2 Reverse -269 -276 12.2322 0.0511
NP_441626.1_2 Forward -276 -269 5.93897 0.231
NP_442365.1_7 Forward -281 -262 -1.7705 0.196
NP_442794.1_1 Forward -281 -269 8.59377 0.102
NP_442615.1_1 Forward -140 -122 7.09898 0.0327
NP_442615.1_1 Reverse -113 -131 -4.11075 0.177
NP_441962.1_4 Reverse -117 -136 0.294447 0.117
NP_440387.1_1 Reverse -122 -138 -1.3181 0.142
NP_440387.1_1 Forward -277 -261 -6.33298 0.279
NP_441431.1_2 Forward -134 -120 8.45543 0.216
NP_441431.1_2 Forward -280 -266 5.80051 0.288
NP_441836.1_2 Reverse -262 -281 3.93269 0.147
NP_441993.1_1 Reverse -116 -135 17.6373 0.0483
NP_441174.1_2 Reverse -48 -62 12.9793 0.23
NP_440114.1_10 Reverse -122 -136 11.996 0.0955
NP_440492.1_8 Forward -385 -366 11.8967 0.252
NP_440293.1_3 Reverse -211 -230 4.52268 0.192
NP_440293.1_9 Forward -23 -9 9.41158 0.285
NP_440766.1_4 Reverse -118 -132 9.63603 0.0871
NP_440422.1_10 Reverse -357 -376 4.88595 0.281
NP_441237.1_9 Forward -130 -120 17.2863 0.00348
NP_439910.1_2 Forward -139 -122 -13.4325 0.162
NP_440457.1_1 Reverse -118 -130 15.1819 0.0611
NP_440457.1_1 Forward -281 -269 7.61046 0.101
NP_440457.1_1 Reverse -264 -276 1.51394 0.236
NP_440457.1_1 Reverse -49 -61 -0.551008 0.268
NP_440457.1_1 Forward -135 -123 -0.649339 0.271
NP_440798.1_6 Forward -130 -117 3.36254 0.151
NP_441801.1_4 Forward -127 -117 2.92996 0.231
NP_442680.1_5 Forward -383 -364 2.70987 0.237
NP_441984.1_3 Forward -135 -117 20.472 0.0581
NP_441984.1_6 Forward -129 -117 13.5103 0.274
NP_442509.1_9 Forward -131 -121 17.3841 0.00128
NP_442509.1_9 Reverse -122 -132 16.2041 0.00739
NP_442509.1_9 Reverse -268 -278 14.6309 0.0263
NP_441253.1_9 Reverse -54 -73 17.1001 0.295
NP_442936.1_5 Reverse -370 -389 6.78429 0.293
NP_442514.1_5 Forward -285 -266 -5.1145 0.254
NP_440734.1_9 Reverse -212 -231 10.3242 0.281
NP_440554.1_4 Reverse -123 -133 16.4996 0.0189
NP_440554.1_4 Forward -130 -120 6.27322 0.123
NP_440554.1_4 Forward -276 -266 5.97822 0.128
NP_442862.1_1 Forward -72 -53 11.2092 0.248
NP_441885.1_5 Reverse -122 -132 11.4848 0.00668
NP_441885.1_5 Forward -131 -121 11.3864 0.00668
NP_441885.1_5 Forward -277 -267 11.0914 0.00874
NP_441885.1_5 Reverse -268 -278 9.12481 0.0238
NP_442341.1_7 Forward -132 -118 18.3875 0.0111
NP_442341.1_7 Forward -278 -264 4.52282 0.188
NP_442341.1_7 Reverse -267 -281 4.52282 0.188
NP_442341.1_9 Reverse -266 -280 4.62054 0.296
NP_441756.1_5 Forward -281 -262 -3.04881 0.287
NP_441756.1_5 Forward -133 -114 -3.83545 0.29
NP_441173.1_9 Reverse -192 -200 13.1954 0.184
NP_442395.2_4 Forward -132 -113 6.29183 0.15
NP_440423.1_6 Reverse -114 -133 -20.3551 0.256
NP_443000.1_7 Forward -133 -123 11.5831 0.0344
NP_443000.1_7 Reverse -266 -276 10.2065 0.0355
NP_443000.1_7 Reverse -120 -130 2.14332 0.226
NP_443000.1_7 Forward -279 -269 1.84832 0.228
NP_441842.1_10 Reverse -115 -129 14.1593 0.0636
NP_440275.1_3 Reverse -120 -130 19.5479 0.00756
NP_440275.1_3 Forward -133 -123 15.418 0.0178
NP_440275.1_3 Reverse -266 -276 12.5664 0.0316
NP_440275.1_3 Forward -279 -269 7.35486 0.0755
NP_440091.1_1 Forward -135 -123 1.41561 0.197
NP_442275.1_1 Forward -231 -212 0.982764 0.284
NP_441635.1_1 Forward -373 -354 8.16414 0.236
NP_441635.1_2 Forward -379 -360 9.69201 0.285
NP_439962.1_4 Reverse -114 -133 -8.06369 0.292
NP_440175.1_7 Reverse -264 -282 12.6812 0.208
NP_442495.1_4 Reverse -211 -221 15.713 0.124
NP_441105.1_3 Forward -227 -208 9.63589 0.0458
NP_441105.1_3 Reverse -111 -130 4.71934 0.0765
NP_440216.1_1 Reverse -122 -136 15.1426 0.00419
NP_440216.1_1 Forward -131 -117 7.27608 0.00942
NP_440216.1_1 Reverse -268 -282 -2.16369 0.0482
NP_440216.1_1 Forward -277 -263 -3.04867 0.0682
NP_440216.1_1 Forward -62 -48 -4.81863 0.115
NP_440216.1_9 Reverse -11 -20 7.27622 0.286
NP_440172.1_1 Forward -131 -121 16.303 0.00854
NP_440172.1_1 Forward -277 -267 12.0747 0.0322
NP_440172.1_1 Reverse -122 -132 8.73149 0.0586
NP_440172.1_1 Reverse -268 -278 6.56821 0.102
NP_441718.1_4 Reverse -308 -327 10.9134 0.299
NP_442015.1_10 Forward -281 -268 19.4888 0.00444
NP_442015.1_10 Reverse -118 -131 4.44418 0.169
NP_442015.1_10 Forward -135 -122 3.06754 0.185
NP_441226.1_7 Forward -130 -123 14.4934 0.0123
NP_441226.1_7 Reverse -123 -130 14.4934 0.0123
NP_441226.1_7 Reverse -269 -276 12.7234 0.0312
NP_441226.1_7 Forward -276 -269 11.5435 0.0757
NP_441111.1_7 Forward -130 -122 18.7023 0.00294
NP_441111.1_7 Reverse -123 -131 18.7023 0.00294
NP_441111.1_7 Reverse -269 -277 8.96754 0.0463
NP_441111.1_7 Forward -276 -268 8.86921 0.0589
NP_441766.1_2 Forward -131 -122 17.5026 0.00297
NP_441766.1_2 Reverse -122 -131 17.5026 0.00297
NP_441766.1_2 Forward -277 -268 13.9627 0.0114
NP_441766.1_2 Reverse -268 -277 7.76787 0.0714
NP_442417.1_5 Reverse -122 -136 9.93102 0.124
NP_440416.1_9 Reverse -261 -280 -18.3884 0.256
NP_440416.1_9 Forward -42 -23 -20.3551 0.284
NP_443052.1_8 Forward -141 -122 -8.752 0.179
NP_442116.1_6 Forward -374 -357 7.40502 0.258
NP_442116.1_6 Reverse -357 -374 6.64108 0.273
NP_442116.1_6 Reverse -370 -387 5.97264 0.289
NP_441135.1_3 Reverse -1 -20 12.1925 0.199
NP_442046.1_2 Forward -365 -352 16.867 0.193
NP_440261.1_5 Forward -130 -117 8.77074 0.0244
NP_440261.1_5 Reverse -269 -282 -2.63565 0.0924
NP_440261.1_5 Forward -276 -263 -4.79893 0.17
NP_440261.1_5 Reverse -123 -136 -12.0754 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATATTGTCTCCTGAGCAAAGTCAAAAAAAATAGTAAAAAATATTTTATTTTGCTTGAATAATGGCACTAAAATGGGTTGGTTGATTAATCCGAAAGAGCAATCTATCTTTGTTTATCAACCCGGCCGATCGCCAGAAATTTTCGACGAAACGGAGTCAAAGTTACTGATGCCAAGCTTTGCCCAGGCCATTGATTTAAATTTGGGAGAAGTATTTGGCTGGCTAATTAAGTAATGTGATCTAATCTTGACAAGGAAGATGGATAAATCCGGCGATCGCCCCAGGAGTTTGTACAATTCTGGTATGTGAATTAAACATGGCGGTAAGTCTCTTCAGTTGGCCGCCAGCCCGACGTTTTTTCCCACTGGTGTACGGTTGCCATTTTCCCTGGTCGTGTTCCC

CDS

ATGCCCTCCCACCCATCCCGCAGTACTGTTTTTAATCCCCTAGAGTGCCGCCCTGATAGTTACAAAGGCTGGTACCAACAGGGCAATACCCTCTGGCAACAGGGGAAATACAATGATGCCCTCCTCAGTTATGAACGGGCTTTGGAGTATTATCCTGGGGATTATTGGGCTTGGTACAAAAGGGGCATTACCCTGGAGCATTTGGGGCGTTACAGAGATGCGGCAGAAAGTTATGACAACGCCTGCCAAATCCAACCGGAAAACTACTGGGCTTGGTACGACCAGGGTTGTGTGTACCTCAATGAAATTGATGATTTTGCCCAGGCTATCCCTTGTTTTCAACGGGCTTTAGATTATTTACCTAAAGATTATTGGGCCACCTATCGTCTGGGGGAATCTTACCGACTCTCTGGCCAGTACGAAGCGGCGATCGCCAGTTTTCGGCAGACGTTAACCATTCGCCAGGACGATTTTTGGTCTTGGTACCGCCAGGCGGACTGTTTTCGCCGTTGGGGCCATTACGCTGAAGCTTTGCAATGCTATAAAAAATCCCTGGAAATCCGTCCCAATGATTACTGGGCCTGGTTTCGACAAGGGGAACTATGGCAACAAATCTACCGTTATGGAAGGGCGATCGCCTGCTACCACAGGGCGTTGGATGTGGAAGTGGATGACGACTATAGCTGGTATGAAATTGCCCTTTGCCAAGTACTACAAAAAAATTACTCAGATGCAGTTTATGCCCTGGGAAAGGTGTTGGAATGGTATCCAGGCACCTACCTAAGTTTGATTGAAGGGGAACCAGCTTTTGTTGACCTCCAGCCCCTGCCCAGTTACCAAGCTTTACTCCAGGCGGCTAGGCAAACTGCGATGGAACCGGTTTTTGACTGA

Protein

MPSHPSRSTVFNPLECRPDSYKGWYQQGNTLWQQGKYNDALLSYERALEYYPGDYWAWYKRGITLEHLGRYRDAAESYDNACQIQPENYWAWYDQGCVYLNEIDDFAQAIPCFQRALDYLPKDYWATYRLGESYRLSGQYEAAIASFRQTLTIRQDDFWSWYRQADCFRRWGHYAEALQCYKKSLEIRPNDYWAWFRQGELWQQIYRYGRAIACYHRALDVEVDDDYSWYEIALCQVLQKNYSDAVYALGKVLEWYPGTYLSLIEGEPAFVDLQPLPSYQALLQAARQTAMEPVFD