Your browser is old and dusty. Try Google Chrome!

Details for sll1250

ORF sll1250
Accession NP_441484.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -362 -348 14.2576 0.147
NP_441061.1_2 Reverse -169 -183 8.16106 0.0927
NP_441061.1_2 Forward -283 -269 -0.000409212 0.219
NP_441061.1_2 Reverse -342 -356 -2.06536 0.281
NP_440557.1_1 Reverse -169 -188 -0.688862 0.27
NP_440795.1_7 Forward -176 -169 14.6904 0.0123
NP_440795.1_7 Reverse -169 -176 14.6904 0.0123
NP_441418.1_6 Reverse -168 -187 -11.2103 0.0462
NP_441418.1_6 Forward -120 -101 -19.7651 0.0955
NP_441418.1_6 Forward -177 -158 -29.6965 0.234
NP_441418.1_6 Reverse -269 -288 -29.6965 0.234
NP_441418.1_6 Reverse -191 -210 -30.6798 0.291
NP_440295.1_9 Reverse -324 -343 -1.7705 0.181
NP_441453.1_4 Reverse -168 -176 16.6374 0.00633
NP_441453.1_4 Forward -177 -169 16.539 0.00633
NP_442877.1_3 Forward -289 -270 9.63507 0.274
NP_441960.1_3 Forward -177 -158 12.8414 0.291
NP_442151.1_6 Forward -278 -264 12.4876 0.0722
NP_442838.1_7 Reverse -163 -182 -9.73531 0.232
NP_441818.1_1 Reverse -169 -180 14.2178 0.0541
NP_441818.1_1 Forward -176 -165 11.8579 0.155
NP_441818.1_9 Reverse -111 -130 -0.295539 0.196
NP_441976.1_1 Forward -128 -109 12.8808 0.171
NP_442655.1_10 Forward -375 -356 -12.3902 0.261
NP_442655.1_10 Reverse -188 -207 -19.5684 0.282
NP_442173.1_1 Forward -176 -168 17.3257 0.00633
NP_442173.1_1 Reverse -169 -177 15.4574 0.00633
NP_442752.1_4 Forward -177 -170 13.8055 0.0199
NP_443027.1_4 Reverse -166 -176 7.94484 0.223
NP_443027.1_4 Forward -179 -169 7.35486 0.24
NP_439997.1_3 Forward -333 -314 9.14423 0.293
NP_442975.1_10 Reverse -164 -178 2.8506 0.269
NP_442975.1_10 Forward -282 -268 1.47397 0.297
NP_440784.1_7 Forward -176 -169 15.9687 0.0123
NP_440784.1_7 Reverse -169 -176 15.9687 0.0123
NP_441934.1_8 Reverse -108 -127 10.0292 0.292
NP_440928.1_4 Forward -133 -114 17.5015 0.0971
NP_439979.1_2 Forward -120 -101 7.7676 0.26
NP_442062.1_8 Forward -177 -167 17.3846 0.00193
NP_442062.1_8 Reverse -168 -178 15.2213 0.00881
NP_442062.1_8 Forward -213 -203 3.02829 0.289
NP_440761.1_4 Reverse -163 -182 -12.9802 0.257
NP_441859.1_3 Forward -178 -159 3.9319 0.23
NP_440304.1_4 Forward -179 -169 18.9579 0.00406
NP_440304.1_4 Reverse -267 -277 14.3364 0.051
NP_440304.1_4 Reverse -166 -176 8.23984 0.0845
NP_440304.1_4 Reverse -202 -212 3.71661 0.293
NP_442242.1_4 Forward -176 -169 14.3954 0.0124
NP_442242.1_4 Reverse -169 -176 14.3954 0.0124
NP_441035.1_3 Forward -216 -197 19.0757 0.0593
NP_441352.1_2 Forward -220 -201 2.55606 0.222
NP_441935.1_2 Reverse -257 -276 -4.03212 0.253
NP_441208.1_9 Reverse -201 -215 5.30946 0.271
NP_442276.1_2 Reverse -156 -175 2.45773 0.299
NP_440132.1_1 Reverse -166 -184 7.88563 0.286
NP_442726.1_1 Reverse -106 -125 11.1109 0.213
NP_440856.1_4 Reverse -161 -180 -4.22878 0.251
NP_440856.1_7 Forward -120 -101 1.67108 0.161
NP_441083.1_5 Reverse -168 -178 10.1081 0.0208
NP_441083.1_5 Forward -177 -167 9.51814 0.026
NP_442827.1_8 Forward -185 -166 2.9486 0.153
NP_441434.1_3 Forward -354 -335 -1.47551 0.246
NP_441738.1_2 Reverse -170 -177 15.28 0.0102
NP_441738.1_2 Forward -175 -168 11.5435 0.084
NP_441558.1_5 Reverse -267 -286 8.25926 0.155
NP_440209.1_1 Forward -177 -169 18.1123 0.00295
NP_440209.1_1 Reverse -168 -176 8.57422 0.0425
NP_440447.1_6 Forward -185 -167 1.69077 0.261
NP_441713.1_4 Forward -281 -262 10.3242 0.257
NP_441770.1_4 Forward -344 -325 -6.29373 0.22
NP_440178.1_7 Forward -178 -159 -20.8467 0.201
NP_439953.1_2 Reverse -197 -215 10.6389 0.266
NP_442111.1_4 Reverse -167 -181 15.5359 0.0212
NP_442111.1_4 Forward -132 -118 11.8976 0.0469
NP_441163.1_1 Reverse -196 -213 4.26636 0.291
NP_441831.1_5 Reverse -240 -259 9.63589 0.296
NP_441533.1_7 Forward -124 -106 14.6697 0.265
NP_440906.1_5 Forward -176 -169 15.8704 0.0124
NP_440906.1_5 Reverse -169 -176 15.8704 0.0124
NP_440747.1_1 Reverse -189 -207 13.6872 0.183
NP_440747.1_10 Reverse -165 -177 -11.6624 0.131
NP_440747.1_10 Forward -180 -168 -11.8591 0.161
NP_441130.1_10 Forward -179 -165 9.93102 0.118
NP_441486.1_1 Reverse -165 -179 2.75286 0.0765
NP_441486.1_1 Forward -180 -166 -2.26202 0.175
NP_442634.1_4 Forward -179 -165 -4.22864 0.19
NP_442634.1_4 Reverse -166 -180 -5.50694 0.258
NP_440470.1_5 Reverse -24 -43 5.77684 0.292
NP_442848.1_1 Forward -183 -169 -1.47537 0.263
NP_443018.1_3 Forward -176 -169 14.8871 0.0123
NP_443018.1_3 Reverse -169 -176 14.8871 0.0123
NP_443018.1_3 Reverse -270 -277 4.26735 0.267
NP_443018.1_3 Forward -277 -270 4.16902 0.278
NP_440376.1_1 Reverse -168 -177 9.73449 0.0365
NP_440376.1_1 Forward -177 -168 9.63616 0.0385
NP_440376.1_1 Reverse -269 -278 4.22796 0.166
NP_441857.1_5 Reverse -161 -179 3.3624 0.244
NP_442687.1_7 Forward -178 -168 17.5813 0.0089
NP_442687.1_7 Reverse -167 -177 9.02648 0.0994
NP_442191.1_4 Reverse -191 -205 10.7992 0.288
NP_440042.1_2 Reverse -158 -177 7.27595 0.184
NP_442770.1_1 Forward -309 -295 15.1419 0.271
NP_442658.1_1 Reverse -166 -176 16.7941 0.00966
NP_442658.1_1 Forward -179 -169 14.8275 0.0188
NP_442658.1_1 Reverse -267 -277 5.58445 0.262
NP_442782.1_2 Reverse -269 -283 6.98109 0.215
NP_441414.1_9 Reverse -321 -340 -10.9153 0.297
NP_441487.1_9 Forward -178 -159 -0.39387 0.255
NP_441256.1_1 Reverse -102 -121 -4.6221 0.233
NP_441256.1_1 Forward -123 -104 -8.752 0.264
NP_441958.1_5 Forward -178 -168 19.2529 0.00183
NP_441958.1_5 Reverse -167 -177 10.7964 0.0099
NP_441958.1_5 Reverse -121 -131 -1.98659 0.265
NP_440203.1_5 Forward -210 -200 9.81266 0.245
NP_439905.1_1 Forward -277 -264 7.49244 0.258
NP_440984.1_7 Reverse -264 -278 18.7808 0.0121
NP_441338.2_9 Reverse -204 -223 9.3409 0.2
NP_442911.1_2 Forward -187 -168 -5.50708 0.16
NP_443055.1_6 Forward -177 -159 4.73828 0.181
NP_443055.1_6 Forward -128 -110 -0.6699 0.265
NP_443055.1_6 Reverse -363 -381 -0.76823 0.266
NP_440993.1_2 Reverse -163 -179 3.89344 0.256
NP_441099.1_5 Forward -130 -111 -7.76869 0.18
NP_442002.1_9 Forward -178 -171 14.1004 0.074
NP_442002.1_9 Reverse -167 -174 11.6422 0.185
NP_441294.1_7 Reverse -164 -178 10.0185 0.213
NP_441646.1_1 Forward -219 -200 5.40766 0.179
NP_441646.1_1 Forward -358 -339 2.26107 0.219
NP_442438.1_10 Forward -205 -191 0.196253 0.236
NP_442431.1_10 Reverse -114 -132 -0.964162 0.298
NP_441000.1_6 Forward -178 -164 4.12949 0.0992
NP_442771.1_1 Reverse -166 -184 11.9172 0.0174
NP_442771.1_1 Forward -179 -161 -4.79907 0.166
NP_440147.1_4 Forward -179 -166 11.6223 0.0326
NP_440147.1_4 Reverse -202 -215 6.01747 0.106
NP_440147.1_4 Reverse -166 -179 2.18257 0.209
NP_441550.1_8 Forward -179 -169 15.4175 0.0132
NP_441550.1_8 Reverse -166 -176 15.0242 0.0132
NP_441916.1_7 Reverse -168 -178 17.5813 0.00295
NP_441916.1_7 Forward -177 -167 14.828 0.0115
NP_441916.1_7 Reverse -269 -279 4.89658 0.154
NP_441041.1_4 Forward -362 -343 -8.55534 0.204
NP_441041.1_4 Forward -383 -364 -11.0136 0.239
NP_441041.1_4 Forward -162 -143 -13.5702 0.291
NP_441041.1_7 Reverse -165 -177 21.0225 0.00153
NP_441041.1_7 Forward -289 -277 5.57123 0.25
NP_441041.1_7 Forward -216 -204 5.18252 0.272
NP_442004.1_6 Reverse -168 -182 4.22782 0.222
NP_441725.1_5 Reverse -169 -179 21.0229 0.00533
NP_441725.1_5 Forward -176 -166 9.7148 0.0503
NP_439966.1_7 Forward -179 -169 9.12434 0.119
NP_439966.1_7 Forward -280 -270 5.68278 0.214
NP_439966.1_9 Reverse -166 -175 0.983037 0.253
NP_442941.1_3 Reverse -169 -179 11.3864 0.0116
NP_442941.1_3 Forward -199 -189 5.28991 0.122
NP_442941.1_3 Forward -176 -166 -0.118297 0.249
NP_440289.1_2 Reverse -165 -178 14.8673 0.0107
NP_440289.1_2 Forward -180 -167 6.60746 0.0591
NP_440289.1_2 Forward -216 -203 0.215946 0.173
NP_440983.1_5 Reverse -99 -118 -7.96535 0.294
NP_441514.1_1 Reverse -304 -314 14.2496 0.274
NP_442281.1_1 Reverse -163 -177 19.9601 0.0024
NP_442281.1_1 Forward -182 -168 8.45543 0.0808
NP_442281.1_2 Forward -123 -104 17.3057 0.124
NP_441334.1_7 Reverse -166 -185 -21.1417 0.29
NP_442256.1_2 Reverse -166 -184 0.904127 0.115
NP_440437.1_1 Forward -183 -164 -4.52377 0.261
NP_440437.1_1 Forward -206 -187 -5.80207 0.292
NP_442500.1_2 Reverse -275 -294 8.75091 0.283
NP_441457.1_7 Reverse -267 -286 2.45773 0.255
NP_441556.1_4 Reverse -102 -121 18.1997 0.109
NP_441556.1_10 Forward -283 -269 10.3192 0.27
NP_440375.1_8 Forward -118 -99 -1.67217 0.293
NP_442068.1_4 Reverse -348 -367 6.48849 0.232
NP_441644.1_6 Reverse -168 -178 13.3526 0.0203
NP_441644.1_6 Forward -278 -268 11.9759 0.0408
NP_441644.1_6 Forward -177 -167 6.27276 0.163
NP_441644.1_6 Forward -131 -121 3.91283 0.256
NP_442215.1_2 Forward -215 -199 10.8749 0.0448
NP_440253.1_2 Forward -359 -341 2.77242 0.131
NP_440253.1_2 Reverse -168 -186 2.0841 0.144
NP_440253.1_2 Forward -177 -159 0.314141 0.191
NP_440929.1_8 Reverse -168 -177 9.93116 0.0249
NP_440929.1_8 Forward -177 -168 9.83282 0.0254
NP_440566.1_2 Forward -118 -99 13.4708 0.127
NP_442933.1_1 Reverse -69 -88 8.25963 0.253
NP_442933.1_10 Forward -177 -168 17.601 0.00325
NP_442933.1_10 Reverse -168 -177 17.601 0.00325
NP_441751.2_8 Reverse -169 -183 -2.26202 0.132
NP_441751.2_8 Forward -176 -162 -6.39192 0.265
NP_439922.1_3 Forward -319 -300 12.8432 0.152
NP_442554.1_8 Reverse -169 -179 14.828 0.0108
NP_442554.1_8 Forward -277 -267 8.63316 0.0712
NP_442554.1_8 Forward -176 -166 7.35486 0.0931
NP_442554.1_8 Forward -350 -340 2.7333 0.259
NP_442075.1_3 Reverse -301 -320 13.0775 0.3
NP_441762.1_7 Forward -178 -166 3.67722 0.0676
NP_441762.1_7 Reverse -167 -179 3.38223 0.0676
NP_442142.1_4 Forward -123 -110 15.26 0.0289
NP_442292.1_1 Reverse -169 -178 9.53783 0.0183
NP_442292.1_1 Forward -277 -268 5.11294 0.162
NP_442292.1_1 Forward -176 -167 0.589713 0.23
NP_440919.1_1 Forward -182 -163 -8.752 0.296
NP_442381.1_8 Reverse -165 -184 4.32602 0.0708
NP_442381.1_8 Forward -289 -270 -4.81876 0.137
NP_441711.1_3 Reverse -212 -230 18.407 0.194
NP_443009.1_5 Forward -178 -167 16.971 0.00677
NP_443009.1_5 Reverse -167 -178 14.0211 0.0249
NP_442408.2_1 Reverse -168 -187 -4.42544 0.261
NP_440947.1_9 Forward -174 -155 18.1907 0.141
NP_441715.1_4 Reverse -169 -179 7.25653 0.108
NP_440279.1_8 Forward -221 -202 19.2723 0.242
NP_441448.1_1 Forward -361 -342 15.5357 0.158
NP_440158.1_8 Reverse -166 -185 21.7306 0.0321
NP_440183.1_9 Forward -118 -99 -20.8467 0.292
NP_441198.1_8 Reverse -166 -176 14.7362 0.0644
NP_441198.1_8 Forward -179 -169 13.076 0.108
NP_441468.1_1 Forward -176 -169 15.8704 0.0124
NP_441468.1_1 Reverse -169 -176 15.8704 0.0124
NP_441468.1_1 Reverse -270 -277 4.26735 0.246
NP_441468.1_2 Forward -227 -213 18.4858 0.178
NP_441020.2_6 Reverse -166 -183 22.4583 0.00186
NP_441020.2_6 Forward -179 -162 14.9851 0.0457
NP_441673.1_1 Reverse -168 -177 11.1111 0.0121
NP_441673.1_1 Forward -177 -168 11.0128 0.018
NP_441731.1_3 Forward -185 -166 -5.40875 0.284
NP_442253.1_5 Forward -216 -199 9.57695 0.122
NP_442253.1_5 Reverse -200 -217 -5.86102 0.295
NP_441826.1_2 Forward -183 -169 3.04785 0.115
NP_442490.1_9 Forward -189 -170 16.9124 0.0517
NP_442868.1_6 Forward -179 -169 9.22315 0.0527
NP_442868.1_6 Reverse -166 -176 7.94484 0.0657
NP_442719.1_2 Reverse -354 -372 -3.32482 0.2
NP_442427.1_8 Reverse -159 -178 6.78429 0.23
NP_442808.1_1 Forward -279 -269 6.86274 0.0941
NP_442808.1_1 Reverse -9 -19 2.14288 0.275
NP_442542.1_2 Reverse -166 -179 12.8023 0.114
NP_442542.1_9 Forward -163 -149 6.58715 0.229
NP_442050.1_5 Forward -179 -169 15.8108 0.0091
NP_442050.1_5 Reverse -166 -176 14.0409 0.0259
NP_442342.1_9 Reverse -166 -182 4.28677 0.25
NP_441114.1_3 Forward -211 -202 8.35786 0.231
NP_441114.1_3 Forward -118 -109 7.37455 0.239
NP_440111.2_2 Reverse -186 -205 -3.24547 0.265
NP_441518.1_3 Forward -187 -168 -13.7669 0.264
NP_441878.1_6 Reverse -167 -177 10.5014 0.0176
NP_441878.1_6 Forward -178 -168 10.4031 0.0176
NP_441878.1_6 Reverse -203 -213 2.24165 0.0462
NP_441878.1_6 Reverse -268 -278 -7.78811 0.266
NP_441036.1_8 Reverse -167 -177 8.1415 0.176
NP_441036.1_8 Reverse -163 -173 6.37155 0.234
NP_441557.1_5 Forward -177 -168 18.6826 0.0015
NP_441557.1_5 Reverse -168 -177 10.5211 0.00695
NP_441520.1_5 Forward -143 -124 13.5691 0.148
NP_442066.2_9 Reverse -265 -278 9.2624 0.176
NP_441308.1_8 Reverse -189 -199 15.123 0.218
NP_441564.1_10 Reverse -38 -57 1.27776 0.287
NP_442183.1_1 Reverse -168 -182 19.0758 0.0065
NP_442183.1_1 Forward -177 -163 9.73436 0.094
NP_440356.1_1 Reverse -211 -230 13.175 0.247
NP_440440.1_5 Reverse -112 -131 8.94757 0.198
NP_440861.1_3 Forward -188 -170 11.1305 0.271
NP_442347.1_2 Reverse -375 -384 5.11294 0.238
NP_442347.1_2 Reverse -11 -20 3.83464 0.284
NP_442347.1_2 Reverse -169 -178 3.34298 0.284
NP_442645.1_2 Forward -128 -109 -8.65367 0.131
NP_442645.1_2 Forward -359 -340 -16.3235 0.23
NP_442965.1_5 Forward -226 -208 15.5554 0.126
NP_441037.1_4 Reverse -267 -277 13.2626 0.0692
NP_441037.1_4 Reverse -166 -176 9.85159 0.21
NP_441037.1_4 Forward -179 -169 9.65667 0.21
NP_442317.1_6 Forward -182 -163 16.3224 0.0832
NP_441633.1_3 Forward -179 -166 -3.81562 0.177
NP_440136.1_2 Forward -176 -169 15.9687 0.0123
NP_440136.1_2 Reverse -169 -176 15.9687 0.0123
NP_442590.1_10 Reverse -191 -210 13.9625 0.126
NP_442998.1_5 Reverse -326 -336 13.1564 0.158
NP_442998.1_5 Reverse -224 -234 10.6981 0.206
NP_442998.1_10 Reverse -170 -177 15.5754 0.0102
NP_442998.1_10 Forward -175 -168 5.74231 0.255
NP_440899.1_2 Reverse -180 -199 7.37347 0.23
NP_440299.1_1 Forward -181 -168 19.5865 0.00216
NP_441799.1_1 Reverse -164 -178 3.8339 0.279
NP_441007.1_5 Forward -119 -100 14.1591 0.182
NP_441007.1_10 Reverse -264 -277 9.85238 0.083
NP_441007.1_10 Reverse -163 -176 1.78924 0.203
NP_441007.1_10 Forward -152 -139 0.904263 0.212
NP_441007.1_10 Forward -182 -169 -0.865694 0.295
NP_442201.1_10 Forward -188 -169 -8.752 0.227
NP_441559.1_8 Forward -341 -327 3.24451 0.143
NP_440915.1_5 Forward -110 -91 14.9085 0.283
NP_440915.1_6 Reverse -164 -178 12.291 0.0218
NP_440915.1_6 Forward -181 -167 3.73617 0.1
NP_440915.1_6 Forward -290 -276 -1.67204 0.243
NP_441296.1_9 Reverse -143 -156 15.1616 0.18
NP_442866.1_1 Reverse -163 -182 -8.26035 0.279
NP_441464.1_8 Forward -177 -163 9.83269 0.189
NP_441939.1_3 Forward -277 -258 5.01433 0.292
NP_441199.1_6 Forward -204 -185 0.0977854 0.254
NP_442993.1_1 Forward -177 -161 -6.23465 0.146
NP_442993.1_1 Reverse -204 -220 -11.3479 0.244
NP_440677.1_1 Reverse -102 -121 17.2074 0.0932
NP_442386.1_9 Reverse -167 -176 7.37413 0.219
NP_442386.1_9 Forward -279 -270 6.78414 0.219
NP_442386.1_9 Forward -178 -169 6.39082 0.219
NP_442386.1_9 Forward -331 -322 5.21086 0.262
NP_440570.1_5 Reverse -101 -120 -3.54046 0.29
NP_442054.1_3 Reverse -217 -236 3.34271 0.112
NP_441340.1_5 Forward -176 -169 15.6737 0.0124
NP_441340.1_5 Reverse -169 -176 15.6737 0.0124
NP_441340.1_5 Forward -277 -270 4.07068 0.239
NP_442791.1_9 Reverse -355 -374 11.5033 0.284
NP_440327.1_3 Reverse -195 -214 12.1925 0.297
NP_442240.1_1 Reverse -195 -214 17.2065 0.135
NP_440161.1_3 Forward -122 -103 8.35759 0.273
NP_440586.1_8 Forward -176 -169 13.2151 0.026
NP_440586.1_8 Reverse -169 -176 13.2151 0.026
NP_442251.1_6 Forward -176 -169 15.2804 0.0124
NP_442251.1_6 Reverse -169 -176 15.2804 0.0124
NP_440192.1_4 Forward -374 -355 15.898 0.169
NP_440192.1_4 Forward -353 -334 9.39761 0.276
NP_441262.1_3 Forward -177 -170 14.7888 0.0223
NP_441262.1_3 Reverse -168 -175 13.9038 0.0336
NP_440027.1_3 Forward -226 -208 2.28001 0.292
NP_443051.1_1 Forward -178 -169 18.0926 0.00402
NP_443051.1_1 Reverse -167 -176 8.75118 0.027
NP_443051.1_1 Reverse -268 -277 0.29472 0.195
NP_439996.1_2 Reverse -103 -122 2.3594 0.27
NP_440926.1_9 Forward -374 -355 7.86593 0.275
NP_440439.1_1 Forward -180 -167 2.77255 0.128
NP_440439.1_6 Forward -319 -300 7.17762 0.242
NP_440372.1_2 Forward -176 -169 16.3621 0.0124
NP_440372.1_2 Reverse -169 -176 16.3621 0.0124
NP_440819.1_5 Reverse -326 -334 7.59091 0.272
NP_440316.1_10 Reverse -268 -278 5.97822 0.275
NP_439977.1_5 Reverse -162 -181 -0.590531 0.229
NP_440139.1_1 Reverse -162 -181 10.52 0.0917
NP_440139.1_1 Forward -183 -164 3.14526 0.214
NP_440267.1_2 Reverse -163 -177 11.7987 0.125
NP_442384.1_10 Reverse -168 -181 17.8172 0.00567
NP_441877.1_9 Forward -318 -301 1.51381 0.297
NP_442262.1_10 Forward -176 -169 14.1988 0.0123
NP_442262.1_10 Reverse -169 -176 14.1988 0.0123
NP_441689.1_5 Forward -179 -169 8.63269 0.132
NP_440344.1_10 Forward -184 -167 -11.3676 0.212
NP_440344.1_10 Reverse -161 -178 -11.5642 0.219
NP_440531.1_8 Forward -374 -355 3.93269 0.269
NP_442123.1_3 Forward -177 -158 12.8808 0.191
NP_440189.1_10 Reverse -157 -176 7.57094 0.242
NP_440562.1_3 Reverse -169 -186 6.72535 0.15
NP_441640.1_6 Reverse -377 -396 8.25926 0.289
NP_440297.1_9 Reverse -169 -179 19.0562 0.0359
NP_440297.1_9 Forward -176 -166 0.963343 0.282
NP_441592.1_4 Forward -177 -158 -2.0655 0.26
NP_440999.1_9 Reverse -164 -178 2.45787 0.149
NP_440999.1_9 Forward -279 -265 -0.197071 0.201
NP_440888.1_2 Reverse -168 -182 7.86545 0.179
NP_440888.1_2 Forward -278 -264 5.30886 0.284
NP_439969.1_6 Reverse -352 -371 13.4708 0.0861
NP_442277.1_7 Forward -83 -67 -0.852625 0.231
NP_441123.1_6 Reverse -160 -178 21.7503 0.0285
NP_441543.1_2 Reverse -169 -178 9.34117 0.0818
NP_441543.1_2 Forward -176 -167 6.29291 0.153
NP_441543.1_2 Forward -277 -268 4.22796 0.267
NP_442845.1_4 Forward -179 -160 10.9142 0.178
NP_441304.1_10 Forward -375 -366 13.8644 0.23
NP_441304.1_10 Forward -67 -58 13.7661 0.239
NP_441469.1_8 Forward -178 -169 13.3727 0.073
NP_441469.1_8 Forward -279 -270 12.3894 0.111
NP_441469.1_8 Reverse -167 -176 5.3096 0.277
NP_442315.1_5 Forward -365 -355 16.1063 0.3
NP_443064.1_6 Reverse -168 -178 11.0156 0.13
NP_443064.1_6 Forward -177 -167 10.2399 0.166
NP_442337.1_6 Forward -115 -96 13.7393 0.245
NP_442578.1_7 Forward -176 -169 14.5921 0.026
NP_442578.1_7 Reverse -169 -176 14.5921 0.026
NP_440148.1_1 Reverse -44 -63 1.86774 0.219
NP_441462.1_2 Forward -177 -167 19.1546 0.00206
NP_441462.1_2 Reverse -168 -178 10.4031 0.011
NP_443062.1_6 Forward -185 -166 5.11266 0.209
NP_442204.1_1 Forward -112 -101 1.63197 0.267
NP_442204.1_1 Forward -181 -170 0.353664 0.281
NP_442204.1_1 Reverse -107 -118 -0.0396598 0.285
NP_440516.1_6 Reverse -371 -385 10.0287 0.233
NP_440516.1_6 Forward -120 -106 9.6354 0.236
NP_440516.1_8 Forward -177 -168 9.4395 0.0183
NP_440516.1_8 Reverse -168 -177 7.17789 0.0754
NP_440516.1_8 Reverse -269 -278 -0.295266 0.232
NP_442428.1_5 Forward -176 -169 15.8704 0.0124
NP_442428.1_5 Reverse -169 -176 15.8704 0.0124
NP_442428.1_5 Reverse -270 -277 4.66067 0.244
NP_441443.1_7 Forward -375 -356 13.2741 0.0924
NP_441835.1_2 Reverse -333 -352 6.39097 0.27
NP_440673.1_2 Reverse -137 -156 9.31652 0.248
NP_440673.1_3 Forward -175 -168 14.0021 0.0426
NP_440673.1_3 Reverse -170 -177 12.4288 0.0426
NP_440673.1_3 Forward -118 -111 8.98723 0.203
NP_440673.1_3 Forward -276 -269 8.8889 0.206
NP_440673.1_3 Reverse -376 -383 7.41394 0.263
NP_440865.1_9 Reverse -162 -181 -5.80207 0.217
NP_441052.1_2 Reverse -168 -178 1.94665 0.221
NP_441052.1_2 Forward -177 -167 0.57002 0.256
NP_442219.1_8 Reverse -302 -321 7.10414 0.277
NP_442219.1_9 Forward -176 -167 8.94785 0.0681
NP_442219.1_9 Reverse -169 -178 8.25953 0.0681
NP_440592.1_7 Reverse -149 -168 14.2574 0.212
NP_440436.1_4 Reverse -169 -178 15.9289 0.00508
NP_440436.1_4 Forward -176 -167 14.6506 0.0111
NP_440436.1_4 Forward -119 -110 8.75075 0.0995
NP_441884.1_9 Reverse -165 -184 -15.7335 0.138
NP_441884.1_9 Forward -216 -197 -22.715 0.284
NP_441884.1_9 Forward -392 -373 -23.9933 0.284
NP_442864.1_2 Reverse -133 -152 9.73422 0.296
NP_440314.1_9 Reverse -169 -188 -5.80207 0.225
NP_440648.1_1 Forward -278 -259 5.89931 0.21
NP_441719.1_4 Forward -176 -169 16.3621 0.0124
NP_441719.1_4 Reverse -169 -176 16.3621 0.0124
NP_441733.1_10 Reverse -165 -178 15.7522 0.0564
NP_441733.1_10 Forward -180 -167 6.4108 0.188
NP_441004.1_1 Reverse -263 -282 -8.65367 0.201
NP_441004.1_1 Forward -168 -149 -15.8318 0.279
NP_441004.1_1 Forward -378 -359 -17.6018 0.292
NP_442366.1_1 Forward -33 -20 15.2606 0.272
NP_442366.1_3 Forward -178 -160 -0.865831 0.201
NP_442366.1_3 Reverse -146 -164 -3.52077 0.251
NP_442366.1_3 Reverse -167 -185 -4.79907 0.276
NP_440129.1_10 Forward -184 -170 6.58777 0.177
NP_442873.1_9 Reverse -89 -108 13.2733 0.128
NP_440296.1_10 Forward -216 -197 -14.4552 0.269
NP_443054.1_2 Forward -179 -165 11.5043 0.0761
NP_443054.1_2 Reverse -202 -216 5.50613 0.231
NP_441851.1_10 Forward -178 -168 18.6629 0.0027
NP_441851.1_10 Reverse -167 -177 8.23984 0.12
NP_442622.1_1 Forward -178 -159 -2.85214 0.177
NP_442515.1_1 Forward -178 -164 5.40779 0.107
NP_442515.1_1 Reverse -167 -181 4.12949 0.108
NP_441982.1_6 Reverse -40 -49 13.8222 0.274
NP_441982.1_6 Reverse -325 -334 11.6259 0.288
NP_442709.1_3 Forward -369 -350 3.04771 0.288
NP_440940.1_7 Reverse -158 -176 8.86816 0.167
NP_440432.1_9 Forward -176 -161 16.4995 0.0111
NP_440432.1_9 Reverse -169 -184 0.0782283 0.16
NP_440432.1_9 Forward -277 -262 -3.95334 0.194
NP_442843.1_1 Reverse -322 -341 -11.2103 0.286
NP_440474.1_8 Reverse -205 -219 8.25877 0.189
NP_441477.1_3 Reverse -100 -119 19.6648 0.127
NP_442450.1_5 Forward -179 -169 19.1546 0.0103
NP_440195.1_5 Reverse -162 -181 6.88262 0.192
NP_440195.1_5 Forward -219 -200 1.57275 0.287
NP_442006.1_2 Forward -156 -139 -14.5141 0.203
NP_442006.1_2 Forward -228 -211 -15.8908 0.23
NP_442006.1_2 Forward -380 -363 -17.0707 0.269
NP_442006.1_2 Forward -330 -313 -17.5624 0.279
NP_442006.1_2 Forward -120 -103 -17.8574 0.283
NP_442006.1_2 Reverse -102 -119 -19.1357 0.299
NP_441570.1_1 Forward -177 -159 -17.4838 0.278
NP_441078.1_4 Reverse -168 -177 9.93116 0.0203
NP_441078.1_4 Forward -177 -168 9.83282 0.0226
NP_441078.1_4 Reverse -204 -213 -1.47524 0.266
NP_441078.1_4 Reverse -269 -278 -1.86856 0.272
NP_442729.1_5 Forward -115 -105 13.353 0.231
NP_442729.1_8 Forward -181 -168 8.57408 0.125
NP_441663.1_8 Forward -206 -187 -0.787193 0.233
NP_440707.1_9 Forward -107 -88 1.17943 0.292
NP_440526.1_3 Forward -176 -165 11.3662 0.0646
NP_440526.1_3 Reverse -169 -180 1.6315 0.267
NP_441432.1_8 Forward -178 -169 8.35786 0.0755
NP_441432.1_8 Reverse -268 -277 4.52295 0.206
NP_441432.1_8 Reverse -121 -130 2.94966 0.28
NP_441432.1_9 Forward -59 -46 10.1497 0.256
NP_443024.1_3 Forward -374 -364 10.2065 0.289
NP_442320.1_8 Reverse -162 -176 4.71948 0.0472
NP_442320.1_8 Forward -183 -169 4.03116 0.0559
NP_441732.1_2 Forward -181 -165 -16.4611 0.167
NP_441057.1_3 Forward -345 -326 -1.96717 0.147
NP_441057.1_4 Reverse -187 -205 -0.669169 0.272
NP_441072.1_2 Reverse -157 -176 6.98095 0.261
NP_442489.1_7 Reverse -168 -177 10.4228 0.0151
NP_442489.1_7 Forward -177 -168 10.3245 0.0193
NP_442489.1_7 Reverse -269 -278 -1.37691 0.195
NP_442489.1_7 Reverse -204 -213 -1.6719 0.235
NP_442489.1_7 Forward -213 -204 -1.96689 0.28
NP_442079.1_7 Reverse -169 -188 9.43923 0.112
NP_440559.1_1 Forward -176 -167 17.4043 0.00658
NP_440559.1_1 Reverse -169 -178 17.306 0.00658
NP_441659.2_8 Reverse -168 -178 17.0896 0.00284
NP_441659.2_8 Forward -177 -167 9.7148 0.0271
NP_441659.2_8 Forward -278 -268 -0.118297 0.287
NP_442913.1_10 Reverse -159 -178 -0.295539 0.158
NP_440779.1_5 Forward -177 -160 5.44704 0.0372
NP_440779.1_5 Reverse -168 -185 -14.5141 0.246
NP_442346.1_5 Forward -178 -168 17.4829 0.00248
NP_442346.1_5 Reverse -167 -177 15.8113 0.0045
NP_442346.1_5 Reverse -203 -213 4.79825 0.272
NP_440545.1_3 Reverse -164 -181 -2.3211 0.183
NP_440025.1_3 Reverse -222 -236 12.6438 0.264
NP_441126.1_6 Reverse -300 -314 14.231 0.267
NP_440459.1_2 Forward -171 -154 9.97027 0.212
NP_440459.1_2 Forward -228 -211 7.31533 0.296
NP_440010.1_10 Forward -293 -274 1.67108 0.295
NP_441943.1_8 Reverse -194 -213 -13.3736 0.265
NP_442551.1_4 Forward -215 -200 1.74985 0.245
NP_442900.1_2 Reverse -123 -142 3.24438 0.285
NP_442603.1_7 Reverse -168 -182 13.372 0.089
NP_442603.1_7 Forward -206 -192 6.48882 0.24
NP_442828.1_7 Reverse -326 -345 -6.1954 0.296
NP_441888.1_7 Forward -182 -168 4.12949 0.225
NP_441948.1_4 Reverse -197 -215 -0.374176 0.139
NP_441833.1_4 Forward -176 -169 15.9687 0.0124
NP_441833.1_4 Reverse -169 -176 15.9687 0.0124
NP_443040.1_1 Forward -82 -68 10.7637 0.291
NP_440751.1_3 Reverse -343 -362 16.2232 0.127
NP_441329.1_1 Forward -95 -76 18.3818 0.0847
NP_442060.1_10 Forward -214 -195 9.73422 0.25
NP_442162.1_9 Forward -176 -169 16.2637 0.0124
NP_442162.1_9 Reverse -169 -176 16.2637 0.0124
NP_440772.1_6 Forward -119 -100 10.4225 0.239
NP_442199.1_5 Forward -286 -267 -4.6221 0.229
NP_442140.1_3 Forward -176 -166 14.533 0.0486
NP_442140.1_3 Reverse -169 -179 5.68323 0.198
NP_442140.1_3 Reverse -270 -280 5.48657 0.207
NP_441609.1_1 Forward -62 -43 -0.39387 0.238
NP_441813.1_5 Forward -179 -169 16.1063 0.01
NP_441813.1_5 Reverse -166 -176 8.1415 0.0478
NP_441813.1_5 Forward -280 -270 0.176696 0.215
NP_442254.1_1 Reverse -99 -118 -4.81876 0.282
NP_440590.1_4 Reverse -169 -182 -4.60227 0.263
NP_440567.1_1 Reverse -169 -183 10.226 0.0385
NP_440567.1_1 Forward -176 -162 8.25939 0.0597
NP_442497.1_10 Reverse -169 -178 19.8626 0.00532
NP_442497.1_10 Forward -176 -167 17.9943 0.00813
NP_440821.1_4 Forward -179 -169 19.8429 0.00399
NP_440821.1_4 Reverse -166 -176 10.7964 0.0146
NP_441239.1_9 Reverse -166 -178 16.4603 0.0175
NP_441239.1_9 Forward -179 -167 11.1504 0.0648
NP_441239.1_9 Forward -215 -203 7.02048 0.173
NP_441239.1_9 Forward -280 -268 5.54551 0.217
NP_441892.1_1 Reverse -159 -176 -1.33779 0.203
NP_440665.1_1 Forward -120 -101 -15.3402 0.267
NP_440604.1_6 Forward -177 -158 -0.0988766 0.171
NP_440796.1_3 Forward -184 -166 10.2448 0.204
NP_441017.1_6 Forward -181 -167 13.372 0.195
NP_441541.1_1 Forward -94 -76 -1.62138 0.24
NP_441936.1_9 Forward -113 -94 14.1591 0.26
NP_440546.1_4 Forward -177 -167 14.5061 0.0459
NP_440546.1_4 Reverse -168 -178 13.6334 0.0459
NP_440675.1_3 Forward -177 -158 8.45592 0.204
NP_440462.1_6 Reverse -166 -176 9.7148 0.0429
NP_440462.1_6 Forward -179 -169 7.84651 0.0699
NP_442340.1_3 Forward -154 -135 -4.03212 0.213
NP_440868.1_4 Forward -282 -270 1.90727 0.171
NP_441582.1_5 Forward -215 -196 4.22689 0.236
NP_442402.1_4 Forward -344 -325 0.588665 0.182
NP_442402.1_10 Forward -335 -325 13.4509 0.202
NP_442402.1_10 Reverse -96 -106 11.6809 0.241
NP_441848.1_4 Forward -323 -307 8.50558 0.288
NP_441084.1_6 Forward -257 -243 9.8289 0.263
NP_440696.1_6 Forward -298 -279 3.14605 0.288
NP_442039.1_4 Forward -176 -169 15.1821 0.0124
NP_442039.1_4 Reverse -169 -176 15.1821 0.0124
NP_442039.1_7 Reverse -323 -333 12.4681 0.231
NP_442039.1_7 Forward -348 -338 7.45319 0.276
NP_442829.1_2 Reverse -45 -61 8.14109 0.287
NP_440825.1_7 Forward -176 -166 11.4458 0.239
NP_442837.1_3 Forward -176 -169 15.7721 0.0124
NP_442837.1_3 Reverse -169 -176 15.7721 0.0124
NP_442053.1_1 Forward -177 -168 9.24284 0.068
NP_442053.1_1 Reverse -168 -177 8.94785 0.07
NP_440505.1_3 Forward -179 -169 7.55152 0.151
NP_441701.1_3 Forward -360 -343 8.10198 0.249
NP_441203.1_1 Reverse -169 -188 -3.04881 0.0658
NP_442532.1_7 Reverse -269 -283 2.35953 0.245
NP_440914.1_1 Reverse -168 -178 7.24882 0.242
NP_441699.1_4 Forward -237 -218 16.5191 0.246
NP_441011.1_8 Forward -176 -167 15.6344 0.00738
NP_441011.1_8 Reverse -169 -178 14.356 0.0249
NP_442533.1_6 Forward -177 -168 15.1427 0.00675
NP_442533.1_6 Reverse -168 -177 7.47288 0.0898
NP_442533.1_6 Forward -278 -269 5.01461 0.16
NP_442541.1_10 Forward -213 -199 0.982316 0.292
NP_441482.1_7 Forward -183 -169 15.7325 0.00937
NP_439944.1_9 Reverse -169 -179 17.3846 0.00516
NP_439944.1_9 Forward -176 -166 15.8113 0.0144
NP_441527.1_4 Forward -80 -61 -1.48055 0.148
NP_440115.1_6 Reverse -165 -175 8.82982 0.125
NP_439965.1_1 Forward -209 -190 -5.01543 0.2
NP_442492.1_2 Forward -177 -158 14.3558 0.0647
NP_441106.1_1 Reverse -268 -277 12.5861 0.0301
NP_441106.1_1 Forward -178 -169 9.73449 0.0311
NP_441106.1_1 Reverse -167 -176 8.84951 0.0431
NP_439903.1_6 Reverse -165 -184 6.58682 0.167
NP_442306.1_10 Reverse -199 -218 -13.2752 0.197
NP_442306.1_10 Reverse -337 -356 -15.4385 0.197
NP_441286.1_1 Forward -178 -166 5.54551 0.0259
NP_441286.1_1 Reverse -167 -179 5.34885 0.0259
NP_440670.1_8 Forward -177 -168 8.94785 0.0606
NP_440670.1_8 Reverse -168 -177 8.84951 0.0606
NP_440886.1_7 Forward -279 -269 8.04271 0.0805
NP_440886.1_7 Reverse -101 -111 4.10949 0.253
NP_440886.1_7 Forward -201 -191 3.51951 0.279
NP_440083.1_2 Forward -116 -97 4.03102 0.143
NP_442382.1_9 Forward -340 -321 8.16011 0.286
NP_439995.1_5 Reverse -158 -177 8.84924 0.235
NP_442401.1_2 Reverse -128 -147 9.7334 0.201
NP_440028.1_6 Forward -119 -101 10.7372 0.277
NP_442022.1_4 Forward -375 -356 10.1275 0.239
NP_440907.2_8 Forward -176 -166 16.5975 0.0115
NP_440907.2_8 Reverse -169 -179 9.81266 0.103
NP_442264.1_2 Forward -187 -170 6.82368 0.25
NP_442264.1_2 Reverse -164 -181 5.44704 0.276
NP_441021.1_1 Reverse -169 -188 8.65258 0.0482
NP_441021.1_1 Forward -176 -157 -5.50708 0.177
NP_441021.1_8 Reverse -199 -217 3.85406 0.226
NP_441021.1_8 Forward -182 -164 2.37909 0.25
NP_441463.1_3 Reverse -158 -177 -6.88371 0.251
NP_441463.1_3 Forward -288 -269 -8.85033 0.274
NP_441626.1_2 Forward -176 -169 15.7721 0.0124
NP_441626.1_2 Reverse -169 -176 15.7721 0.0124
NP_442211.1_3 Reverse -269 -288 10.0008 0.257
NP_442365.1_5 Forward -176 -157 12.9791 0.121
NP_442794.1_1 Forward -181 -169 7.4138 0.138
NP_442794.1_1 Forward -166 -154 3.87389 0.283
NP_442615.1_1 Reverse -159 -177 1.19912 0.0894
NP_442615.1_1 Forward -186 -168 -4.70074 0.192
NP_442615.1_1 Reverse -260 -278 -5.68405 0.22
NP_441962.1_4 Reverse -163 -182 -12.5869 0.26
NP_440387.1_1 Reverse -168 -184 7.43336 0.0282
NP_441431.1_2 Reverse -165 -179 8.75042 0.207
NP_441431.1_2 Forward -216 -202 6.39049 0.272
NP_441488.1_7 Forward -183 -164 6.58763 0.139
NP_441836.1_2 Forward -284 -265 0.294447 0.203
NP_441993.1_1 Reverse -266 -285 4.67549 0.215
NP_440358.1_8 Reverse -301 -320 0.491109 0.263
NP_440114.1_10 Forward -177 -163 14.4542 0.0401
NP_442090.1_2 Forward -93 -74 11.1244 0.239
NP_442090.1_2 Forward -49 -30 7.78217 0.281
NP_441206.1_4 Reverse -199 -218 15.5357 0.0296
NP_441510.2_7 Forward -212 -198 11.1104 0.28
NP_440287.1_6 Forward -140 -121 11.9958 0.127
NP_440293.1_3 Forward -358 -339 -0.295539 0.228
NP_440766.1_4 Forward -181 -167 8.45605 0.0871
NP_441421.1_9 Forward -88 -69 3.93269 0.226
NP_442743.1_1 Reverse -350 -369 6.09517 0.268
NP_442930.1_1 Forward -139 -129 10.501 0.276
NP_442930.1_1 Reverse -131 -141 10.1076 0.278
NP_439910.1_2 Reverse -160 -177 -21.4956 0.183
NP_442867.1_8 Reverse -211 -230 7.27595 0.244
NP_440457.1_1 Forward -181 -169 16.8536 0.0455
NP_440457.1_1 Forward -363 -351 1.31728 0.241
NP_441984.1_3 Reverse -164 -182 6.01734 0.276
NP_441332.1_6 Forward -279 -269 14.8416 0.141
NP_440473.1_9 Reverse -157 -176 8.94757 0.0615
NP_442509.1_9 Reverse -191 -201 13.8442 0.0448
NP_442509.1_9 Forward -177 -167 8.04271 0.192
NP_442509.1_9 Reverse -168 -178 7.84605 0.2
NP_441253.1_8 Reverse -163 -177 10.2813 0.288
NP_441159.1_8 Reverse -231 -250 1.96529 0.236
NP_440554.1_4 Forward -176 -166 8.33817 0.0773
NP_440554.1_4 Reverse -169 -179 6.96153 0.107
NP_440554.1_4 Forward -277 -267 3.02829 0.244
NP_441845.1_6 Forward -189 -171 4.54237 0.211
NP_442737.1_5 Forward -121 -102 19.9568 0.0536
NP_441885.1_5 Forward -177 -167 10.1081 0.0145
NP_441885.1_5 Reverse -122 -132 6.27322 0.0647
NP_441885.1_5 Reverse -168 -178 1.65166 0.106
NP_441428.1_8 Forward -286 -267 3.6377 0.251
NP_442341.1_7 Reverse -167 -181 4.12949 0.2
NP_441173.1_9 Forward -333 -325 14.3753 0.161
NP_441173.1_9 Forward -231 -223 10.9338 0.242
NP_441173.1_9 Reverse -157 -165 9.85212 0.275
NP_443000.1_7 Forward -179 -169 8.82982 0.0437
NP_443000.1_7 Reverse -166 -176 1.455 0.247
NP_440507.2_3 Forward -186 -167 16.1249 0.0807
NP_442513.1_6 Forward -20 -1 9.24175 0.296
NP_441842.1_10 Forward -184 -170 13.4709 0.0753
NP_441842.1_10 Reverse -262 -276 13.3726 0.0776
NP_441842.1_10 Reverse -161 -175 10.6193 0.157
NP_440275.1_3 Reverse -166 -176 10.9931 0.0397
NP_440275.1_3 Forward -179 -169 10.0098 0.0454
NP_440275.1_3 Reverse -267 -277 7.94484 0.0641
NP_440091.1_1 Reverse -164 -176 13.117 0.0313
NP_441190.1_2 Reverse -329 -348 0.196116 0.27
NP_441105.1_3 Forward -224 -205 3.73603 0.0873
NP_440216.1_1 Forward -177 -163 -3.54032 0.0833
NP_440216.1_1 Forward -213 -199 -11.6035 0.203
NP_440216.1_1 Reverse -168 -182 -12.2918 0.256
NP_440216.1_1 Reverse -269 -283 -12.5868 0.288
NP_440172.1_1 Forward -177 -167 18.5646 0.00421
NP_440172.1_1 Reverse -168 -178 6.56821 0.102
NP_440172.1_1 Reverse -342 -352 5.48657 0.143
NP_442290.1_8 Reverse -203 -217 18.8791 0.165
NP_442015.1_10 Forward -204 -191 4.14919 0.178
NP_442015.1_10 Forward -181 -168 1.29759 0.206
NP_441226.1_7 Forward -176 -169 14.4934 0.0123
NP_441226.1_7 Reverse -169 -176 14.4934 0.0123
NP_441226.1_7 Forward -277 -270 11.5435 0.0757
NP_441226.1_7 Forward -329 -322 8.29857 0.205
NP_442446.1_3 Forward -111 -92 11.1109 0.275
NP_441111.1_7 Reverse -169 -177 18.7023 0.00294
NP_441111.1_7 Forward -176 -168 8.86921 0.0589
NP_441111.1_7 Forward -277 -269 -0.570565 0.233
NP_442379.1_10 Reverse -161 -178 -2.12444 0.224
NP_441766.1_2 Forward -177 -168 17.896 0.00297
NP_441766.1_2 Reverse -168 -177 9.4395 0.0285
NP_441766.1_2 Forward -278 -269 5.21127 0.134
NP_442417.1_5 Reverse -168 -182 13.5693 0.0786
NP_440416.1_1 Forward -177 -158 3.93269 0.0702
NP_443052.1_8 Reverse -158 -177 15.0441 0.00763
NP_443052.1_8 Forward -288 -269 0.392778 0.0664
NP_442154.1_1 Reverse -112 -130 -15.2222 0.218
NP_442154.1_1 Forward -119 -101 -17.4838 0.257
NP_440261.1_5 Reverse -169 -182 -10.1088 0.201
NP_440261.1_5 Forward -176 -163 -10.6988 0.203
NP_440261.1_5 Forward -277 -264 -10.8955 0.221
NP_440988.1_10 Reverse -195 -209 4.41476 0.261
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACTACAAAGGAAGTATGGCGACCAAGGAGGAATTGTGGCGGAAGGTCGGGACATTGGCACCCAGGTTTTTCCCAACGCGGAATTGAAAATTTTCCTCACCGCTTCAGTTCAGGAACGAGCCCGCCGTCGCCTCAAGGATTTTGAAGCTCAGGGTAATCAAGCAGTGGATTTAGCCCAATTGGAAGCGGACATTGCCCACCGGGATCATCTTGATAGCACTAGGGCGATCGCTCCTTTGCAGAAGGCAGTGGATGCAGTGGAAATTATTACCGATAACCTCACCATTGCCGAGGTGGTGGAGACTATTATTGAACTTTATAAAAAATACAATAAGGGGTAATTCTGGCTAGTTTTTGAGCACTTAATAAAAGGGTTAGAATGGGTTTCAACGGCAAATAG

CDS

GTGGAGTGTCGAGGCGAATCTAAAATGCTGAAAGTAGGAAACACAAACCTAACCCTGACTGAGTTTCTAGCCTTACCGGAAGAGAAGCCGCCCCTAGAGTATCGAGATGGGCAAGTTAGTGCCAAACCTATGCCAAAAGGAAAACACAGTACTTTACAAACTGCATTGTCATTTGCCATTAACATGGCCTTGAAAAAGGAAAAAATTGCTTGGGCATTCACAGAGTTGCGTTGCAGTTTTGAAAATCGGTCTATTGTTCCTGATATTGCGGTTTTTACTTGGGAAAATATTCCCTGTGATCAAGATGGAGAAATTGCCGACAACTTTTACCTCCCGCCTAATTGGATGATTGAAATATTGTCTCCTGAGCAAAGTCAAAAAAAATAG

Protein

MECRGESKMLKVGNTNLTLTEFLALPEEKPPLEYRDGQVSAKPMPKGKHSTLQTALSFAINMALKKEKIAWAFTELRCSFENRSIVPDIAVFTWENIPCDQDGEIADNFYLPPNWMIEILSPEQSQKK